Mini Shell

Direktori : /proc/thread-self/root/var/lib/rpm/
Upload File :
Current File : //proc/thread-self/root/var/lib/rpm/__db.003

��9����������������������������������������������������������������������������������"'�$'���%��������������������������� �0hP�*�m�5K)0��'>�'���>�ʭZ>�l<*`!J-�jX!p!8!8!8���������������p�������8����������������8�������������������������������������������������	��������
������������������������
������������������������� ������������������������������������������������P�����������@�����������������8/0��=	�n�G�
����������
��
P<�������������� X���!���"��e#XN(�$���U%��	�&��x�'��������(`x)��
�u*0�H�+��!,�l�C-x�8�. '*/a@�0 0818�
P2`�H3��
`�	4h��5j
X�6�G	�G	7h � 8h"��	9p��:W W;��<��������=X���>�x
�^?�5�-@>лAp�MB���	C(\�LDP���E����F0�KG��L
H�vmI("��
J�fȿ
K���L���M8	��Nn�O(���	PXr0�Q �AR�0*S-��
Tp��{U��
ج
VxG�Y
Wh���X`ZxZY����Z@�X�[0I �\`�8L]���^8P�_@�p`����a��Зb��������c��������d�LMeȨ��f��]gHv(�h�n��
i���j�Yh�	kHf�al`�p�m��������n(/��o�l	m	p`�x�q��������r��������s8�P�t��������u���v�>w��x
x��������y�z�
z00{�P��|@�X�}����~���������������������������%�%��5�5������؊��8�	 {�h2�����I��X���p����%
h���b�p��~p�
��&�n�OH����8}�6(
��p5�X��T	�3 3������		�������������������(�������������x�������x������������������������������HX����������������������H��5nnn`&��������@����������^ ����� &�&H�����������������������H��~��@�@����������������@������@	Packages@����������������������@�������������������������X�@m�P������*�$
�����������������*�*�*�.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libc.so.6(GLIBC_2.8)(64bit)libpopt.so.0()(64bit)libpopt.so.0(LIBPOPT_0)(64bit)libselinux.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.14.0-6.el83.0.4-14.6.0-14.0-15.2-14.14.3c���cr-�^���[m~@[E�@Z�w@Z��@Z|;�Y�Y�@Yx�@YV=@Yt�X��@X��@X��@XIK@XAb@X6�@X%��W�:�W��W�g�W�~�V�@V�=@V�v�U�a@U��U��T��@T?�@S�@S�@S���RV��Q��@Q�L�Q���Q�'@Q�@Q�Pmz@P��P��O?@N���Nf@N?�N6�@N)f@N&�@N��M��@M�M�x@M�=�MQ0@MIG@M��L��@L�*@L_�L(��L ��Lk@K͗@K͗@K�"@KK�K�@J���J�$�Jj�I�2�I��@I&��I%Q@I%Q@H1k�H$�G�8�G��@G��@G��@F��@F��@F�v�F�^�F^��FT,�FM@F�@E�@E�b@E��E���E��@E���E�=�E��E@D��@DĶ@D��@D���D���Dk@D)%@C�@C�C�q�Cw*�Cu�@Ct��CoA�C^@CW��CT�CP�@CL��CJW�C3�@C�@C&�B��B�%�B�%�B�R�BK�@B9q@B9q@B�B�A��@A��@A�I�Au�@��@@��@,�@@@?Xz�?Xz�?0�?�@?�@?�>+�>#��=��=�<���<�?@<V��<��<�;�s�;��@;�M@;i@�;@b@;1�;��:Te�:S@9�0�9z�@9k@9L��8�@8�m�Kamil Dudka <kdudka@redhat.com> - 3.14.0-6Kamil Dudka <kdudka@redhat.com> - 3.14.0-5Kamil Dudka <kdudka@redhat.com> - 3.14.0-4Kamil Dudka <kdudka@redhat.com> - 3.14.0-3Kamil Dudka <kdudka@redhat.com> - 3.14.0-2Kamil Dudka <kdudka@redhat.com> - 3.14.0-1Kamil Dudka <kdudka@redhat.com> - 3.13.0-3Fedora Release Engineering <releng@fedoraproject.org> - 3.13.0-2Kamil Dudka <kdudka@redhat.com> - 3.13.0-1Fedora Release Engineering <releng@fedoraproject.org> - 3.12.3-3Fedora Release Engineering <releng@fedoraproject.org> - 3.12.3-2Kamil Dudka <kdudka@redhat.com> - 3.12.3-1Kamil Dudka <kdudka@redhat.com> - 3.12.2-1Kamil Dudka <kdudka@redhat.com> - 3.12.1-1Fedora Release Engineering <releng@fedoraproject.org> - 3.11.0-4Kamil Dudka <kdudka@redhat.com> - 3.11.0-3Kamil Dudka <kdudka@redhat.com> - 3.11.0-2Kamil Dudka <kdudka@redhat.com> - 3.11.0-1Kamil Dudka <kdudka@redhat.com> - 3.10.0-4Kamil Dudka <kdudka@redhat.com> - 3.10.0-3Kamil Dudka <kdudka@redhat.com> - 3.10.0-2Kamil Dudka <kdudka@redhat.com> - 3.10.0-1Kamil Dudka <kdudka@redhat.com> - 3.9.2-5Kamil Dudka <kdudka@redhat.com> - 3.9.2-4Marcin Juszkiewicz <mjuszkiewicz@redhat.com> - 3.9.2-3Fedora Release Engineering <releng@fedoraproject.org> - 3.9.2-2Jan Kaluza <jkaluza@redhat.com> - 3.9.2-1Jan Kaluza <jkaluza@redhat.com> - 3.9.1-2Jan Kaluza <jkaluza@redhat.com> - 3.9.1-1Jan Kaluza <jkaluza@redhat.com> - 3.9.0-1Jan Kaluza <jkaluza@redhat.com> - 3.8.9-1Jan Kaluza <jkaluza@redhat.com> - 3.8.8-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 3.8.7-4Tom Callaway <spot@fedoraproject.org> - 3.8.7-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 3.8.7-2Jan Kaluza <jkaluza@redhat.com> - 3.8.7-1Jan Kaluza <jkaluza@redhat.com> - 3.8.6-1Jan Kaluza <jkaluza@redhat.com> - 3.8.5-2Jan Kaluza <jkaluza@redhat.com> - 3.8.5-1Jan Kaluza <jkaluza@redhat.com> - 3.8.4-2Jan Kaluza <jkaluza@redhat.com> - 3.8.4-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 3.8.3-2Jan Kaluza <jkaluza@redhat.com> 3.8.3-1Jan Kaluza <jkaluza@redhat.com> 3.8.2-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 3.8.1-4Jan Kaluza <jkaluza@redhat.com> 3.8.1-3Jan Kaluza <jkaluza@redhat.com> 3.8.1-2Jan Kaluza <jkaluza@redhat.com> 3.8.1-1Jan Kaluza <jkaluza@redhat.com> 3.8.0-5Jan Kaluza <jkaluza@redhat.com> 3.8.0-4Jan Kaluza <jkaluza@redhat.com> 3.8.0-3Jan Kaluza <jkaluza@redhat.com> 3.8.0-2Jan Kaluza <jkaluza@redhat.com> 3.8.0-1Jan Kaluza <jkaluza@redhat.com> 3.7.9-11Jan Kaluza <jkaluza@redhat.com> 3.7.9-10Jan Kaluza <jkaluza@redhat.com> 3.7.9-9Jan Kaluza <jkaluza@redhat.com> 3.7.9-8Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 3.7.9-7Jan Kaluza <jkaluza@redhat.com> 3.7.9-6Jan Kaluza <jkaluza@redhat.com> 3.7.9-5Jan Kaluza <jkaluza@redhat.com> 3.7.9-4Jan Kaluza <jkaluza@redhat.com> 3.7.9-3Jan Kaluza <jkaluza@redhat.com> 3.7.9-2Jan Kaluza <jkaluza@redhat.com> 3.7.9-1Jan Kaluza <jkaluza@redhat.com> 3.7.8-12Jan Kaluza <jkaluza@redhat.com> 3.7.8-11Jan Kaluza <jkalx���������8��������������� �8 	�������������������������-&x����������������x�xProvidename����������������p������@�����������������0�������X�m�g
�fg��$w����������������g�f�h�� regression fix- rebase to 23.1.0- Fix vulkan sw with wayland, pull in .4 + .5 fixes- rebase to 21.1.3- rebuild against llvm 12- Update to 21.1.1- Update to 20.3.3 + upstream fixes for qemu regression- Update to 20.3.2 for upstream fixes- Update to 20.3.1 for radeon fix- Fix regression with radeon si/cik cards- Update to 20.3.0 release- Update 20.3.0-rc2
- enable lavapipe behind env var so it can be used for testing- Update to 20.1.4
- Update nouveau tu1xx support patch (Karol)- a fix on top of the big-endian fix (#1847064)- add another fix for big-endian llvmpipe (#1847064)- Update to 20.1.2
- add fix for big-endian llvmpipe (#1847064)- Update to 20.1.1
- Add support for turing- Update to 20.1.0 final- Update to 20.1.0-rc4- Fix put image shm fallback path.- Update to 19.3.4 release (s390x fix)- Update to 19.3.3 release- drop khr-devel subpackage from here- sort out libglvnd requires- mesa-19.3.0-rc4- Add CET support to asm files- mesa-19.1.4- mesa-19.1.0-rc5- mesa-19.1.0-rc4- mesa-19.1.0-rc3
- disable asserts explicitly- mesa 19.1.0-rc2
- bring back glesv2.pc- mesa 19.1.0-rc1- Fix remote shm detection again- Fix remove shm detection- Add shm leak fix- fix shm swrast- Mesa 18.3.1 - move to release- Rebuild for LLVM 7.0.1- Mesa 18.3.0 RC2
- Drop python3 build system backport
- Drop no-longer-necessary big-endian build fix
- Re-enable 10bpc fbconfigs- Mesa 18.2.2- Mesa 18.2.1
- Fix "HW cursor for format" error message flood with swrast- Drop unneeded BuildRequires: makedepend- mesa 18.2.0- Fix crash on screen resolution change
  Resolves: #1616390- Rebuild for LLVM 6.0- rename fallback for glvnd- Mesa 18.1.3- Disable arm-specific drivers
- Use alternate glvnd indirect library name- Mesa 18.1.2- Mesa 18.0.5- Mesa 18.0.3
- Disable old drivers: radeon, r200, r300, i915, vieux- Disable omx/opencl/nine- Mesa 18.0.2- Use llvm-toolset- Update to 17.3.6- Backport patch to fix video corruption- Update to 17.3.5- Update to 17.3.4- Update to 17.3.3- Update to 17.3.1- Sanitize tarball- Update to 17.3.0-rc3- Update to 17.3.0-rc2- Update to 17.2.4 GA- Rebuild for LLVM 5.0.0- 17.2.3, bugfix release.- Fix for vc4/Raspberry Pi- enable vulkan on 32-bit x86- Backport S3TC support from master- Update to 17.2.2 GA- Update to 17.2.1 GA- Add upstream patch for glibc xlocale.h change (fdo bz 102454)- Update to 17.2.0 GA- Update to 17.2.0-rc6- Update to 17.2.0-rc5- Update to 17.2.0-rc4- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Update to 17.1.5- Stop replacing eglext.h, we're up to date again- Update to 17.1.4- Fixes and perf improvements for vc4- Update to 17.1.3- Some etnaviv fixes- Update to 17.1.2- Disable BGRA8 images on Fermi- Update to 17.1.1- Update to 17.1.0- Update to 17.1.0-rc4- Enable renderonly support for i.MX SoC (rhbz #1424714)- Update to 17.1.0-rc2- Update to 17.1.0-rc1- Update to 17.0.3- Rebuild for LLVM4- Update to 17.0.2- Fix glXGetDriverConfig not working with glvnd (rhbz#1429894)
- Fix indirect rendering, add libGLX_indirect.so.0 symlink (rhbz#1427174)- Rebuild for aarch64 llvmpipe fix (rhbz 1429050)- Update to 17.0.1- 17.0.0 GA- Update to 17.0.0-rc3- Fix GLX_SGIX_fbconfig extension dispatching with glvnd, this fixes games such
  as "The Binding of Isaac: Rebirth" and "Crypt of the NecroDancer" from Steam- Update eglext.h to 20161230 version this brings in some new defines needed
  by some apps / libraries- Update to 17.0.0-rc2- Enable etnaviv gallium driver- Update to 17.0.0-rc1- Enable libglvnd support (rhbz#1413579)- Add valgrind BuildRequires to have valgrind support- 13.0.3 GA- Use nettle for sha1- 13.0.2 GA- 13.0.1 GA- Don't ship duplicate vulkan devel headers- Add options for enabling vulkan components
- Enable intel/radeon vulkan drivers- 13.0.0 GA- rebuild for llvm 3.9- 13.0.0-rc2- 13.0.0-rc1- Add 2 patches from upstream to fix DRI3 vaapi crashes (rhbz1309446, fdo71759)- 12.0.�x����������������������X��k@��������ɳ�$Y����������������ɳʳ(��78862 (link() silently truncates after a null byte on Windows). (CVE-2019-11044)
- Updated Litespeed SAPI to 7.6- ZC-4361: Update ea-openssl requirement to v1.1.1 (ZC-5583)- EA-8762: Update litespeed from upstream to 7.6- EA-8722: Update scl-php71 from v7.1.32 to v7.1.33- Apply allow_coredump patch for MODLS-694- EA-8549: Build php-fpm with pcntl- MODLS-689: Apply crash_limit patch- EA-8634: Update scl-php71 from v7.1.31 to v7.1.32- EA-8595: Update scl-php71 from v7.1.30 to v7.1.31- EA-8576: Update litespeed from upstream to 7.5- EA-8558: Update litespeed from upstream to 7.4.2- Update litespeed 7.4.3 version- AAP-272: fix error with uid comparison- EA-8538: Update litespeed from upstream to 7.4- Updated to version 7.1.30 via update_pkg.pl (EA-8516)- AAP-254: php-fpm enters lve 48- ZC-5063: Add PLESK Signal Managment patches for PHP-FPM- Updated to version 7.1.29 via update_pkg.pl (EA-8431)- ZC-5036: Add find-latest-version (assumes PHP is checked out next ro ea-tools)- EA-8342: Update litespeed to new upstream update of 7.3- EA-8342: Update litespeed to 7.3- Apply graceful_stop patch to ea-php- Updated to version 7.1.28 via update_pkg.pl (EA-8316)- LSAPI sem_timedwait synchronization fixed- Updated to version 7.1.27 via update_pkg.pl (EA-8267)- MODLS-627: Fix php_value priority issue 
- MODLS-626: Update LiteSpeed patches for V 7.2- EA-8170: Update litespeed to the latest version (7.2)- EA4D-129: Apply mod_lsapi_mode patch- enable cloudlinux-php-fpm.7.1.dl.ea-php.v2.patch- Updated to version 7.1.26 via update_pkg.pl (EA-8133)- Updated to version 7.1.25 via update_pkg.pl (EA-8048)- EA4D-116: Update SIGTERM cleanup patch- Updated to version 7.1.24 via update_pkg.pl (EA-8003)- EA-7957: Added ea-apache24-mod_proxy_fcgi as a dependency of php-fpm.- Updated to version 7.1.23 via update_pkg.pl (EA-7904)- Updated to version 7.1.22 via update_pkg.pl (EA-7833)- EA-7786 - Update PHP Source- MODLS-545: KeepListener behavior disabled to prevent lsphp DoS- Fixed php-fpm installing directories it does not own (EA-7526)- Updated to version 7.1.20 via update_pkg.pl (EA-7707)- ALTPHP-539: Improved Litespeed SIGTERM cleanup handling patch- ALTPHP-526: Updated patch for Litespeed SIGTERM cleanup handling- Updated to version 7.1.19 via update_pkg.pl (EA-7604)- ALTPHP-511: added patches to avoid creating zombies when using lsphp- EA-7359: Ensure ea-libxml2 is listed as a requirement for the php-xml package.- Updated to version 7.1.18 via update_pkg.pl (EA-7506)- EA4D-65: Added patch for LiteSpeed SIGTERM cleanup- Updated to version 7.1.17 via update_pkg.pl (EA-7422)- EA4D-53: Update LSAPI to 7.1
- ALTPHP-491: add use_reject to LSPHP- ZC-3604: Update litespeed to the latest version (7.1).- EA-7382: Update dependency on ea-openssl to require the latest version with versioned symbols.- EA4D-4: Duplications in cli and litespeed were removed- EA-7351: Update to v7.1.16, drop v7.1.15- ZC-3552: Added versioning to ea-openssl and ea-libcurl requirements.- ZC-3475: Update for ea-openssl shared object- EA4D-50: Change ea-openssl directory to /opt/cpanel/ea-openssl- Updated to version 7.1.15 via update_pkg.pl (EA-7264)- Updated to version 7.1.14 via update_pkg.pl (EA-7204)- HB-3287: Increase open file limit for php-fpm by default- Filter libxml2.so from requires- HB-3263: Ensure securetmp is done before starting FPM- EA-7044: Adjust PHPs to use ea-libxml2- HB-3061: Fix epoll bug.- ALTPHP-424: Add timestamps to LSPHP log messages- Updated to version 7.1.13 via update_pkg.pl (EA-7070)- Updated to version 7.1.12 via update_pkg.pl (ZC-3097)- EA-6812: build PHP against ea-openssl like Apache- Updated to version 7.1.11 via update_pkg.pl (EA-6935)- EA-6866: Update mail-header patch for segfaults under Apache- EA-4653: Update mail header patch for 7.1- HB-2873: Added network-online.target to "After" in the service file- EA-6819: Patch to support libtidy 5.4.0- Updated to version 7.1.10 via update_pkg.pl (EA-6850)- Update to 7.1.10- ALTPHP-380: added user.ini loo�x�������������������X[�l��������Gq������$a����������������q�p�r��k)
- groups: marks reason 'group' for packages that have no record yet (RhBug:1136584) (Jan Silhan)
- goal: renamed undefined name variable (Jan Silhan)
- refactor: split out and clean up the erase command. (Ales Kozumplik)
- py3: fix traceback in fmtColumns() on a non-subscriptable 'columns'. (Ales Kozumplik)
- groups: allow erasing depending packages on remove (RhBug:1135861) (Ales Kozumplik)
- history: fixed wrong set operation (RhBug:1136223) (Jan Silhan)
- base: does not reinstall pkgs from local rpms with install command (RhBug:1122617) (Jan Silhan)
- refactor: crypto: drop the integer keyid representation altogether. (Ales Kozumplik)
- crypto: fix importing rpmfusion keys. (RhBug:1133830) (Ales Kozumplik)
- refactor: crypto: Key is a class, not an "info" dict. (Ales Kozumplik)
- repos: fix total downloaded size reporting for cached packages. (RhBug:1121184) (Ales Kozumplik)- packaging: add dnf-yum. (Ales Kozumplik)
- cli: added plugins missing hint (RhBug:1132335) (Jan Silhan)
- using ts.addReinstall for package reinstallation (RhBug:1071854) (Jan Silhan)
- Add history redo command. (Radek Holy)
- Add a TransactionConverter class. (Radek Holy)
- bash-completion: complete `help` with commands (Igor Gnatenko)
- bash-completion: generate commands dynamically (Igor Gnatenko)
- base: group_install accepts glob exclude names (RhBug:1131969) (Jan Silhan)
- README: changed references to new repo location (Jan Silhan)
- transifex update (Jan Silhan)
- syntax: fixed indentation (Jan Silhan)
- removed lt.po which was accidentally added in c2e9b39 (Jan Silhan)
- lint: fix convention violations in the new source files (Radek Holy)
- Fix setting of the resolving demand for repo-pkgs command. (Radek Holy)
- Add repository-packages remove-or-distro-sync command. (RhBug:908764) (Radek Holy)
- fix: traceback that GroupPersistor._original might not exist. (RhBug:1130878) (Ales Kozumplik)
- pycomp: drop to_ord(). (Ales Kozumplik)
- refactor: crypto.keyids_from_pubring() using _extract_signing_subkey(). (Ales Kozumplik)
- fix: another 32-bit hex() problem in crypto. (Ales Kozumplik)
- remove: pgpmsg.py. (Ales Kozumplik)
- replace the whole of pgpmsg.py with gpgme and a dummy context. (Ales Kozumplik)
- cosmetic: sort methods of Repo according to the coding standard. (Ales Kozumplik)
- Fix dnf.crypto.keyinfo2keyid(). (Ales Kozumplik)
- util: get rid of an inconvenient 'default_handle' constant. (Ales Kozumplik)
- simplify misc.import_key_to_pubring()'s signature. (Ales Kozumplik)
- cleanup: header of dnf.yum.pgpmsg. (Ales Kozumplik)
- crypto: add crypto.retrieve() and drop Base._retrievePublicKey() (Ales Kozumplik)
- cosmetic: order of functions in dnf.crypto. (Ales Kozumplik)
- unicode: fixed locale.format error (RhBug:1130432) (Jan Silhan)
- remove: misc.valid_detached_sig(). (Ales Kozumplik)
- tests: some tests for dnf.crypto. (Ales Kozumplik)
- crypto: use pubring_dir() context manager systematically. (Ales Kozumplik)
- Drop unused argument from getgpgkeyinfo(). (Ales Kozumplik)
- remove: Base._log_key_import(). (Ales Kozumplik)
- doc: cosmetic: conf_ref: maintain alphabetical order of the options. (Ales Kozumplik)
- crypto: document crypto options for repo. (Ales Kozumplik)
- crypto: fixup procgpgkey() to work with Py3 bytes. (Ales Kozumplik)
- dnf.util.urlopen(): do not create unicode streams for Py3 and bytes for Py2 by default. (Ales Kozumplik)
- lint: delinting of the repo_gpgcheck patchset. (Ales Kozumplik)
- Add CLI parts to let the user confirm key imports. (RhBug:1118236) (Ales Kozumplik)
- gpg: make key decoding work under Py3. (Ales Kozumplik)
- crypto: add dnf.crypto and fix things up so untrusted repo keys can be imported. (Ales Kozumplik)
- transifex update (Jan Silhan)
- syntax: fixed indentation (Jan Silhan)
- packaging: pygpgme is a requirement. (Ales Kozumplik)
- remove: support for gpgcakey gets dropped for now. (Ales Kozumplik)
- repo: smarter _DetailedLibrepoError construction. (Ales Kozumplik)
- repo: nicer error message on librepo's perform() failure. (Ales Kozumplik)
- get_best_sel�x�������������h��������XD/m�H�"������$2����������������"�!�#��.6.31-2.cloudlinux.1Dan Muey <dan@cpanel.net> - 5.6.31-2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> 5.6.31-1.cloudlinux.1Dmitriy Kasyanov <dkasyanov@cloudlinux.com> 5.6.31-1.cloudlinuxDmitriy Kasyanov <dkasyanov@cloudlinux.com> 5.6.30-15.cloudlinuxDan Muey <dan@cpanel.net> - 5.6.30-15Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.30-14Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.6.30-13.cloudlinux.2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.6.30-13.cloudlinux.1Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.30-13Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.30-12Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.30-11Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.30-10Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.30-9Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.30-8Dan Muey <dan@cpanel.net> - 5.6.30-7Cory McIntire <cory@cpanel.net> - 5.6.30-6Cory McIntire <cory@cpanel.net> - 5.6.30-5Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.6.30-4.cloudlinux.3Eugene Zamriy <ezamriy@cloudlinux.com> - 5.6.30-4.cloudlinux.2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.6.30-4.cloudlinux.1Dan Muey <dan@cpanel.net> - 5.6.30-4Dan Muey <dan@cpanel.net> - 5.6.30-3Dan Muey <dan@cpanel.net> - 5.6.30-2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 1:5.6.30-1.cloudlinux.2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 1:5.6.30-1.cloudlinux.1Eugene Zamriy <ezamriy@cloudlinux.com> - 1:5.6.29-1.cloudlinux.2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.6.29-1.cloudlinux.1Dan Muey <dan@cpanel.net> - 5.6.28-6S. Kurt Newman <kurt.newman@cpanel.net> - 5.6.28-5Matt Dees <matt.dees@cpanel.net> 5.6.28-4S. Kurt Newman <kurt.newman@cpanel.net> - 5.6.28-3Edwin Buck <e.buck@cpanel.net> - 5.6.28-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.28-1Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.6.27-2.cloudlinux.1Julian Brown <julian.brown@cpanel.net> 5.6.27-2Edwin Buck <e.buck@cpanel.net> 5.6.27-1Jacob Perkins <jacob.perkins@cpanel.net> 5.6.26-2Eugene Zamriy <ezamriy@cloudlinux.com> - 5.6.26-1.cloudlinux.2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.6.26-1.cloudlinux.1Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.26-1Matt Dees <matt@cpanel.net> - 5.6.25-3S. Kurt Newman <kurt.newman@cpanel.net> - 5.6.25-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.25-1Eugene Zamriy <ezamriy@cloudlinux.com> - 1:5.6.24-1.cloudlinux.1Edwin Buck <e.buck@cpanel.net> - 5.6.24-1Matt Dees <matt@cpanel.net> - 5.6.23-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.23-1Dan Muey <dan@cpanel.net> - 5.6.22-5S. Kurt Newman <kurt.newman@cpanel.net> - 5.6.22-4Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.22-3Alexey Berezhok <aberezhok@cloudlinux.com> - 1:5.6.22-2.cloudlinux.1Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.22-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.22-1Sergey Fokin <sfokin@cloudlinux.com> - 1:5.6.21-1.cloudlinux.1Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.21-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.6.20-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.20-1Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.19-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.6.18-3S. Kurt Newman <kurt.newman@cpanel.net> - 5.6.18-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.18-1David Nielson <david.nielson@cpanel.net> - 5.6.17-2Sergey Fokin <sfokin@cloudlinux.com> - 1:5.6.17-1.2.cloudlinux.1Sergey Fokin <sfokin@cloudlinux.com> - 1:5.6.17-1.2.cloudlinuxJacob Perkins <jacob.perkins@cpanel.net> - 5.6.17-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.45-7Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.16-4S. Kurt Newman <kurt.newman@cpanel.net> - 5.6.16-3Dan Muey <dan@cpanel.net> - 5.6.16-2Kurt Newman <kurt.newman@cpanel.net> - 5.6.16-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.6.15-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.15-1Dan Muey <dan@cpanel.net> - 5.6.14-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.14-1Trinity Quirk <trinity.quirk@cpanel.net> - 5.6.13-1Kurt Newman <kurt.newman@cpanel.net> - 5.6.12-1Trinity Quirk <trinity.quirk@cpanel.net> - 5.6.6-6Darren Mobl�x�����p�������X��k����������h�$V�����������������h�h�h�//fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Cleanup spec file conditionals- Python 2 binary package renamed to python2-pytz
  See https://fedoraproject.org/wiki/FinalizingFedoraSwitchtoPython3- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Update to 2017.2- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Enable tests- Rebuild for Python 3.6
- Disable python3 tests for now- Update to 2016.10- Update to 2016.7- Update to 2016.6.1 (RHBZ #1356337)
- Fix Source0 URL to override a change in PyPI URLs (see
  https://bitbucket.org/pypa/pypi/issues/438/)- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- Use proper PYTHONPATH with python3 test
- Use %license
- Drop BuildRoot and %clean- Update to 2016.4 (RHBZ #1265036)- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for Python3.5 rebuild- Update to 2015.7- Update to 2015.4 (bug #1161236)
- Do not ship zoneinfo with python3 package (bug #1251554)
- Run tests- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Changes/Python_3.4- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- remove rhel logic from with_python3 conditional- Use system zoneinfo, BZ 857266.- Latest upstream, python3 support, BZ 851226.- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Features/Python_2.7/MassRebuild- Define => global- Update to current version, BZ 573252.- Corrected Source0 URL, BZ 560168.- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Rebuild for Python 2.6- Apply patch correctly.- Updated tzdata patch from Petr Machata bug 471014- Update to latest, now using timezone files provided by tzdata package- Fix for egg-info file creation- Bump for rebuild against python 2.5 and change BR to python-devel accordingly- Update to 2006p- Update to 2006g- Rebuild for gcc/glibc changes- Update to 2005r- Update to 2005m- Remove -O1 from install command- Initial Fedora Extras package	

��2017.2-11.el82017.22017.2pytzpytz-2017.2-py3.6.egg-infoPKG-INFOSOURCES.txtdependency_links.txttop_level.txtzip-safe__init__.py__pycache____init__.cpython-36.opt-1.pyc__init__.cpython-36.pycexceptions.cpython-36.opt-1.pycexceptions.cpython-36.pyclazy.cpython-36.opt-1.pyclazy.cpython-36.pycreference.cpython-36.opt-1.pycreference.cpython-36.pyctzfile.cpython-36.opt-1.pyctzfile.cpython-36.pyctzinfo.cpython-36.opt-1.pyctzinfo.cpython-36.pycexceptions.pylazy.pyreference.pytzfile.pytzinfo.pypython3-pytzCHANGES.txtREADME.txtpython3-pytzLICENSE.txt/usr/lib/python3.6/site-packages//usr/lib/python3.6/site-packages/pytz-2017.2-py3.6.egg-info//usr/lib/python3.6/site-packages/pytz//usr/lib/python3.6/site-packages/pytz/__pycache__//usr/share/doc//usr/share/doc/python3-pytz//usr/share/licenses//usr/share/licenses/python3-pytz/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -march=z13 -mtune=z14 -fasynchronous-unwind-tables -fstack-clash-pr�x�������������xt�������X��l��/�$?����������������/X?`?�d���$�	0�	<�h�l�����	���������	�
���
����l�(58<9L:�G�H�I�X�Y�\�]�^b�d�e�f�l�tu v,�l�p�v����
�	�LPTgXh\Ccpanel-perl-542-net-ipv4addr0.101.cp130~el8CPAN moduleCpanel build perl module 'Net::IPv4Addr'hȵbh-centos-8.dev.cpanel.net.5perlcpanel/perlhttps://metacpan.orglinuxnoarch3&�[��$�$hȵ9�dhhȵ86285c359b777272c02fd1b0df51fa9c9df93e7a6d115adfdf05f6e09b31b5b535943c534801bd976d493be42fb192407735bc455c5d1d986f0d52d644a161cdd22954a8c5ebf2eb591863e46c707aa4266b7be6b24f2f1da19b17f289b89ce3rootrootrootrootrootrootcpanel-perl-542-net-ipv4addr-0.10-1.cp130~el8.src.rpm������������cpanel-perl(Net::IPv4Addr)cpanel-perl-542-net-ipv4addrcpanel-perl-net-ipv4addr




cpanel-perl-542rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h?�b�@`-@Q+R@Busy Camels <bc@cpanel.net> - 0.10-1.cp130Busy Camels <bc@cpanel.net> - 0.10-1.cp108Busy Camels <bc@cpanel.net> - 0.10-1.cp1198Todd Rinaldo <toddr@cpanel.net> - 0.10-1.cp1136- Bump to 1.cp130 for re-build- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Net-IPv4Addr 0.100.100.10-1.cp130~el80.10ipv4calcIPv4Addr.pmautosplit.ix/usr/local/cpanel/3rdparty/perl/542/bin//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Net//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/auto/Net/IPv4Addr/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl script text executablePerl5 module source textASCII textutf-8b2e2cd4c44789c8f7adea88ea941d21b8bef2dc4f452ab344df54535b768cc69?����Ԉ���6�m�#����+�4b70403bf815ffc3c2682e47da203b66cb3a28a5602b45996e6b82083c36fd457520e705234ad6e71922271124e3bcdd7934a00ai?�z0�i?�sr_probe() helper (Jaroslav Kysela) [2065575]
- ASoC: codecs: pcm3168a: Use dev_err_probe() helper (Jaroslav Kysela) [2065575]
- ASoC: codecs: max9860: Use dev_err_probe() helper (Jaroslav Kysela) [2065575]
- ASoC: codecs: max9759: Use dev_err_probe() helper (Jaroslav Kysela) [2065575]
- ASoC: codecs: es7241: Use dev_err_probe() helper (Jaroslav Kysela) [2065575]
- ASoC: codecs: ak4118: Use dev_err_probe() helper (Jaroslav Kysela) [2065575]
- ASoC: Intel: catpt: Streamline locals declaration for PCM-functions (Jaroslav Kysela) [2065575]
- ASoC: Intel: catpt: Reduce size of catpt_component_open() (Jaroslav Kysela) [2065575]
- ASoC: tegra20: spdif: Improve driver's code (Jaroslav Kysela) [2065575]
- ASoC: tegra20: spdif: Support device-tree (Jaroslav Kysela) [2065575]
- ASoC: tegra20: spdif: Set FIFO trigger level (Jaroslav Kysela) [2065575]
- ASoC: SOF: Kconfig: Make the SOF_DEVELOPER_SUPPORT depend�x��������������c�������X��k���������~������˳�$[����������������˳̳ʳ�memory limit error during string reallocation correctly
- CVE-2020-7071: avoid parse_url() returning a wrong host to user- EA4D-789: Security fixes
- CVE-2024-8929: fix various heap buffer over-reads for mysqlnd- EA4D-789: Security fixes
- CVE-2024-11233: fix single byte overread with convert.quoted-printable-decode
  filter
- CVE-2024-11234: fix HTTP fulluri CRLF injection
- Bug #74960: fix heap buffer overflow via str_repeat
- CVE-2024-11236: prevent integer overflow in quoters causing OOB writes- EA4D-789: Security fixes
- CVE-2024-8925: Fix data integrity violation while parsing multipart/form-data
  boundaries larger than the read buffer
- CVE-2024-8927: Fix bypass of cgi.force_redirect configuration- ALTPHP-1839: Change lsapi naming- Fix for hardened PHP
- CVE-2024-5458: Fix early-out for ipv6 hostname validation, ensure full check
  is performed- Fix for hardened PHP
- CVE-2024-2756: fix __Host-/__Secure-cookie bypass due to partial
  CVE-2022-31629 fix
- CVE-2024-3096: Disallow null character in bcrypt password to fix bug causing
  password_verify to erroneously return true- build for rhel8 with system openssl- EA-11821: Patch to build with the latest ea-libxml2
- ZC-10950: Add debug_package nil back w/ second directive (3rd item will be ZC-10951)
- ZC-10936: Clean up Makefile and remove debug-package-nil- CVE-2023-3247: Fix missing randomness check for SOAP HTTP Digest- Fix for hardened PHP
- CVE-2023-3823: Fix external entity loading in XML without enabling by
  sanitizing libxml2 globals before parsing
- CVE-2023-3824: Fix buffer mismanagement in phar_dir_read()- Fix for hardened PHP
- CVE-2023-0567: Fix validation of malformed BCrypt hashes
- CVE-2023-0568: Fix array overrun when appending slash to paths
- CVE-2023-0662: Fix DOS vulnerabality by limiting number of parsed
  multipart body parts and printing upload limit exceed error message only once- Fix for Harden PHP
- CVE-2022-31631: Fix integer overflow that could cause PDO::quote() to return an improperly quoted string- Fix for harden PHP
- CVE-2022-31628: Fix potential infinite recursion in phar wrapper when using quine gzip file
- CVE-2022-31629: Add cookie integrity validation- Fix for Harden PHP
- CVE-2021-21705: add user name and password validation in filters module- ELS-189: Fix for Harden PHP
- CVE-2022-31625: Fix freeing of uninitialized memory leading to RCE
- CVE-2022-31626: Fix buffer overflow in mysqlnd driver leading to RCE- EA-10532: Update litespeed to 8.0.1- ZC-9589: Update DISABLE_BUILD to match OBS- CVE-2021-21703: fix error in php fpm shared memory organization leading to privilage escalation
- CVE-2021-21707: fix handling of paths with percent encoded NULL byte- ALTPHP-1190: Update hardened php- ALTPHP-1164: Update hardened php
- EA4D-293: Added unixIDBC requires- EA-9013: Disable %check section- ALTPHP-1132: Update hardened php- EA4D-266: Update hph-fpm lve patch 
- ALTPHP-1102: Update Litespeed patches for litespeed-7.9- EA-9625: Update litespeed to 7.9- ALTPHP-1053: Update move_override_ini patch
- ALTPHP-1038: Update litespeed log patch- Fix Bug #73809: Phar Zip parse crash - mmap fail
- Fix Bug #77322: PharData::addEmptyDir('/') Possible integer overflow
- Fix Bug #77961: Slow reqursive functions with MySQL
- Fix Bug #80366: Potential issue in ext/standard/iptc.c: Return Value Not Checked
- Fix Bug #80411: References to null-serialized object break serialize()- AAP-178: Added disable killing of PHP-FPM parent process in LVE when not enough of memory- Update to the latest version- ALTPHP-1017: revert #79825- ALTPHP-997: Fix Local-Master values after updating LiteSpeed- ZC-7893: Update DSO config to factor in PHP 8- EA-9390: Fix build with latest ea-brotli (v1.0.9)- Fix for build for CentOS 8- Fix bug #79601: Wrong ciphertext/tag in AES-CCM encryption for a 12 bytes IV (CVE-2020-7069)
- Fix bug #79699: PHP parses encoded cookie names so malicious `__Host-` cookies can be sent (CVE-2020-7070)
- Fix bug #79825: opcache.file_cache causes SIGSEGV when custom opcode handlers c�x�������������XS�������X�Bm(�x]�������*�$�����������������*�*�*�<pbrown@redhat.com> 3.5.6-1Preston Brown <pbrown@redhat.com> 3.5.5-1Bill Nottingham <notting@redhat.com>Preston Brown <pbrown@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Matt Wilson <msw@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>- enforce stricter parsing of config files (#2148925)- create /var/log/btmp with mode 0660 (#2061561)- logrotate.8: encourage admins to use the `su` directive (#1759770)
- do not abort globbing on broken symlink (#1723265)- fix programming mistakes detected by Coverity Analysis
- document the --version option in the logrotate(8) man page (#1611498)- fix license tag to match the source code license- new upstream version 3.14.0- add explicit BR for the gcc compiler- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- new upstream version 3.13.0- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- new upstream version 3.12.3- new upstream version 3.12.2- new upstream version 3.12.1- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- mark cron.daily/logrotate as config file (#1174207)- make the package build on RHEL-6, too- build out of source tree
- new upstream version 3.11.0- make /var/lib/logrotate/logrotate.status the default state file (#1381719)- fix migration of state file from its previous location (#1393247)- own /etc/cron.daily because no dependency of logrotate installs it
- do not explicitly declare mode for each single installed file- document default state file used by logrotate cron job (#1357215)
- modernize spec file
- new upstream version 3.10.0- do not log to syslog by default (#1304828)- make the /var/lib/logrotate directory owned by logrotate- Fix code indentation to get it build with gcc6.
- Fixed dates in changelog.- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- new upstream version 3.9.2
- log to syslog- move logrotate.status to /var/lib/logrotate and add it to rwtab.d (#1127415)- new upstream version 3.9.1- new upstream version 3.9.0- new upstream version 3.8.9- new upstream version 3.8.8- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- fix license handling- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- new usptream version 3.8.7- new upstream version 3.8.6- fix #982409 - do not crash when no logs are rotated and "sharedscripts" and
  "prerotate" is used- new upstream version 3.8.5- do not try to parse config files bigger than 16MB
- remove unused patches- new upstream version 3.8.4- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- new upstream version 3.8.3- new upstream version 3.8.2
- tests are enabled during build- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- fix #736054 - check for missing '{' in config file- fix #742731 - man page syntax, formatting, and spelling fixes- new upstream version 3.8.1- fix #723797 - added maxsize option- fix #726980 - work properly when acl_get_fd is supported,
  but acl_set_fd is not- fix #723547 - fixed size directive parsing- fix #722825 - do not redirect logrotate output in cron script- new upstream version 3.8.0
- removed unused patches- fix #709034 - work properly when ACLs are not supported- fix #708367 - fixed mail directive parsing- fix #689061 - added Url- fix #688520 - fixed CVE-2011-1154, CVE-2011-1155 and CVE-2011-1098- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- fix #671926 - fixed crash when tabooext is used in config file- fix #661181 - fixed SIGBUS when config file is empty or 4096 bytes
- fix #666677 - preserve ACLs when rotating files- fix #644309 - mention all logrotate params in man page- fix #638629 - better size directive description- fixed AUTHORS in man page- new upstream version 3.7.9- fix #602643 - update manpage to reflect scripts changes
- fix #606675 - pass currently rotated file as argument to
  po�x��������������B�������XM}l���������X������U������$E����������������U�T�V���g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��`tf�`tf�`tf�`tf�`tf�`tf�`tf�g��g��`tf�`tf�`tf�`tf�`tf�`tf�`tf�`tf�`tf�`tf�`tf�`tf�`tf�`tf�g��`tf�`tf�`tf�`tf�`tf�`tf�`tf�`tf�g��g��`tf�g��g��g��g��g��g��g��g��g��`tf�`tf�g��g��`tf�g��`tf�g��g��g��g��g��g��g��g��`tf�`tf�`tf�`tf�`tf�`tf�`tf�`tf�`tf�`tf�g��`tf�g��g��g��g��g��g��g��`tf�`tf�`tf�`tf�g��`tf�`tf�g��g��g��`tf�g��g��g��g��g��g��g��g��g��g��g��`tf�`tf�g��`tf�`tf�`tf�`tf�`tf�g��`tf�g��`tf�g��g��g��g��g��g��g��`tf�`tf�ed8f46438fd662635575e276217fe323165cb783db52a99b22561be4afae36b433f2dd0ffdbd197ee95c114bb1b86c0e458c3babc5acb417ddd368176b2127d64a6bfc85010cac66093103859a91fb67436b6131b43b704dd1cf4207c9bd48654a6bfc85010cac66093103859a91fb67436b6131b43b704dd1cf4207c9bd48652a44636e0192dd05f2ef3b319a11f490ed371ba7ffc21b80b3f6ba20f7f3ee742f50c912e271b317461dd2aac3dd63c54764a36c96c38e2af096fe615eff11251b8343bb560dbef9b5058ccb9c26409a2319cf678c42c977ea9eaf4bbcffb2d01b8343bb560dbef9b5058ccb9c26409a2319cf678c42c977ea9eaf4bbcffb2d080f87d9bcbf9cf22dbd8eccd35482b7a32d1b8e7334d8631e4902a2a29a789744fb761113d6f1e970b2c06d97916347214999aa9bac60bd49857a62e763df790b45d9139d1ffc1a9d228bd185937089d6e265df466ed6580928a03d3e20c54feb45d9139d1ffc1a9d228bd185937089d6e265df466ed6580928a03d3e20c54fe0e19999e99ab6692f33e7b3eb10aec84084d0e28c175db8c3b85e730c241ba6f0e19999e99ab6692f33e7b3eb10aec84084d0e28c175db8c3b85e730c241ba6f0db42b40eef397ad62ad085aa72bddb3d2f3241965f607187a13c550646c12ae0db42b40eef397ad62ad085aa72bddb3d2f3241965f607187a13c550646c12ae1b933e74a1772f9cc4b2fff7717e94648bad076cb47567b43f8fbff4450f07bc1b933e74a1772f9cc4b2fff7717e94648bad076cb47567b43f8fbff4450f07bc12053a7ce95aca0e1559b49a773b64d2d46822a6b8d070b8268a4b1c7ecbc1b912053a7ce95aca0e1559b49a773b64d2d46822a6b8d070b8268a4b1c7ecbc1b9109762a40cdc644a8767aaaf12afd5a2b524eab43953d2c0e5916c90cbb607c5109762a40cdc644a8767aaaf12afd5a2b524eab43953d2c0e5916c90cbb607c5c36a2743cfecc73f13b5d9a11639e5a3092b6ca77ec8d31fd7b384cc96a6dd22c36a2743cfecc73f13b5d9a11639e5a3092b6ca77ec8d31fd7b384cc96a6dd22474b74d4b02c2c140343cb83b3d8b87cb73941af1ec4c49406f082c69717d551474b74d4b02c2c140343cb83b3d8b87cb73941af1ec4c49406f082c69717d55191885ed8e0232ea436ef6da24bcddd7176fe7820f8f727143787cc09fea5a10f91885ed8e0232ea436ef6da24bcddd7176fe7820f8f727143787cc09fea5a10f23a9e555558c4f4b3ac908acc88559259db33063c847561433819016865f0c099574df3ea25465ee35a661b574081569e9fa346ed7d754e8bd079c1c3f852aca6d3bba20c4f8c898cd52696e2f6266cc8cf06914a8f2bc4239029b8645df10c96d3bba20c4f8c898cd52696e2f6266cc8cf06914a8f2bc4239029b8645df10c9335d3254ef1a88483581af630c73b7c708df8d603251cd3ffc5e82706dec7a6b335d3254ef1a88483581af630c73b7c708df8d603251cd3ffc5e82706dec7a6bc20bf3ee8d0470c86a4353f3cc12e3b31d3fdb291dbb2ab6942635d5d59d0090c20bf3ee8d0470c86a4353f3cc12e3b31d3fdb291dbb2ab6942635d5d59d0090686215d2c14a77385cd6d89964ac17a534f7d1452515047fd248fe882b717189686215d2c14a77385cd6d89964ac17a534f7d1452515047fd248fe882b717189e6a70bd459754acef9b362bf64ca5b1e7173dd4386abefbac310f88c24ea8721e6a70bd459754acef9b362bf64ca5b1e7173dd4386abefbac310f88c24ea8721d010ef262186a27342aece24b52bd4e0130c99ec20d3a8061e7e1e9bc7da08e8d010ef262186a27342aece24b52bd4e0130c99ec20d3a8061e7e1e9bc7da08e8290a0dac599553bf83a8f801472c26e3b1fc34bad2bd95b090c06e36691f0815290a0dac599553bf83a8f801472c26e3b1fc34bad2bd95b090c06e36691f081587c813a50de2e5ea0085b8b74702bbc3fbc87af36c2134c2bd1b45898a52059b87c813a50de2e5ea0085b8b74702bbc3fbc87af36c2134c2bd1b45898a52059b3f6b9a6f15018a5245c8ca1ff2f851134fcb44081984c621aa93f550335d00ac3f6b9a6f15018a5245c8ca1ff2f851134fcb44081984c621aa93f550335d00acb8982288118c29ef58676d609e1946253451f63a776cb601fd0a3f7905efde20b8982288118c29ef58676d609e1946253451f63a776cb601fd0a3f7905efde2037d996064a9c3af6f33db9de412b62c7e94848c9134e72f3fd66133b4bf384b437d996064a9c3af6f33db9de412b62c7e94848c9134e72f3fd66133b4bf384b4685e514fad2d9b40350be561a8e5109db1d8ac017d23742ba33b06e79a048581685e514fad2d9b40350be561a8e5109db1d�x������	82�������X�dm,����$y������������������~5eavYzBqY8QzjlOXbmIlY7dJUCwXTECUfirc6kH86
CS8fXZTke4QYZ55VnrOomB4QGqP371kwBETnhlhi74+pvi3jW05Z5x1tVMwuugyz
zkseZp1VYmJq5SHNFZ/pnAQLE9gUDTb6UWcPBwQh9Sw+7ahSK74lJKYm3wktyvZh
zAxbNyzs1M56yeFP6uFwJTBfNByyMAa6TGUhNkxlLcYjxKbVmoAnKCVM8t41TlLv
/a0ki8iQxqvphVLufksR9IpN6d3F15j6GeyVtxBEv04iv4vbuKthWytb+gjX4bI8
CAo9jGHevmtdiw/SbeKx2YBM1MF6eua37rFMooOBj4X7VfQCyS+crNsOQn8nJGah
YbzUDCCgnX+pqN9iZvXisMS79wVyD5DyISFDvT/5jY7IXxPibxr10P/8lfW1d72u
xyI2UiZKZpyHCt4k47yMq4KQGLGuhxJ6q6O3bi2aXRuz8bLqTBLca9dmx9wZFvRh
6jS/SKEg7eFcY0xbb6RVIv1UwGDYfQARAQABwsFfBBgBCAAJBQJW/BCrAhsMAAoJ
EPFlbyTHTNHYEBIQAJhFTh1u34Q+5bnfiM2dAdCr6T6w4Y1v9ePiIYdSImeseJS2
yRglpLcMjW0uEA9KXiRtC/Nm/ClnqYJzCKeIaweHqH6dIgJKaXZFt1Uaia7X9tDD
wqALGu97irUrrV1Kh9IkM0J29Vid5amakrdS4mwt2uEISSnCi7pfVoEro+S7tYQ9
iH6APVIwqWvcaty3cANdwKWfUQZ6a9IQ08xqzaMhMp2VzhVrWkq3B0j2aRoZR7BN
LH2I7Z0giIM8ARjZs99aTRL+SfMEQ3sUxNLb3KWP/n1lSFbrk4HGzqUBBfczESlN
c0970C6znK0H0HD11/3BTkMuPqww+Tzex4dpMQllMEKZ3wEyd9v6ba+nj/P1FHSE
y/VN6IXzd82s1lYOonKTdmXAIROcHnb0QUzwsd/mhB3jKhEDOV2ZcBTD3yHv8m7C
9G9y4hV+7yQlnPlSg3DjBp3SS5r+sOObCIy2Ad32upoXkilWa9g7GZSuhY9kyKqe
Eba1lgXXaQykEeqx0pexkWavNnb9JaPrAZHDjUGcXrREmjEyXyElRoD4CrWXySe4
6jCuNhVVlkLGo7osefynXa/+PNjQjURtx8en7M9A1FkQuRAxE8KIZgZzYxkGl5o5
POSFCA4JUoRPDcrl/sI3fuq2dIOE/BJ2r8dV+LddiR+iukhXRwJXH8RVVEUS
=mCOI
-----END PGP PUBLIC KEY BLOCK-----
V��localhostpubkeyMariaDB Signing Key <signing-key@mariadb.org>Public Keys(none)gpg(MariaDB Signing Key <signing-key@mariadb.org>)gpg(c74cd1d8)gpg(de8f6914)4.14.34:f1656f24c74cd1d8-56fc10ab4:f1656f24c74cd1d8-56fc10ab4:c0f47944de8f6914-56fc10ab?����9201dfee55cf85c2b8e4c32ed23288ebf697e27ei0<�i0<�t//usr/local/cpanel/3rdparty/perl/536/lib/Test2/EventFacet/Info//usr/local/cpanel/3rdparty/perl/536/lib/Test2/Formatter//usr/local/cpanel/3rdparty/perl/536/lib/Test2/Hub//usr/local/cpanel/3rdparty/perl/536/lib/Test2/Hub/Interceptor//usr/local/cpanel/3rdparty/perl/536/lib/Test2/IPC//usr/local/cpanel/3rdparty/perl/536/lib/Test2/IPC/Driver//usr/local/cpanel/3rdparty/perl/536/lib/Test2/Tools//usr/local/cpanel/3rdparty/perl/536/lib/Test2/Util//usr/local/cpanel/3rdparty/perl/536/lib/Text//usr/local/cpanel/3rdparty/perl/536/lib/Thread//usr/local/cpanel/3rdparty/perl/536/lib/Tie//usr/local/cpanel/3rdparty/perl/536/lib/Tie/Hash//usr/local/cpanel/3rdparty/perl/536/lib/Time//usr/local/cpanel/3rdparty/perl/536/lib/Unicode/Collate/CJK//usr/local/cpanel/3rdparty/perl/536/lib/Unicode/Collate/Locale//usr/local/cpanel/3rdparty/perl/536/lib/Unicode/Collate//usr/local/cpanel/3rdparty/perl/536/lib/Unicode/Collate//usr/local/cpanel/3rdparty/perl/536/lib/Unicode//usr/local/cpanel/3rdparty/perl/536/lib/User//usr/local/cpanel/3rdparty/perl/536/lib/autodie/Scope//usr/local/cpanel/3rdparty/perl/536/lib/autodie//usr/local/cpanel/3rdparty/perl/536/lib/autodie//usr/local/cpanel/3rdparty/perl/536/lib/autodie/exception//usr/local/cpanel/3rdparty/perl/536/lib/autodie//usr/local/cpanel/3rdparty/perl/536/lib/encoding//usr/local/cpanel/3rdparty/perl/536/lib/overload//usr/local/cpanel/3rdparty/perl/536/lib/pod//usr/local/cpanel/3rdparty/perl/536/lib/unicore//usr/local/cpanel/3rdparty/perl/536/lib/unicore/To//usr/local/cpanel/3rdparty/perl/536/lib/unicore/lib//usr/local/cpanel/3rdparty/perl/536/lib/unicore/lib/Age//usr/local/cpanel/3rdparty/perl/536/lib/unicore/lib/Alpha//usr/local/cpanel/3rdparty/perl/536/lib/unicore/lib/Bc//usr/local/cpanel/3rdparty/perl/536/lib/unicore/lib/BidiC//usr/local/cpanel/3rdparty/perl/536/lib/unicore/lib/BidiM//usr/local/cpanel/3rdparty/perl/536/lib/unicore/lib/Blk//usr/local/cpanel/3rdparty/perl/536/lib/unicore/lib/Bpt//usr/local/cpanel/3rdparty/perl/536/lib/unicore/lib/CE//usr/local/cpanel/3rdparty/perl/536/lib/unicore/lib/CI//usr/local/cpanel/3rdparty/perl/536/lib/unicore/lib/CWCF//usr/local/cpanel/3rdparty/perl/536/lib/unicore/lib/CWCM//usr/local/cpanel/3rdparty/perl/536/lib/unicore/lib/CWKCF//usr/local/cpanel/3rdparty/perl/536/lib/unicore/lib/CWL//usr/local/cpanel/3rdparty/perl/536/lib/unicore/lib/CWT//usr/local/cpanel/3rdpa�x��������������!�������X��kh
�;������G��$W����������������G�F�R/usr/lib//usr/lib/.build-id//usr/lib/.build-id/c6//usr/lib64/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c67beaa6f2e706544936c44b8a3191d8f59c4ae7, strippedPRRRRR
RRRRRRRRRR
RR	RRutf-820c9ed9e956c4dd9b2bfe025a87607f15366d3831f9615788da47c3b2bdabee1?���@J��2!�^���P,��*����%�hdW
	*����%�)^�˥[�S�*<<�l�~o�-�Q3�$���JP�;O55d���~ӚJ�R���ㄦf(3����~��.@�o	L"m��k��0��.����[���'SYr���s{�u�|�����>^�Y�b���X�}v$�I;o��3�*%H�Vl�8�݂�~�Y��UA�2�o���e>�-3�����9�7a��l�
��ٷ��sz麡����Fe+o�=5�%"4Y��d��+��1�6D�JV�ȁ�T$7�$��C�l'��C\�J�<�X�~���r�U����?9v�q(�F�w~ICU�"<l�Gs@�4`���%I��*���k���O��k���(��N��S�q���^&X��i~�-̻�i�ˌm�
Vx�X��}�O��i72���	�P
��8�^-�^I�SB�kݫQ���3}�a����U(�-$�2o�ݖ�Ea�B"�ʾ�&�J!9��؛�u�j>&#%)���Gk����Cb\"��y�%wU?Kjj�4I%HuuٺB�L�xc������a}����3!�^���P,��*����%�hdW
	*����%����7��V��^��^���m4�V��
᪼�p��6HEP0�8���6���hWwc�u�g��%��!�a��0��A�v�G���+9[Je�f�y���y0�TH�><�tW��'b��Ɗ��^y>W��)��zx��
j+���C��]�I�/������|3�qpT���r��G7�2�Xȃ$��{�ֱ��Ȱ�����?�Y�㇚:}�"�چݞA�����B	�w�Z
�'%��ǽx�gS�Mu�ޙ��X���-
��KY^,ñ��y}�7q:��@	�MZ�S�e!t�wo
}�)Sp�ҞטX�E0�)?,֚�>�j�,j�G�B)�����ST�|4ᆬ1P�QRN[�3� c�����6�	`��N���N��9E�˛'�=�^�����q�����i�2����t|	/)�D��5���{!�aO�&hyB
b��G�T�c�w��_|�����IV��(yC�Ƕ�#V���j��'�!%V���2��9ff68f854d2b8d7e32e69e0f7ab1e51357e195cb4009876899152e95718b71bca0a10e07ed9a004ce2be2e536530c1106c8222a3i0b��i0�gali-fonts8d�3lohit-assamese-fonts�w3lsscsi134i8lshwf��
lvemanager5c1��rlz4-libso�>lz4O��	lvm2-libsP�	lvm2	�Mlve-wrappers-�d	lve-utils�I	lve-statsyLlve ��luksmeta8<�
lua-socketbsiS�lua-lpeglylua-libsTlua-jsoncR�	lua-expat�lluaanLlsof �	logrotate�	lockdev��l	lmdb-libsl	llvm-libs��linux-firmwareminnlibzstdB	libzhuyin'libyamlog��rlibxsltco�1libxshmfence<�Ilibxmlb�V�libxml2�Ilibxklavier�m
libxkbfilesPmlibxkbcommon-x11-ulibxkbcommonY	libxcrypt�nlibxcbg@l�llibwpe}�2libwnck3-&libwmf-lite1-��libwinpr	�zlibwebpm>ssAlibwbclientitlibwayland-server}nlibwayland-egljec� libwayland-cursorslibwayland-client6
libwacom-dataTolibwacommi5llibvpx��m	libvorbis�	libvncserver	�	libvisual�K�libvirt-libs!�	libvirt-gobject"�	libvirt-glib	�1libvirt-gconfig	3.libvirt-daemon-kvmO_13"libvirt-daemon-driver-storage-scsi8/l!libvirt-daemon-driver-storage-rbd6#libvirt-daemon-driver-storage-mpathC8%libvirt-daemon-driver-storage-logicalI*libvirt-daemon-driver-storage-iscsi-direct?8#libvirt-daemon-driver-storage-iscsiL�x�������������X�������X�l��������8�c��$s����������������c�b�d��n Matshkalyan <lmatshkalyan@cloudlinux.com> - 7.2.34-12Chris Castillo <chris.castillo@webpros.com> - 7.2.34-11Julian Brown <julian.brown@cpanel.net> - 7.2.34-10Vladimir D. Seleznev <vseleznev@cloudlinux.com> - 7.2.34-9.cloudlinux.12Sergey Fokin <sfokin@cloudlinux.com> - 7.2.34-9.cloudlinux.11Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 7.2.34-9.cloudlinux.10Vladimir D. Seleznev <vseleznev@cloudlinux.com> - 7.2.34-9.cloudlinux.9Azat Nurgaliev <anurgaliev@cloudlinux.com> - 7.2.34-9.cloudlinux.8Azat Nurgaliev <anurgaliev@cloudlinux.com> - 7.2.34-9.cloudlinux.7Lizi Ekseulidze <lekseulidze@cloudlinux.com> - 7.2.34-9.cloudlinux.6Lizi Ekseulidze <lekseulidze@cloudlinux.com> - 7.2.34-9.cloudlinux.5Vladimir D. Seleznev <vseleznev@cloudlinux.com> - 7.2.34-9.cloudlinux.4Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 7.2.34-9.cloudlinux.3Vladimir D. Seleznev <vseleznev@cloudlinux.com> - 7.2.34-9.cloudlinux.2Dmitriy Popov <dpopov@cloudlinux.com> - 7.2.34-9.cloudlinux.1Tim Mullin <tim@cpanel.net> - 7.2.34-9Dmitriy Popov <dpopov@cloudlinux.com> - 7.2.34-8.cloudlinux.2Nikita Ivanov <nivanov@cloudlinux.com> - 7.2.34-8.cloudlinux.1Julian Brown <julian.brown@cpanel.net> - 7.2.34-8Nikita Ivanov <nivanov@cloudlinux.com> - 7.2.34-7.cloudlinux.6Pavel Mayorov <pmayorov@cloudlinux.com> - 7.2.34-7.cloudlinux.5Pavel Mayorov <pmayorov@cloudlinux.com> - 7.2.34-7.cloudlinux.4Pavel Mayorov <pmayorov@cloudlinux.com> - 7.2.34-7.cloudlinux.3Nikita Ivanov <nivanov@cloudlinux.com> - 7.2.34-7.cloudlinux.2Nikita Ivanov <nivanov@cloudlinux.com> - 7.2.34-7.cloudlinux.1Travis Holloway <t.holloway@cpanel.net> - 7.2.34-7Nikita Ivanov <nivanov@cloudlinux.com> - 7.2.34-6.cloudlinux.3Eduard Abdullin <eabdullin@cloudlinux.com> - 7.2.34-6.cloudlinux.2Eduard Abdullin <eabdullin@cloudlinux.com> - 7.2.34-6.cloudlinux.1Travis Holloway <t.holloway@cpanel.net> - 7.2.34-6Eduard Abdullin <eabdullin@cloudlinux.com> - 7.2.34-5.cloudlinux.2Anatholy Scryabin <ascryabin@cloudlinux.com> - 7.2.34-5.cloudlinux.1Cory McIntire <cory@cpanel.net> - 7.2.34-5Eduard Abdullin <eabdullin@cloudlinux.com> - 7.2.34-4.cloudlinux.1Julian Brown <julian.brown@cpanel.net> - 7.2.34-4Daniil Leonov <dleonov@cloudlinux.com> - 7.2.34-3.cloudlinux.2Eduard Abdullin <eabdullin@cloudlinix.con> - 7.2.34-3.cloudlinux.1Daniel Muey <dan@cpanel.net> - 7.2.34-3Tim Mullin <tim@cpanel.net> - 7.2.34-2Ivan Danilov <idanilov@cloudlinux.com> - 7.2.33-1.cloudlinux.4Ivan Danilov <idanilov@cloudlinux.com> - 7.2.33-1.cloudlinux.3Cory McIntire <cory@cpanel.net> - 7.2.34-1Ivan Danilov <idanilov@cloudlinux.com> - 7.2.33-1.cloudlinux.2Tim Mullin <tim@cpanel.net> - 7.2.33-2Cory McIntire <cory@cpanel.net> - 7.2.33-1Darya Malyavkina <dmalyavkina@cloudlinux.com> - 7.2.32-2.cloudlinux.1Tim Mullin <tim@cpanel.net> - 7.2.32-2Cory McIntire <cory@cpanel.net> - 7.2.32-1Julian Brown <julian.brown@cpanel.net> - 7.2.31-3Darya Malyavkina <dmalyavkina@cloudlinux.com> - 7.2.31-2.cloudlinux.1Tim Mullin <tim@cpanel.net> - 7.2.31-2Cory McIntire <cory@cpanel.net> - 7.2.31-1Cory McIntire <cory@cpanel.net> - 7.2.30-1Tim Mullin <tim@cpanel.net> - 7.2.29-2Cory McIntire <cory@cpanel.net> - 7.2.29-1Julian Brown <julian.brown@cpanel.net> - 7.2.28-2Darya Malyavkina <dmalyavkina@cloudlinux.com> - 7.2.28-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 7.2.28-1Tim Mullin <tim@cpanel.net> - 7.2.27-2Cory McIntire <cory@cpanel.net> - 7.2.27-1Ivan Danilov <idanilov@cloudlinux.com> - 7.2.26-1.cloudlinux.1Daniel Muey <dan@cpanel.net> - 7.2.26-2Cory McIntire <cory@cpanel.net> - 7.2.26-1Tim Mullin <tim@cpanel.net> - 7.2.25-2Cory McIntire <cory@cpanel.net> - 7.2.25-1Cory McIntire <cory@cpanel.net> - 7.2.24-1Cory McIntire <cory@cpanel.net> - 7.2.23-1Darya Malyavkina <dmalyavkina@cloudlinux.com> - 7.2.22-2.cloudlinux.1Tim Mullin <tim@cpanel.net> - 7.2.22-2Darya Malyavkina <dmalyavkina@cloudlinux.com> - 7.2.22-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 7.2.22-1Cory McIntire <cory@cpanel.net> - 7.2.21-1Cory McIntire <cory@cpanel.net> - 7.2.20-3Cory McIntire <cory@cpan�x���������������������X��k��������p�X��$H����������������X�Y��J)?#�d����	6�	r���������������	!�-�Z�`g�
�
	�

�

N

|
�
�
D
l��(�8�+9�+:n+>zG�
H�
I�
X�Y�\4
]\
^�
b�d!e!!f!$l!&t!@
u!h
v!�w"�
x"�
y#�#p�#t�#z�#��#�$$6&>&N6
(�(��(�(�
)g)h)Cfuse-overlayfs1.131.module_el8.10.0+4120+03ad4b47FUSE overlay+shiftfs implementation for rootless containersFUSE overlay+shiftfs implementation for rootless containers.i�_�x64-builder02.almalinux.org
AlmaLinuxAlmaLinuxGPLv3+AlmaLinux Packaging Team <packager@almalinux.org>Unspecifiedhttps://github.com/containers/fuse-overlayfslinuxx86_64modprobe fuse > /dev/null 2>&1 || :�P"TF����A�A���A큤A큤��i�_�i�_�i�_�i�_�i�_�i�_�d�i�_�d�i�_�7288afdcf8687c46bc5fdcc0b7bc82e0a750146cdff42a2d2983d1af280eab0ec4dd7cab2c42d9d4996a9a8eff44dc5c35f9e4c60bbb423a5dae62688b01927c76b674eb35aa33d6d9cd3d965c2ec7420911f2adc4b5769e827b3315285a3ef48177f97513213526df2cf6184d8ff986c675afb514d4e68a404010521b8806430be9d58fd32e0304b604bacf4485960683bd58f6d039dc42620e8a7124de692b../../../../usr/bin/fuse-overlayfs�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootfuse-overlayfs-1.13-1.module_el8.10.0+4120+03ad4b47.src.rpm����������������������������������������fuse-overlayfsfuse-overlayfs(x86-64)@@@@@@@@@@@@@@@@@@@@



@/bin/shfuse3kmodlibc.so.6()(64bit)libc.so.6(GLIBC_2.10)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.6)(64bit)libc.so.6(GLIBC_2.8)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libfuse3.so.3()(64bit)libfuse3.so.3(FUSE_3.0)(64bit)libfuse3.so.3(FUSE_3.2)(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libgcc_s.so.1(GCC_3.3.1)(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.3d��d^*@d 3�d	�@c��b�2@b{�@a�r@a�@a�@a��a�@`�"@`\{@`��`�_���_�/@_���_�"�_d�@_2�@^��^�@^�W@^���^�k@^s^�^b;@^Nt�^J�@]�@]�@]҇�]�\?�[�$@[m~@[m~@[^��[^��[^��[]�@Jindrich Novy <jnovy@redhat.com> - 1.13-1Jindrich Novy <jnovy@redhat.com> - 1.12-1Jindrich Novy <jnovy@redhat.com> - 1.11-1Jindrich Novy <jnovy@redhat.com> - 1.10-2Jindrich Novy <jnovy@redhat.com> - 1.10-1Jindrich Novy <jnovy@redhat.com> - 1.9-1Jindrich Novy <jnovy@redhat.com> - 1.8.2-2Jindrich Novy <jnovy@redhat.com> - 1.8.2-1Jindrich Novy <jnovy@redhat.com> - 1.8.1-1Jindrich Novy <jnovy@redhat.com> - 1.8-1Jindrich Novy <jnovy@redhat.com> - 1.7.1-1Jindrich Novy <jnovy@redhat.com> - 1.7-1Jindrich Novy <jnovy@redhat.com> - 1.6-1Jindrich Novy <jnovy@redhat.com> - 1.5.0-1Jindrich Novy <jnovy@redhat.com> - 1.4.0-2Jindrich Novy <jnovy@redhat.com> - 1.4�x�������������H�����X��l��������h������[��$K����������������[�Z�\�� 4.2.17-6Marek Blaha <mblaha@redhat.com> - 4.2.17-5Ales Matej <amatej@redhat.com> - 4.2.17-4Pavla Kratochvilova <pkratoch@redhat.com> - 4.2.17-3Ales Matej <amatej@redhat.com> - 4.2.17-2Ales Matej <amatej@redhat.com> - 4.2.16-1Ales Matej <amatej@redhat.com> - 4.2.11-1Pavla Kratochvilova <pkratoch@redhat.com> - 4.2.7-7Jaroslav Mracek <jmracek@redhat.com> - 4.2.7-6Pavla Kratochvilova <pkratoch@redhat.com> - 4.2.7-5Pavla Kratochvilova <pkratoch@redhat.com> - 4.2.7-4Pavla Kratochvilova <pkratoch@redhat.com> - 4.2.7-3Pavla Kratochvilova <pkratoch@redhat.com> - 4.2.7-2Pavla Kratochvilova <pkratoch@redhat.com> - 4.2.7-1Pavla Kratochvilova <pkratoch@redhat.com> - 4.2.6-1Pavla Kratochvilova <pkratoch@redhat.com> - 4.0.9.2-6Jaroslav Mracek <jmracek@redhat.com> - 4.0.9.2-5Jaroslav Mracek <jmracek@redhat.com> - 4.0.9.2-4Pavla Kratochvilova <pkratoch@redhat.com> - 4.0.9.2-3Jaroslav Mracek <jmracek@redhat.com> - 4.0.9.2-2Jaroslav Mracek <jmracek@redhat.com> - 4.0.9.2-1Daniel Mach <dmach@redhat.com> - 4.0.9.1-1Jaroslav Mracek <jmracek@redhat.com> - 4.0.9-1Jaroslav Mracek <jmracek@redhat.com> - 4.0.4-2Jaroslav Mracek <jmracek@redhat.com> - 4.0.4-1Jaroslav Mracek <jmracek@redhat.com> - 3.6.1-1Jaroslav Mracek <jmracek@redhat.com> - 3.5.1-1Jaroslav Mracek <jmracek@redhat.com> - 3.5.0-1Daniel Mach <dmach@redhat.com> - 3.4.0-1Daniel Mach <dmach@redhat.com> - 3.3.0-1Daniel Mach <dmach@redhat.com> - 3.2.0-1Daniel Mach <dmach@redhat.com> - 3.1.0-1Daniel Mach <dmach@redhat.com> - 3.0.4-1Martin Hatina <mhatina@redhat.com> - 3.0.3-1Jaroslav Mracek <jmracek@redhat.com> - 3.0.2-1Jaroslav Mracek <jmracek@redhat.com> - 3.0.1-1Igor Gnatenko <ignatenko@redhat.com> - 2.7.5-1Jaroslav Mracek <jmracek@redhat.com> - 2.7.4-1Igor Gnatenko <ignatenko@redhat.com> - 2.7.3-1Jaroslav Mracek <jmracek@redhat.com> - 2.7.2-1Jaroslav Mracek <jmracek@redhat.com> 2.6.3-1Jaroslav Mracek <jmracek@redhat.com> 2.6.2-1Jaroslav Mracek <jmracek@redhat.com> 2.5.1-1Jaroslav Mracek <jmracek@redhat.com> 2.5.0-1Jaroslav Mracek <jmracek@redhat.com> 2.4.1-1Jaroslav Mracek <jmracek@redhat.com> 2.4.0-1Jaroslav Mracek <jmracek@redhat.com> 2.3.0-1Jaroslav Mracek <jmracek@redhat.com> 2.2.0-1Jaroslav Mracek <jmracek@redhat.com> 2.1.1-1Jaroslav Mracek <jmracek@redhat.com> 2.1.0-1Jaroslav Mracek <jmracek@redhat.com> 2.0.1-1Michal Luscon <mluscon@redhat.com> 2.0.0-1Martin Hatina <mhatina@redhat.com> 2.0.0-0.rc2.1Michal Luscon <mluscon@redhat.com> 2.0.0-0.rc1.1Igor Gnatenko <ignatenko@redhat.com> - 1.1.10-2Igor Gnatenko <ignatenko@redhat.com> - 1.1.10-1Igor Gnatenko <ignatenko@redhat.com> - 1.1.9-6Igor Gnatenko <ignatenko@redhat.com> - 1.1.9-5Igor Gnatenko <ignatenko@redhat.com> - 1.1.9-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.1.9-3Michal Luscon <mluscon@redhat.com> 1.1.9-2Igor Gnatenko <ignatenko@redhat.com> 1.1.9-1Michal Luscon <mluscon@redhat.com> 1.1.8-1Michal Luscon <mluscon@redhat.com> 1.1.7-1Michal Luscon <mluscon@redhat.com> 1.1.6-1Michal Luscon <mluscon@redhat.com> 1.1.5-1Michal Luscon <mluscon@redhat.com> 1.1.4-1Michal Luscon <mluscon@redhat.com> 1.1.3-1Michal Luscon <mluscon@redhat.com> 1.1.2-4Michal Luscon <mluscon@redhat.com> 1.1.2-3Michal Luscon <mluscon@redhat.com> 1.1.2-2Michal Luscon <mluscon@redhat.com> 1.1.2-1Michal Luscon <mluscon@redhat.com> 1.1.1-2Michal Luscon <mluscon@redhat.com> 1.1.1-1Michal Luscon <mluscon@redhat.com> 1.1.0-2Michal Luscon <mluscon@redhat.com> 1.1.0-1Michal Luscon <mluscon@redhat.com> 1.0.2-3Jan Silhan <jsilhan@redhat.com> 1.0.2-2Michal Luscon <mluscon@redhat.com> 1.0.2-1Michal Luscon <mluscon@redhat.com> 1.0.1-2Michal Luscon <mluscon@redhat.com> 1.0.1-1Michal Luscon <mluscon@redhat.com> 1.0.0-1Michal Luscon <mluscon@redhat.com> 0.6.5-1Jan Silhan <jsilhan@redhat.com> - 0.6.4-1Jan Silhan <jsilhan@redhat.com> - 0.6.3-2Jan Silhan <jsilhan@redhat.com> - 0.6.3-1Jan Silhan <jsilhan@redhat.com> - 0.6.2-1Jan Silhan <jsilhan@redhat.com> - 0.6.1-1Aleš Kozumplík <ales@redhat.com> - 0.6.0-1Aleš Kozumplík <ales@redhat.com> - �x���������������������X�j�������������$��������������������D
m-fonts, 
- sans-ol-chiki-fonts, sans-old-italic-fonts, sans-old-persian-fonts, sans-phags-pa-fonts, 
- sans-rejang-fonts, sans-runic-fonts, sans-samaritan-fonts, sans-saurashtra-fonts, 
- sans-sinhala-fonts, sans-sundanese-fonts, sans-syloti-nagri-fonts, sans-syriac-eastern-fonts, 
- sans-syriac-estrangela-fonts, sans-syriac-western-fonts, sans-tagbanwa-fonts, 
- sans-tai-le-fonts, sans-tifinagh-fonts, sans-yi-fonts
- Resolves #1148413- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Upstream new release of 20130807 tarball.
- Packages Non Hinted upstream tarball.
- This pulled fonts for number of missing Unicode scripts in Fedora- Resolved #984459 :- Upstream new release.
- Added new package google-noto-serif-khmer-fonts- Resolved #971886 :- Georgian Serif fontconfig file error- Resolved #971886 :- Georgian fontconfig file error- Initial import
- Updated spec file- Updated package as per 3rd comment on review request #953859- Initial packaging/bin/sh/bin/sh����20161022-7.el8.120161022-7.el8.165-google-noto-sans-sinhala.confgoogle-noto-sans-sinhala.metainfo.xml65-google-noto-sans-sinhala.confgoogle-notoNotoSansSinhala-Bold.ttfNotoSansSinhala-Regular.ttf/etc/fonts/conf.d//usr/share/appdata//usr/share/fontconfig/conf.avail//usr/share/fonts//usr/share/fonts/google-noto/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuXML 1.0 document, ASCII textdirectoryTrueType Font data, 17 tables, 1st "GDEF", 15 names, Microsoft, language 0x409, Copyright 2014 Google Inc. All Rights Reserved.Noto Sans SinhalaBoldMonotype Imaging - Noto SanTrueType Font data, 17 tables, 1st "GDEF", 15 names, Microsoft, language 0x409, Copyright 2014 Google Inc. All Rights Reserved.Noto Sans SinhalaRegularMonotype Imaging - Noto PPPPPPutf-8bf7f110df8d0a989a4dd5abf43b1952323acc87cd59dbc29be7fb0f2f9769c9b?������`�
	Q�d~���a	�v{���"��sr5��/f"��U!:?u�0�«;�&&R���`N� Rx��~����B�9Ί�3�G�%-ʞ�geg����E�[	i�N%���#��7�0�\�����aظ��Swfv=��I)ʂ��IGpUSO�"€�@3�Z
{|yیE�Y>��W V�i���Ȁ�ā�M� ��\��V^�$8T���t�^��$��p���?C�^�::uJ��(	��s8܄%�3q�2?�V�5us��-�2���9S�vca�ծ<+<���Z��E�&�a�W�H�\@�V�}�Ę�Dh:��탊_�M)�3
=)d�p��{E@��M��4�ڷg�5�rk��a&}���|���m�d��F�Z�G���U�h�@�#�4��`�
	Q�d~����_�E����"��Н�n�RW?�dVV��q�!��Ω�>����&�c�Z�\o���K��ƹ����Ĩ
�zwg�k�w"���Q	� إy�Z����&�����>c���iP�#�0p�h԰d�_�� ~����zy�
�D�>o�:��b�3�T���<�q�׊�{�	�!�����z8�1+�BÈ��X�Ɩ!s}�=��?L���a�y6��˥��H����1�'$t��������H_�ϟ�*z�_N�����@%��sKL�}ew��c}|>�f�_SU�QݸR�uEI�g��N�M��W0�M�D�Z`ݏX?��^�N��������C�+=U��t�]�Ԇ�+�i:T_G	�&�[7T��?�x��<�.�ZO�2d82dcb2ff53ce360f26f4870305bc5dc42eaa284e609adcebd935ddf9649777124378c2da9c5f3dd8970576102b10c873c02946i/(!Hi/&�sudo/examples/�a/usr/share/doc/sudo/2�$/usr/share/doc/startup-notification/�.s/usr/share/doc/sssd-common/ini/usr/share/doc/sscg/eEL/usr/share/doc/squashfs-tools/x8Xu/usr/share/doc/sqlite-libs/,�u/usr/share/doc/spice-server/s�/usr/share/doc/speexdsp/o5/usr/share/doc/speex/o!/usr/share/doc/speech-dispatcher/ke/usr/share/doc/soundtouch/ystJ'/usr/share/doc/sound-theme-freedesktop/�/usr/share/doc/snappy/iac' /usr/share/doc/smc-fonts-common/�e/usr/share/doc/slirp4netns/mk�x�������������(�������X�l0��������3��$#����������������3�4�2��n_filter_math15.pngrestoration_filter_math16.pngrestoration_filter_math17.pngrestoration_filter_math18.pngrestoration_filter_math19.pngrestoration_filter_math2.pngrestoration_filter_math20.pngrestoration_filter_math21.pngrestoration_filter_math22.pngrestoration_filter_math23.pngrestoration_filter_math24.pngrestoration_filter_math25.pngrestoration_filter_math26.pngrestoration_filter_math3.pngrestoration_filter_math4.pngrestoration_filter_math5.pngrestoration_filter_math6.pngrestoration_filter_math7.pngrestoration_filter_math8.pngrestoration_filter_math9.pngrestoration_filter_table4.pngrestoration_filter_table6.pngsioplm_fig1.pngsioplm_fig2.pngsq_weight_fig1.pngsq_weight_fig2.pngtx_search_fig1.pngtx_search_fig3.pngtx_search_table4.pngtx_search_table8.pngtx_size_search_fig1.pngtx_type_search_fig1.pngtx_type_search_fig2.pngsvt-av1-decoder-design.mdsvt-av1-encoder-design.mdsvt-av1_decoder_user_guide.mdsvt-av1_encoder_user_guide.mdREADME.mdSTYLE.mdsvt-av1-libsLICENSE.mdPATENTS.md/usr/lib//usr/lib/.build-id//usr/lib/.build-id/7a//usr/lib/.build-id/f1//usr/lib64//usr/share/doc//usr/share/doc/svt-av1-libs//usr/share/doc/svt-av1-libs/Docs//usr/share/doc/svt-av1-libs/Docs/img//usr/share/licenses//usr/share/licenses/svt-av1-libs/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu	

 !" #$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvvwxyz{|}~����������w���������������������������������m����������������(��������������������������������������������,-������� �����������������directoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV),�x����������������������XVmX�	���������$>�������������������kHFuJ404+G6ETd0owwxq64jLIcsp/GBZHGU0RKKAo9DRL
H7rpQ7PVlnw8TDNlOtWt5EJlBXFcPL+NgWbqkADAyA/XSNeWlqonvPlYfmasnAHA
pMd9NhPQhC7hJTjCiAwG8UyWpV8Dj07DHFQ5xBbkTnKH2OrJtguPqSNYtTASbsWz
09S8ujoTDXFT17NbFM2dMIiq0a4VQB3SzH13H2io9Cbg/TzJrJGmwgoXgwARAQAB
tDZNeVNRTCBSZWxlYXNlIEVuZ2luZWVyaW5nIDxteXNxbC1idWlsZEBvc3Mub3Jh
Y2xlLmNvbT6JAlQEEwEIAD4WIQS8pDQXw7SF3RKOxtS3s7eIqNN4XAUCZTas2gIb
AwUJA8JnAAULCQgHAgYVCgkICwIEFgIDAQIeAQIXgAAKCRC3s7eIqNN4XLzoD/9P
lpWtfHlI8eQTHwGsGIwFA+fgipyDElapHw3MO+K9VOEYRZCZSuBXHJe9kjGEVCGU
DrfImvgTuNuqYmVUV+wyhP+w46W/cWVkqZKAW0hNp0TTvu3eDwap7gdk80VF24Y2
Wo0bbiGkpPiPmB59oybGKaJ756JlKXIL4hTtK3/hjIPFnb64Ewe4YLZyoJu0fQOy
A8gXuBoalHhUQTbRpXI0XI3tpZiQemNbfBfJqXo6LP3/LgChAuOfHIQ8alvnhCwx
hNUSYGIRqx+BEbJw1X99Az8XvGcZ36VOQAZztkW7mEfH9NDPz7MXwoEvduc61xwl
MvEsUIaSfn6SGLFzWPClA98UMSJgF6sKb+JNoNbzKaZ8V5w13msLb/pq7hab72HH
99XJbyKNliYj3+KA3q0YLf+Hgt4Y4EhIJ8x2+g690Np7zJF4KXNFbi1BGloLGm78
akY1rQlzpndKSpZq5KWw8FY/1PEXORezg/BPD3Etp0AVKff4YdrDlOkNB7zoHRfF
HAvEuuqti8aMBrbRnRSG0xunMUOEhbYS/wOOTl0g3bF9NpAkfU1Fun57N96Us2T9
gKo9AiOY5DxMe+IrBg4zaydEOovgqNi2wbU0MOBQb23Puhj7ZCIXcpILvcx9ygjk
ONr75w+XQrFDNeux4Znzay3ibXtAPqEykPMZHsZ2sbkCDQRlNqzaARAAsdvBo8WR
qZ5WVVk6lReD8b6Zx83eJUkV254YX9zn5t8KDRjYOySwS75mJIaZLsv0YQjJk+5r
t10tejyCrJIFo9CMvCmjUKtVbgmhfS5+fUDRrYCEZBBSa0Dvn68EBLiHugr+SPXF
6o1hXEUqdMCpB6oVp6X45JVQroCKIH5vsCtw2jU8S2/IjjV0V+E/zitGCiZaoZ1f
6NG7ozyFep1CSAReZu/sssk0pCLlfCebRd9Rz3QjSrQhWYuJa+eJmiF4oahnpUGk
txMD632I9aG+IMfjtNJNtX32MbO+Se+cCtVc3cxSa/pR+89a3cb9IBA5tFF2Qoek
hqo/1mmLi93Xn6uDUhl5tVxTnB217dBT27tw+p0hjd9hXZRQbrIZUTyh3+8EMfmA
jNSIeR+th86xRd9XFRr9EOqrydnALOUr9cT7TfXWGEkFvn6ljQX7f4RvjJOTbc4j
JgVFyu8K+VU6u1NnFJgDiNGsWvnYxAf7gDDbUSXEuC2anhWvxPvpLGmsspngge4y
l+3nv+UqZ9sm6LCebR/7UZ67tYz3p6xzAOVgYsYcxoIUuEZXjHQtsYfTZZhrjUWB
J09jrMvlKUHLnS437SLbgoXVYZmcqwAWpVNOLZf+fFm4IE5aGBG5Dho2CZ6ujngW
9Zkn98T1d4N0MEwwXa2V6T1ijzcqD7GApZUAEQEAAYkCPAQYAQgAJhYhBLykNBfD
tIXdEo7G1Lezt4io03hcBQJlNqzaAhsMBQkDwmcAAAoJELezt4io03hcXqMP/01a
PT3A3Sg7oTQoHdCxj04ELkzrezNWGM+YwbSKrR2LoXR8zf2tBFzc2/Tl98V0+68f
/eCvkvqCuOtq4392Ps23j9W3r5XG+GDOwDsx0gl0E+Qkw07pwdJctA6efsmnRkjF
2YVO0N9MiJA1tc8NbNXpEEHJZ7F8Ri5cpQrGUz/AY0eae2b7QefyP4rpUELpMZPj
c8Px39Fe1DzRbT+5E19TZbrpbwlSYs1iCzS5YGFmpCRyZcLKXo3zS6N22+82cnRB
SPPipiO6WaQawcVMlQO1SX0giB+3/DryfN9VuIYd1EWCGQa3O0MVu6o5KVHwPgl9
R1P6xPZhurkDpAd0b1s4fFxin+MdxwmG7RslZA9CXRPpzo7/fCMW8sYOH15DP+Yf
UckoEreBt+zezBxbIX2CGGWEV9v3UBXadRtwxYQ6sN9bqW4jm1b41vNA17b6CVH6
sVgtU3eN+5Y9an1e5jLD6kFYx+OIeqIIId/TEqwS61csY9aav4j4KLOZFCGNU0FV
ji7NQewSpepTcJwfJDOzmtiDP4vol1ApJGLRwZZZ9PB6wsOgDOoP6sr0YrDI/NNX
2RyXXbglnQ1yJZVSH3/3eo6knG2qTthUKHCRDNKdy9Qqc1x4WWWtSRjh+zX8AvJK
2q1rVLH2/3ilxe9wcAZUlaj3id3TxquAlud4lWDz
=h5nH
-----END PGP PUBLIC KEY BLOCK-----
e6��localhostpubkeyMySQL Release Engineering <mysql-build@oss.oracle.com>Public Keys(none)gpg(MySQL Release Engineering <mysql-build@oss.oracle.com>)gpg(a8d3785c)gpg(dc49a81a)4.14.34:b7b3b788a8d3785c-6536acda4:b7b3b788a8d3785c-6536acda4:c952c9bcdc49a81a-6536acda?����54d281855ce6ff319b00d6a90b01fc80e630e316i0<�i0<�LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=2de3d395aaad408bc64183ab83adca0301ced7d6, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=6a7899a17e071de1d6108563cfff15f15106011b, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=36d095e1e0d51d38f8bb50417a7d5b4d114318bf, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=02e4f5f97000f2bdfdb9bbb9b4722125fc701943, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9ec6af25483d94ca6114d10546cba8ea3be3fbb2, not strippedutf-812825998338d4f6cab9e8f1ce916dd2918303a5c7c607a4c54d342252993a020?�����zԣF��h[>�p�rP�@�e5f7928d4970dd5ed63d175e2efbce40dccfa9d82c0b0dcba02f59e54cdc4195f9e280e26d91b9c3ddc21ed73fcc0cca249eeb76i0:J�x���������������������X�l0f�������a��$q����������������a�b�`�� parameters when creating system accounts (#67408)- automated rebuild- automated rebuild- rebuild in new environment- rebuild with proper defines to get support for large lastlog files (#61983)- rebuild- fix autoheader breakage and random other things autotools complain about- use -O0 instead of -O on ia64
- build in source directory
- don't leave lock files on the filesystem when useradd creates a group for
  the user (#50269)
- fix the -o option to check for duplicate UIDs instead of login names (#52187)- build with -O on ia64- fixup broken specfile- Create an empty mailspool when creating a user so non-setuid/non-setgid
  MDAs (postfix+procmail) can deliver mail (#41811)
- 20000902
- adapt patches- don't overwrite user dot files in useradd (#19982)
- truncate new files when moving overwriting files with the contents of other
  files while moving directories (keeps files from looking weird later on)
- configure using %{_prefix} as the prefix- langify- Fix up chage behavior (Bug #15883)- 20000826
- Fix up useradd man page (Bug #17036)- check for vipw lock before adding or deleting users (Bug #6489)- take LOG_CONS out of the openlog() call so that we don't litter the
  screen during text-mode upgrades- Remove a fixed-size buffer that caused problems when adding a huge number
  of users to a group (>8192 bytes) (Bugs #3809, #11930)- remove dependency on util-linux because it causes prereq loops- change symlinked man pages to includers
- require /usr/bin/newgrp (util-linux) so that /usr/bin/sg isn't left dangling- automatic rebuild- use mandir for FHS
- added patches in src/ and po/ to honor DESTDIR
- use make install DESTDIR=$RPM_BUILD_ROOT- Fix up usermod's symlink behavior (Bug #5458)- get rid of mkpasswd- fix usermod patch to check for shadow before doing any shadow-specific stuff
  and merge it into the pwlock patch- fix man symlinks- make -p only change shadow password (bug #8923)- rebuild to fix dependeencies
- man pages are compressed- Fix a security bug (adduser could overwrite previously existing
  groups, Bug #8609)- unset LINGUAS before building
- Fix typo in newusers manpage (Bug #8258)
- libtoolize- fix segfault for userdel when the primary group for the user is not
  defined- Serial: 1 because now we are using 19990827 (why the heck can't they have
  a normal version just like everybody else?!)
- ported all patches to the new code base- SIGHUP nscd from usermod, too- added usermod password locking from Chris Adams <cadams@ro.com>- have things that modify users/groups SIGHUP nscd on exit- have userdel remove user private groups when it is safe to do so
- allow -f to force user removal even when user appears busy in utmp- edit out unused CHFN fields from login.defs.- auto rebuild in the new build environment (release 7)- configure fix for arm- build against glibc 2.1- Note that /usr/sbin/mkpasswd conflicts with /usr/bin/mkpasswd;
  one of these (I think /usr/sbin/mkpasswd but other opinions are valid)
  should probably be renamed.  In any case, mkpasswd.8 from this package
  needs to be installed. (problem #823)- translations modified for de, fr, tr- updated to 980403
- redid the patches- updated the spec file
- updated the patch so that new accounts created on shadowed system won't
  confuse pam_pwdb anymore ('!!' default password instead on '!')
- fixed a bug that made useradd -G segfault
- the check for the ut_user is now patched into configure- added patch for XOPEN oddities in glibc headers
- check for ut_user before checking for ut_name -- this works around some
  confusion on glibc 2.1 due to the utmpx header not defining the ut_name
  compatibility stuff. I used a gross sed hack here because I couldn't make
  automake work properly on the sparc (this could be a glibc 2.0.99 problem
  though). The utuser patch works fine, but I don't apply it.
- sleep after running autoconf- added forgot lastlog command to the spec file- obsoletes adduser- modified groupadd; updated the patch- updated to 970616
- changed useradd to meet RH specs
-�x�����x�p��������Xl��������X�W��$G����������������W�V�X��1bfab05f9c592711df93bf45ffc428de5519c8aacd0c24c0adde0c2ad713107bc6e18faac125e228fb59b477dd752c3e5767bee0537480e191d752ef21fd8d96b1c263f4cf52a81639951694aa9d7d0d9cc1000854ec73ba111c062ccafd8d96b1c263f4cf52a81639951694aa9d7d0d9cc1000854ec73ba111c062cca7283f765f6c2744bfae53c5232a4ac4a29b8bbb83763be75ef88fa3018356f267283f765f6c2744bfae53c5232a4ac4a29b8bbb83763be75ef88fa3018356f2662d88045222a2ba51eabdcc9d49650d515e5f01179c637bd3a0ff1bd0100a95162d88045222a2ba51eabdcc9d49650d515e5f01179c637bd3a0ff1bd0100a951189432569258dee015a40354ccb3d02bc0096f27ca319e464a5beac48941e483189432569258dee015a40354ccb3d02bc0096f27ca319e464a5beac48941e483060e860a0b4fc80c5eb2be4fae1bed7a4df4c32838bd4cdf7fbb88ba997968a8060e860a0b4fc80c5eb2be4fae1bed7a4df4c32838bd4cdf7fbb88ba997968a841c129b05e78b107d0eb0fdda48661603794dc031bd7dea1a937982e6625c10e41c129b05e78b107d0eb0fdda48661603794dc031bd7dea1a937982e6625c10e9553be498cd9fd7dcc039a327d576324d1c450f68e7dcd3dd3768c8fcc3cf8e69553be498cd9fd7dcc039a327d576324d1c450f68e7dcd3dd3768c8fcc3cf8e664654aa9a1c4850a4f79090ea324cd1e0466f0d8f431b5a114c0ee11c25139ec64654aa9a1c4850a4f79090ea324cd1e0466f0d8f431b5a114c0ee11c25139ec7ab40e9a0698bd5af35651a08bff6aa7e998ba7a9fb4b2a07c85ac86816b53037ab40e9a0698bd5af35651a08bff6aa7e998ba7a9fb4b2a07c85ac86816b530338630568c1b5bddf72767cf6f18864fdf49411fef4cfc9fcb550cef9300eaa5afe780811d16ffbb7b7c51211f54b6d06af2f3c29915adf6d7a29febe90709291a31a0baae2d56af7b41a16b457ef6778b1d6be45bbf63dd8d909507b580c16f829bd5c6750d06836d1e23bc398731ba378ab6e5bd91a80a9e488157f160bbaf9278af99529241907c1d0e2ae60e82f669141ae60e7a9fb6137bd3edf2bd9807aa0b31085c4179dac53c66cea59a176b3083064721c164358e2293a62ee84554cb21a57b3c8f7d56e78f9538c9ead3346681329ef316a8829b277ea9a9e762947c91a8f06526ee4ee84c6ccfdc39a87cf96f2d69f3e9e9d1610d7ba7c5b17f2a0428d15f2065b4057df9a3e1f5239e555d84fc0308a9b620ea472aefc96bd8b92c896445943894f52b10180035b031ef1c82a5a8749f6be802c05e57f90523d1db9d78dafc00162d61f0ed68e2a7964bfa7a430082a6bf406a24f388e616f7d31388f9ac126b206f348accf639b3d2295192b6757d4e273639a952ce35baaabbb1a43fc02cf8432a4d7c7f05757911959c96e03faababbba4c423532c9f640d520d125addd3d434a5e52c3843bc8b180ccffa2ada0f3e2c5caae741ed0adb2da4b502385f01ca68a75215af3ae048359a9f0e66721ba539e18450d59e0a0b1dd4216faccd44728faeb75c7e662d7c84152af9414fd5a8dc992a04ac5eef1fbf9a38498423a3c5aab75c85d92c1ccd460d40f1e6a1361f896e8e67f4bec239bee8a4297d68324aedd2441509369cb0e0278d54288ac1206a36ce54d495cacd0bf06bcebcf46106614fb0b079ae46849650a2f52488317964568c1dfec4badcff4e073ddcdfacd42bea5a9b7bd46874387a9c45f8b0fed8ef77776130c3ae9108d5483dae7e30ae1361091133b96a198af8e206b055541f517e5c39861fb7a12798a3982e2c87a39e9544510a1e3220a0709e07969ed361a7aaff819441b33c12a5c8bd92bcc843028bc4ad0647d1322254009585befad24e4afdc8f368dba10828558a73a6a0d5ae974f1395369bf28296c0cddba6444dbc6c71c39799cca56757d22e929fb22fc39ca0c3e839a1b3affdabc44c2fd385000bb5b8ce9a92d6f3d312ee41aad4d8ca62a8a707bd1a7a0f1345609ad73262fe53433f4247a79126f5ee44cc54100954fe37cf1efaa3326a6d9007eb6c884e71521de9021b8f5a13c251e4528627bb0f24ebe2a10f80ad7c8907ebf3f05693578eca3656b39347d91eac7e9da9ac18c46d21f80be2e2ea04ed72a66ded7fecc081d229aaea67a8c122fefcbe5e3fe2fbf9599d87215c0c8ca88562a78868e01fb6abb47f8db543f677ff6a32c420d6b47019fda0395da82dfc93eb7eb8b76cb5ea7f62f37a6445e822ec03a7d6185c360de5cd28953013333d3266535e93b4dcf4d92c240484d658a07a1065871734f89ecdc5e32e6feae593a3b8664f26575c9edc58260ca0bce71334dc106bfa82fb7a992ffd93b97033caec94ef1606181a95ff9d9041122b7c2345320b4edfe25711bd8cdf8ef13854cfab4ceaec6807a98cabe1943663ed5c4e45320b4edfe25711bd8cdf8ef13854cfab4ceaec6807a98cabe1943663ed5c4ef90365c5eda963479917d72317924b247c6b1df4984f624202a93fdda43e597af90365c5eda963479917d72317924b247c6b1df4984f624202a93fdda43e597a01e2f2b23306993384ed135e3bb1ef0e90669f30d27e08ceab383e56be42aed701e2f2b23306993384ed135e3bb1ef0e90669f30d27e08ceab383e56be42aed7bbd8b1e48a0059e375769eaa442d5fd0d8534f91e6c13ea56e3c8821b7e300acbbd8b1e48a0059e375769eaa442d5fd0d8534f91e6c13ea56e3c8821b7e300acb2750ad5a2427318571ed6666890a08d16f68250bd1c�x����������������������X�k�F
h�������E3�$U����������������E3D3F3�1.6 and 1.5.28- automated rebuild- update to 2.1.5- update to 2.1.4- automated rebuild- modify to build with db 4.x- update cyrus-sasl 2 to 2.1.2
- change buildreq to db3-devel- suppress output to stdout/stderr in %postun- configure sasldb2 to use berkeley DB instead of gdbm- update to 2.1.1- marge 1.5.24 back in, making a note that it should be removed at some
  point in the future- update to 2.1.0, which is designed to be installed in parallel with cyrus sasl
  1.x, so fork the package and rename it to cyrus-sasl2
- add the sasldb auxprop plugin to the main package
- add disabled-by-default saslauthd init script
- move the .la files for plugins into their respective packages -- they're
  needed by the library- free ride through the build system- patch to fix possible syslog format-string vulnerability- add pam-devel as a buildprereq- include sample programs in the -devel subpackage, prefixing their names
  with "sasl-" to reduce future potential naming conflicts- build without -ggdb- add gdbm-devel as a build dependency (#44990)
- split off CRAM-MD5 and DIGEST-MD5 into a subpackage of their own (#43079,
  and dialogs with David L. Parsley)- split out the PLAIN and LOGIN mechanisms into their own package (this allows
  an administrator to disable them by simply removing the package)- rebuild in new environment- fix gssapi-over-tls- enable static libraries, but always build with -fPIC- make sure the version of 1.5.24 in the package matches the masters (#18968)- re-add the libsasl.so symlink to the -devel package (oops)- move .so files for modules to their respective packages -- they're not -devel
  links meant for use by ld anyway- split off -devel subpackage
- add a -gssapi subpackage for the gssapi plugins- fix the summary text- re-enable arcfour and CRAM- force use of gdbm for database files to avoid DB migration weirdness
- enable login mechanism
- disable gssapi until it can coexist peacefully with non-gssapi setups
- actually do a make in the build section (#15410)- update to 1.5.24- automatic rebuild- rebuild in new environment (release 3)- don't muck with syslogd in post
- remove patch for db-3.0 wackiness, no longer needed- FHS cleanup
- don't strip anything by default- fixed man pages not being gzipped- incorporated changes from Mads Kiilerich
- release number is 1, not mk1- updated to sasl 1.5.11
- configure --disable-krb4 --without-rc4 --disable-cram 
  because of missing libraries and pine having cram as default...
- handle changing libsasl.so versions- changed group- first build for Powertools/bin/sh/bin/sh/bin/sh/bin/sh/bin/sh	

2.1.27-6.el8_52.1.27-6.el8_52.1.27-6.el8_5	
saslauthdsaslauthd.build-id4f06b63134b56f78a17dd88f968d1ee902e1486854d83aa20a127c1ea7d363d0499c9f989cafdc1485ac574e6263605fd7cfcbdef6ec1ef3da43ed26saslauthd.servicepluginviewersaslauthdtestsaslauthdcyrus-saslLDAP_SASLAUTHDpluginviewer.8.gzsaslauthd.8.gzsasldblistusers2.8.gzsaslpasswd2.8.gztestsaslauthd.8.gz/etc/sysconfig//run//usr/lib//usr/lib/.build-id//usr/lib/.build-id/4f//usr/lib/.build-id/54//usr/lib/.build-id/85//usr/lib/systemd/system//usr/sbin//usr/share/doc//usr/share/doc/cyrus-sasl//usr/share/man/man8/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnuASCII textcannot open `/bui�x�������������`|�������Xamq���������$v�������������������4�?4�
�a�l�u�	~�	��3��3��3��3��3��	3�3�3�(4+X44Y4@
4��4�h4�xsFNBFb8EKsBEADwGmleOSVThrbCyCVUdCreMTKpmD5p5aPz/0jc66050MAb71Hv
TVcfuMqHYO8O66qXLpEdqZpuk4D+rw1oKyC+d8uPD2PSHRqBXnR0Qf+LVTZvtO92
3R7pYnC2x6V6iVGpKQYFP8cwh2B1qgIa+9y/N8cQIqfD+0ghyiUjjTYek3YFBnqa
L/2h2V0Mt0DkBrDK80LqEY10PAFDfJjINAW9XNHZzi2KqUx5w1z8rItokXV6fYE5
ItyGMR6WVajJg5D4VCiZd0ymuQP2bGkrRbl6FH5vofVSkahKMJeHs2lbvMvNyS3c
n8vxoBvbbcwSAV1gvB1uzXXxv0kdkFZjhU1Tss4+Dak8qeEmIrC5qYycLxIdVEhT
Z8N8+P7Dll+QGOZKu9+OzhQ+byzpLFhUHKys53eXo/HrfWtw3DdP21yyb5P3QcgF
scxfZHzZtFNUL6XaVnauZM2lqquUW+lMNdKKGCBJ6co4QxjocsxfISyarcFj6ZR0
5Hf6VU3Y7AyuFZdL0SQWPv9BSu/swBOimrSiiVHbtE49Nx1x/d1wn1peYl07WRUv
C10eF36ZoqEuSGmDz59mWlwB3daIYAsAAiBwgcmN7aSB8XD4ZPUVSEZvwSm/IwuS
Rkpde+kIhTLjyv5bRGqU2P/Mi56dB4VFmMJaF26CiRXatxhXOAIAF9dXCwARAQAB
zS1NYXJpYURCIFNpZ25pbmcgS2V5IDxzaWduaW5nLWtleUBtYXJpYWRiLm9yZz7C
wXgEEwEIACIFAlb8EKsCGwMGCwkIBwMCBhUIAgkKCwQWAgMBAh4BAheAAAoJEPFl
byTHTNHYJZ0P/2Z2RURRkSTHLKZ/GqSvPReReeB7AI+ZrDapkpG/26xp1Yw1isCO
y99pvQ7hjTFhdZQ7xSRUiT/e27wJxR7s4G/ck5VOVjuJzGnByNLmwMjdN1ONIO9P
hQAs2iF3uoIbVTxzXof2F8C0WSbKgEWbtqlCWlaapDpN8jKAWdsQsNMdXcdpJ2os
WiacQRxLREBGjVRkAiqdjYkegQ4BZ0GtPULKjZWCUNkaat51b7O7V19nSy/T7MM7
n+kqYQLMIHCF8LGd3QQsNppRnolWVRzXMdtR2+9iI21qv6gtHcMiAg6QcKA7halL
kCdIS2nWR8g7nZeZjq5XhckeNGrGX/3w/m/lwczYjMUer+qs2ww5expZJ7qhtSta
lE3EtL/l7zE4RlknqwDZ0IXtxCNPu2UovCzZmdZm8UWfMSKk/3VgL8HgzYRr8fo0
yj0XkckJ7snXvuhoviW2tjm46PyHPWRKgW4iEzUrB+hiXpy3ikt4rLRg/iMqKjyf
mvcE/VdmFVtsfbfRVvlaWiIWCndRTVBkAaTu8DwrGyugQsbjEcK+4E25/SaKIJIw
qfxpyBVhru21ypgEMAw1Y8KC7KntB7jzpFotE4wpv1jZKUZuy71ofr7g3/2O+7nW
LrR1mncbuT6yXo316r56dfKzOxQJBnYFwTjXfa65yBArjQBUCPNYOKr0wkYEEhEI
AAYFAlb8JFYACgkQy8sIKhu5Q9snYACgh3id41CYTHELOQ/ymj4tiuFt1lcAn3JU
9wH3pihM9ISvoeuGnwwHhcKnwsFcBBIBCAAGBQJW/CSEAAoJEJFxGJmV5Fqe11cP
/A3QhvqleuRaXoS5apIY3lrDL79Wo0bkydM3u2Ft9EqVVG5zZvlmWaXbw5wkPhza
7YUjrD7ylaE754lHI48jJp3KY7RosClY/Kuk56GJI/SoMKx4v518pAboZ4hjY9MY
gmiAuZEYx5Ibv1pj0+hkzRI78+f6+d5QTQ6y/35ZjSSJcBgCMAr/JRsmOkHu6cY6
qOpq4g8mvRAX5ivRm4UxE2gnxZyd2LjY2/S2kCZvHWVaZuiTD0EU1jYPoOo6fhc8
zjs5FWS56C1vp7aFOGBvsH3lwYAYi1K2S+/B4nqpitYJz/T0zFzzyYe7ZG77DXKD
/XajD22IzRGKjoeVPFBx+2V0YCCpWZkqkfZ2Dt3QVW//QIpVsOJnmaqolDg1sxoa
BEYBtCtovU0wh1pXWwfn7IgjIkPNl0AU8mW8Ll91WF+Lss/oMrUJMKVDenTJ6/ZO
06c+JFlP7dS3YGMsifwgy5abA4Xy4GWpAsyEM68mqsJUc7ZANZcQAKr6+DryzSfI
Olsn3kJzOtb/c3JhVmblEO6XzdfZJK/axPOp3mF1oEBoJ56fGwO2usgVwQDyLt3J
iluJrCvMSBL9KtBZWrTZH5t3rTMN0NUALy4Etd6Y8V94i8c5NixMDyjRU7aKJAAw
tUvxLd12dqtaXsuvGyzLbR4EDT/Q5DfLC1DZWpgtUtCVwsFcBBIBCAAGBQJW/CS2
AAoJEEHdwLQNpW8iMUoP/AjFKyZ+inQTI2jJJBBtrLjxaxZSG5ggCovowWn8NWv6
bQBm2VurYVKhvY1xUyxoLY8KN+MvoeTdpB3u7z+M6x+CdfoTGqWQ2yapOC0eEJBF
O+GFho2WE0msiO0IaVJrzdFTPE0EYR2BHziLu0DDSZADe1WYEqkkrZsCNgi6EMng
mX2h+DK2GlC3W2tY9sc63DsgzjcMBO9uYmpHj6nizsIrETqouVNUCLT0t8iETa25
Mehq/I92I70Qfebv7R4eMrs+tWXKyPU0OjV+8b8saZsv1xn98UkeXwYx4JI04OTw
nBeJG8yPrGDBO5iucmtaCvwGQ3c76qBivrA8eFz3azRxQYWWiFrkElTg+C/E83JQ
WgqPvPZkI5UHvBwBqcoIXG15AJoXA/ZWIB8nPKWKaV5KDnY3DBuA4rh5Mhy3xwcC
/22E/CmZMXjUUvDnlPgXCYAYU0FBbGk7JpSYawtNfdAN2XBRPq5sDKLLxftx7D8u
ESJXXAlPxoRh7x1ArdGM+EowlJJ0xpINBaT0Z/Hk0jxNIFEak796/WeGqewdOIki
dAs4tppUfzosla5K+qXfWwmhcKmpwA4oynE8wIaoXptoi8+rxaw4N6wAXlSrVxeC
VTnb7+UY/BT2Wx6IQ10C9jrsj6XIffMvngIinCD9Czvadmr7BEIxKt1LP+gGA8Zg
wsFcBBIBCgAGBQJYE6oDAAoJEL7YRJ/O6NqIJ24P+QFNa2O+Q1rLKrQiuPw4Q73o
7/blUpFNudZfeCDpDbUgJ01u1RHnWOyLcyknartAosFDJIpgcXY5I8jsBIO5IZPR
C/UKxZB3RYOhj49bySD9RNapHyq+Y56j9JUoz6tkKFBd+6g85Ej8d924xM1UnRCS
9cfI9W0fSunbCi2CXLbXFF7V+m3Ou1SVYGIAxpMn4RXyYfuqeB5wROR2GA5Ef6T3
S5byh1dRSEgnrBToENtp5n7Jwsc9pDofjtaUkO854l45IqFarGjCHZwtNRKd2lcK
FMnd1jS0nfGkUbn3qNJam1qaGWx4gXaT845VsYYVTbxtkKi+qPUIoOyYx4NEm6fC
ZywH72oP+fmUT/fbfSHa5j137dRqokkR6RFjnEMBl6WHwgqqUqeIT6t9uV6WWzX9
lNroZFAFL/de7H31iIRuZcm38DUZOfjVf9glweu4yFvuJ7cQtyQydFQJV4LGDT/C
8e9TWrV1/gWMyMGQlZsRWa+h+FfFUccQtfSdXpvSxtXfop+fVQmJgUUl92jh4K9j
c9a6rIp5v1Q1yEgs2iS50�x�������������(l�������XSk������������$ ���������������������tor in the more command (patch by Steve Grubb)- use ncurses only
- fix #218915 - fdisk -b 4K
- upgrade to -pre7 release
- fix building problem with raw0 patch
- fix #217186 - /bin/sh: @MKINSTALLDIRS@: No such file or directory 
  (port po/Makefile.in.in from gettext-0.16)
- sync with FC6 and RHEL5:
- fix #216489 - SCHED_BATCH option missing in chrt
- fix #216712 - issues with raw device support ("raw0" is wrong device name)
- fix #216760 - mount with context or fscontext option fails
  (temporarily disabled the support for additional contexts -- not supported by kernel yet)
- fix #211827 - Can't mount with additional contexts
- fix #213127 - mount --make-unbindable does not work
- fix #211749 - add -r option to losetup to create a read-only loop- fix #209911 - losetup.8 updated (use dm-crypt rather than deprecated cryptoloop)
- fix #210338 - spurious error from '/bin/login -h $PHONENUMBER' (bug in IPv6 patch)
- fix #208634 - mkswap "works" without warning on a mounted device- rebuilt for unwind info generation, broken in gcc-4.1.1-21- remove obsolete NFS code and patches (we use /sbin/mount.nfs
  and /sbin/umount.nfs from nfs-utils now)
- move nfs.5 to nfs-utils- fix #205038 - mount not allowing sloppy option (exports "-s"
  to external /sbin/mount.nfs(4) calls) 
- fix minor bug in util-linux-2.13-mount-twiceloop.patch
- fix #188193- util-linux should provide plugin infrastructure for HAL- fix Makefile.am in util-linux-2.13-mount-context.patch
- fix #201343 - pam_securetty requires known user to work
		(split PAM login configuration to two files)
- fix #203358 - change location of taskset binary to allow for early affinity work- fix #199745 - non-existant simpleinit(8) mentioned in ctrlaltdel(8)- Change keycreate line to happen after pam_selinux open call so it gets correct context- fix #176494 - last -i returns strange IP addresses (patch by Bill Nottingham)- fix #198300, #199557 - util-linux "post" scriptlet failure- Added the -o fsc flag to nfsmount.- rebuild- add Requires(post): libselinux- add IPv6 support to the login command (patch by Milan Zazrivec)
- fix #198626 - add keyinit instructions to the login PAM script 
  (patch by David Howells)- rebuild- cleanup dependences for post and preun scriptlets- silence install in minimal buildroot without /var/log- include the raw command for RHELs- move install-info parts from postun to preun- Only execute chcon on machines with selinux enabled- Remove unneeded header files from nfsmount.c- fix #187014 - umount segfaults for normal user
- fix #183446 - cal not UTF-8-aware
- fix #186915 - mount does not translate SELIinux context options though libselinux
- fix #185500 - Need man page entry for -o context= mount option
- fix #152579 - missing info about /etc/mtab and /proc/mounts mismatch
- fix #183890 - missing info about possible ioctl() and fcntl() problems on NFS filesystem
- fix #191230 - using mount --move results in wrong data in /etc/mtab
- added mount subtrees support
- fdisk: wrong number of sectors for large disks (suse#160822)
- merge fdisk-xvd (#182553) with new fdisk-isfull (#188981) patch 
- fix #181549 - raw(8) manpage has old information about dd
- remove asm/page.h usage- Remove requirement on restorecon, since we can do the same thing
- with chcon/matchpathcon, and not add requirement on policycoreutils- Fixed bug in patch for bz183713 which cause nfs4 mounts to fail.- Added syslog logging to background mounts as suggested
  by a customer.- fix #183713 - foreground mounts are not retrying as advertised
- fix #151549 - Added 'noacl' mount flag
- fix #169042 - Changed nfsmount to try udp before using tcp when rpc-ing
		the remote rpc.mountd (iff -o tcp is not specified).
		This drastically increases the total number of tcp mounts
		that can happen at once (ala autofs).- Better calling of restorecon as suggested by Bill Nottingham
- prereq restorecon to avoid ordering issues- restorecon /var/log/lastlog- fix #181782 - mkswap selinux relabeling (fix util-linux-2.13-mkswap-selinux.patch)- fix #181782 - mk�x��������������[�������X�l���������v�������)�$^�����������������))�-�8375726345c64cf9071f7bb0ae266a26887d88501135431109c5f1c42fa1d6635d9864dc018563093a34cd63dabcd48233ddfbd8093559622ff4b471eb2033706666d445b9ef8646826daeb1c7f6fea915de9f59d712a631aa83f96d643b0a69de9c2734c3c1e02e5e66221e768ad6d284f6018b16f8fff4be0970f137066aaab36590ff8f3947625333024f7d9f1ac189236d6f452dea3bd17baaa9220da0e1076cabe5d2b4999561898f7a0530ae1e6ab724ee16df42e5dde8c67a09f8abad9cf5426d62ef2a0d20b003279b13299aa447c9391e2b37f3bb77e1f3a351baaa73ec2342625d2d07697f8de56ac1a4515bc40133fa0a9f54599a46a28d5ef61f05d986675fa08d678ba8bd310cff8d913ab1f721a452186a5cc096b8862a037ae83ae86b688af3f820f870080c4e44c9e34e79e0c084471e4dd9aa833311513b5403319fe3fcf1c4ad77422d642b240fd34deb58b849fcc11099d89f1689490942e6cb4b1bde722c48f627e3dfc0ee8ba841155ee952a2b98949338559078755a3913d53c04164776dd5c0a6d32e318655b853b1241d5e2871154806cb5f325c53cb3f4e0ff2a540d368e0c73dc472d639d7c8dc4667882773d722f42f01404ac7d029da6f3ec9cd9e184878a6015f6de2f302f1478fb2bbc3dfe74c626347d7f5727633f627a0bd9948d461a292c0b5219ba20e2fd6f121fc44a04fb2a02428e14e6a54b5a208edf898d13f24c12e11c98cefa5f9a536be7dcc4a7f2e59485cf90e88d6795add41bbb69827c8cc1871c60a0f7e5769469769f84a6f80ef6c36eca9136dc0e96559f9c2e29263da3557c8e2b23dc0456bf98331db85413a9264ec5ffd43a6df50d537ab39d86e38278a758ec860eb43f2be973928b4763f453531df1dc3897cfa0e45a6db3fc371c771d6d64ba681d4b1a08116036980aa15be4ee55626d58a21bc2d45d502e63c854a045d032e27ced720db905665748fe7711a702550472d2bc3ef1bbb0bca238e291944c834588110c8a65718aafaa8a63e15d619554a0d3e5fa0d5577f03c55964e2ef4e4c8059dd9d4bb9e4936971846730829e6bd9755133ad8e994e834632fc0adcf7ba06c79af0c6cb6becd4a46f950e5f72af7992d49879fbf786e9fb42160441e3be398104e87f32af924064d8c3482db31b63b0756d11ead18adc7b8c35f4377eef8f74ac33876a6c69b6e1ca1c8b5aa6bdabdfa83b41b3373bedd35b0e2490773a8a38f14bb62cea4e91dd6f1cbcd9f467172ff196e3cc45ae9691f7fdb4cf9f79584ad0d18cc3acee67cdd6fa845d756bece5aaa0facecc3994c0a1b4b026ca92d671bbed88c4bdc5f31273182b4488aed5d2cc52d8efc756321a1cebf834f8ac40e5555dd44225026b13e22a7748e5356626c1c2149e3e083eb56792ccf9df6890f83ef3e8b90e3836fb1b4718c1773f5937c7bbd59b57c235db14d5fc3d60fb717c2a1d25f1b025b5fdb27187a0eb3873a20679daa2a72d30db8783a099d450120e282c7e6307ec94e5809d02ac799fb538764a5a011711f451e07ed35c5c493dda4b65fc7a446d0c00dab5cc626a758d2ba96eb941d8c16b7e00b633623ac9319e57aea69c7a16b26cb8a1d323260d486a7c51cc130162e064a447757a648a48ed2b3f01c7daccb431d89ec007d9e3aad3a98c6f0a73a110d321fd3f66bb75ad42419895abb48f840b292f8cc7ad64d7593d601db938ba80d2196a30d2ca013f5073ca2b31377d1a02d6287fe92c750ce5db4689cfa8de1aacbe9afabe5ff039452b06130752f5514f008633350e92ee219060e8f93dafa027499a0fb7294946af2749ede848f80b122b145c548a5bceb4f931eace29626b0d34eaac41b503f7518a77434f1a7c33c367a66b2ba0cbff09b286ba026d620072b85237b1bf039f2971999dd9e56b47fbfe5fc9adc3d898f6519e7c472e96a88d3aa7fe270629d6bb36b0b3770453fc34ce310d29439145b26a687d8bc8150bc0c0c24d8b598b56c1ae8289c97884fc8b2e008d76f1a82d6eb96021fc9bef7a0f36905d94f0d8babfa86450e01d5134964d8f3fffd8da464b36fbaa7dacea0de62324bed34a8ea57d58a22d349abd9af8c9038c40ca3dcfa2840251fd14f94f0b5ae7b7d8ab836d2e7b74ac48ac78bdd7f26bbebe16fe2096178c12890bc61ce355372773807e35f1e339100be5f2cee3fe16b8dacd21385d37245ea90ac5aab8bf6e8c915014bad83d809d39d3118ce428b1dd1d4d2bb7b3aa37f5421cdee9bbe4f144a0da4cabc09d20498cb77128f48186cd4a1a58c1e59908086734e9eded96a30d9b090f5eabfdea97bd40e6a01ed503ce88e1fe3afd56f2c1be7c9b2f305dba094d7084dcd1ac2b6b2a1c854d575cc6906d7c483dd98f52685843354fa3bf4613417fb55f3d80ba90aa4ddbced67a80b0e8597c5aa876cac676f2d9c5c3bfc064872bf8d76c0eab5c364a3dab0d461ecb1e10203f3b1300d37d354a380cd010ddadbe3bc3522afde82684790faadad67f1b4fe2dda8f0731acecb32f0fab3fc6aa1728a1c6927fd70353f740c04e62b1fd9b7a0c4dc9dec1ffba82741f07c9a7029ecf7542721e0d5dae7b9d7a1ca2d3f051c3d6c0daa7330c5b0a81878303dce5158b3d1d38d8b948a5b2282ee2bb10e3987285b205cebfd20ce8af734a96547da3be6c096874ef646260e865b2973c1d02d4e9e93b5ec3e68964d1ce47e41dc8c69b1a6a1360dab73a90e4cfacd27484a2281f67d92b1aad71ca227edc9ddfd61019f1b3e9267f2835864ce51cdc019d3558587ca8a123e4726402251d36cec7d57b�x�����p	�J�������XQ�m��������H��$����������������a	�n��~��@��эh^k�*��}��x��������������:�������X
Zl���������
��$����������������
��	��e-ESRCH-in-qemu_cpu_kick_thread.patch [bz#1668205]
- Resolves: bz#1653114
  (Incorrect NUMA nodes passed to qemu-kvm guest in ibm,max-associativity-domains property)
- Resolves: bz#1668205
  (Guest quit with error when hotunplug cpu)- kvm-virtio-Helper-for-registering-virtio-device-types.patch [bz#1648023]
- kvm-virtio-Provide-version-specific-variants-of-virtio-P.patch [bz#1648023]
- kvm-globals-Allow-global-properties-to-be-optional.patch [bz#1648023]
- kvm-virtio-Make-disable-legacy-disable-modern-compat-pro.patch [bz#1648023]
- kvm-aarch64-Add-virt-rhel8.0.0-machine-type-for-ARM.patch [bz#1656504]
- kvm-aarch64-Set-virt-rhel8.0.0-max_cpus-to-512.patch [bz#1656504]
- kvm-aarch64-Use-256MB-ECAM-region-by-default.patch [bz#1656504]
- Resolves: bz#1648023
  (Provide separate device types for transitional virtio PCI devices - Fast Train)
- Resolves: bz#1656504
  (Machine types for qemu-kvm based on rebase to qemu-3.1 (aarch64))- kvm-hw-s390x-s390-virtio-ccw-Add-machine-types-for-RHEL8.patch [bz#1656510]
- kvm-spapr-Add-H-Call-H_HOME_NODE_ASSOCIATIVITY.patch [bz#1661967]
- kvm-redhat-Fixing-.gitpublish-to-include-AV-information.patch []
- Resolves: bz#1656510
  (Machine types for qemu-kvm based on rebase to qemu-3.1 (s390x))
- Resolves: bz#1661967
  (Kernel prints the message "VPHN is not supported. Disabling polling...")- kvm-redhat-define-pseries-rhel8.0.0-machine-type.patch [bz#1656508]
- Resolves: bz#1656508
  (Machine types for qemu-kvm based on rebase to qemu-3.1 (ppc64le))- kvm-pc-7.5-compat-entries.patch [bz#1655820]
- kvm-compat-Generic-HW_COMPAT_RHEL7_6.patch [bz#1655820]
- kvm-pc-PC_RHEL7_6_COMPAT.patch [bz#1655820]
- kvm-pc-Add-compat-for-pc-i440fx-rhel7.6.0-machine-type.patch [bz#1655820]
- kvm-pc-Add-pc-q35-8.0.0-machine-type.patch [bz#1655820]
- kvm-pc-Add-x-migrate-smi-count-off-to-PC_RHEL7_6_COMPAT.patch [bz#1655820]
- kvm-clear-out-KVM_ASYNC_PF_DELIVERY_AS_PF_VMEXIT-for.patch [bz#1659604]
- kvm-Add-edk2-Requires-to-qemu-kvm.patch [bz#1660208]
- Resolves: bz#1655820
  (Can't migarate between rhel8 and rhel7 when guest has device "video")
- Resolves: bz#1659604
  (8->7 migration failed: qemu-kvm: error: failed to set MSR 0x4b564d02 to 0x27fc13285)
- Resolves: bz#1660208
  (qemu-kvm: Should depend on the architecture-appropriate guest firmware)- Rebase to qemu-kvm 3.1.0- kvm-Disable-CONFIG_IPMI-and-CONFIG_I2C-for-ppc64.patch [bz#1640044]
- kvm-Disable-CONFIG_CAN_BUS-and-CONFIG_CAN_SJA1000.patch [bz#1640042]
- Resolves: bz#1640042
  (Disable CONFIG_CAN_BUS and CONFIG_CAN_SJA1000 config switches)
- Resolves: bz#1640044
  (Disable CONFIG_I2C and CONFIG_IPMI in default-configs/ppc64-softmmu.mak)- kvm-qcow2-Give-the-refcount-cache-the-minimum-possible-s.patch [bz#1656507]
- kvm-docs-Document-the-new-default-sizes-of-the-qcow2-cac.patch [bz#1656507]
- kvm-qcow2-Fix-Coverity-warning-when-calculating-the-refc.patch [bz#1656507]
- kvm-include-Add-IEC-binary-prefixes-in-qemu-units.h.patch [bz#1656507]
- kvm-qcow2-Options-documentation-fixes.patch [bz#1656507]
- kvm-include-Add-a-lookup-table-of-sizes.patch [bz#1656507]
- kvm-qcow2-Make-sizes-more-humanly-readable.patch [bz#1656507]
- kvm-qcow2-Avoid-duplication-in-setting-the-refcount-cach.patch [bz#1656507]
- kvm-qcow2-Assign-the-L2-cache-relatively-to-the-image-si.patch [bz#1656507]
- kvm-qcow2-Increase-the-default-upper-limit-on-the-L2-cac.patch [bz#1656507]
- kvm-qcow2-Resize-the-cache-upon-image-resizing.patch [bz#1656507]
- kvm-qcow2-Set-the-default-cache-clean-interval-to-10-min.patch [bz#1656507]
- kvm-qcow2-Explicit-number-replaced-by-a-constant.patch [bz#1656507]
- kvm-block-backend-Set-werror-rerror-defaults-in-blk_new.patch [bz#1657637]
- kvm-qcow2-Fix-cache-clean-interval-documentation.patch [bz#1656507]
- Resolves: bz#1656507
  ([RHEL.8] qcow2 cache is too small)
- Resolves: bz#1657637
  (Wrong werror default for -device drive=<node-name>)- kvm-target-ppc-add-basic-support-for-PTCR-on-POWER9.patch [bz#1639069]
- kvm-linux-headers-Update-for-nested-KVM-HV-downstream-on.patch [bz#1639069]
- kvm-target-ppc-Add-one-reg-id-fo�x�������������*�������X�j���������	G�$W����������������GH�k3�ۉ�K�ti1�2a����
DZK=E�]!��gdcW&���K�U�b��qe`c
	�U�b��q]��*M����]bah�"��z�5ş�T�Ɵӻ%�=$l�oSS�va852fc9005ea1cc99072e0e11eacdd91a36856ea75ed42d4b1cfdf9bd0093b0cb2b57c401306a78015773b49679f227b6a7de478i=��i=�{06]
- [netdrv] mt76: mt7603: notify mac80211 about buffered frames in ps queue (Jarod Wilson) [1776606]
- [netdrv] mt76: mt7603: fix up hardware queue index for PS filtered packets (Jarod Wilson) [1776606]
- [netdrv] mt76: mt7603: clear ps filtering mode before releasing buffered frames (Jarod Wilson) [1776606]
- [netdrv] mt76: mt7603: fix tx status HT rate validation (Jarod Wilson) [1776606]
- [netdrv] mt76: add driver for MT7603E and MT7628/7688 (Jarod Wilson) [1776606]
- [netdrv] mt76: mt76x0u: do not reset radio on resume (Jarod Wilson) [1776606]
- [netdrv] mt7601u: null check the allocation (Jarod Wilson) [1776606]
- [netdrv] mt7601u: use params->ssn value directly (Jarod Wilson) [1776606]
- [netdrv] mt76: usb: fix rx A-MSDU support (Jarod Wilson) [1776606]
- [netdrv] mt76: mt76u: get rid of {out,in}_max_packet (Jarod Wilson) [1776606]
- [netdrv] mt76: mt76u: reduce rx memory footprint (Jarod Wilson) [1776606]
- [netdrv] mt76: mt76x02u: fix sparse warnings: should it be static? (Jarod Wilson) [1776606]
- [netdrv] mt76: mt76x0: fix RF frontend initialization for external PA (Jarod Wilson) [1776606]
- [netdrv] mt76: generalize mt76_get_txpower for 4x4:4 devices (Jarod Wilson) [1776606]
- [netdrv] mt76: mt76x02: fix tx reordering on rate control probing without a-mpdu (Jarod Wilson) [1776606]
- [netdrv] mt76: mt76x02: fix tx status reporting issues (Jarod Wilson) [1776606]
- [netdrv] mt76: mt76x02: fix edcca file permission (Jarod Wilson) [1776606]
- [netdrv] mt76: mt76x02: run mt76x02_edcca_init atomically in mt76_edcca_set (Jarod Wilson) [1776606]
- [netdrv] mt76: mt76x2: move mutex_lock inside mt76x2_set_channel (Jarod Wilson) [1776606]
- [netdrv] mt76: mt76x2u: remove mt76x02_edcca_init in mt76x2u_set_channel (Jarod Wilson) [1776606]
- [netdrv] mt76: mt76x02: remove enable from mt76x02_edcca_init signature (Jarod Wilson) [1776606]
- [netdrv] mt76: move tx_napi in mt76_dev (Jarod Wilson) [1776606]
- [netdrv] mt76: mt76x02: remove useless return in mt76x02_resync_beacon_timer (Jarod Wilson) [1776606]
- [netdrv] mt7601u: fix possible memory leak when the device is disconnected (Jarod Wilson) [1776606]
- [netdrv] mt7601u: do not schedule rx_tasklet when the device has been disconnected (Jarod Wilson) [1776606]
- [netdrv] mwifiex: don't disable hardirqs; just softirqs (Jarod Wilson) [1776606]
- [netdrv] mwifiex: dispatch/rotate from reorder table atomically (Jarod Wilson) [1776606]
- [netdrv] mwifiex: ignore processing invalid command response (Jarod Wilson) [1776606]
- [netdrv] mwifiex: update set_mac_address logic (Jarod Wilson) [1776606]
- [netdrv] mwifiex: print PCI mmap with pK (Jarod Wilson) [1776606]
- [netdrv] mwifiex: drop 'set_consistent_dma_mask' log message (Jarod Wilson) [1776606]
- [netdrv] iwlwifi: add support for hr1 RF ID (Jarod Wilson) [1776606]
- [netdrv] iwlwifi: change 0x02F0 fw from qu to quz (Jarod Wilson) [1776606]
- [netdrv] iwlwifi: add new cards for 22000 and change wrong structs (Jarod Wilson) [1776606]
- [netdrv] iwlwifi: add new cards for 22000 and fix struct name (Jarod Wilson) [1776606]
- [net] mac80211: notify offchannel expire on mgmt_tx (Jarod Wilson) [1776606]
- [net] nl80211: send event when CMD_FRAME duration expires (Jarod Wilson) [1776606]
- [net] mac80211: no need to check return value of debugfs_create functions (Jarod Wilson) [1776606]
- [net] mac80211: extend __rate_control_send_low warning (Jarod Wilson) [1776606]
- [net] mac80211: fill low rate even for HAS_RATE_CONTROL (Jarod Wilson) [1776606]
- [net] mac80211: use STA info in rate_control_send_low() (Jarod Wilson) [1776606]
- [net] mac80211: call rate_control_send_low() internally (Jarod Wilson) [1776606]
- [net] cfg80211: Add a function to iterate all BSS entries (Jarod Wilson) [1776606]
- [net] mac80211: allow turning TWT responder support on and o�x���������������������X�l��������7e��$u����������������e�d�f��y_limit conf option (Jaroslav Mracek)
- Reset all transaction for groups if Base.reset() (RhBug:1446432) (Jaroslav
  Mracek)
- Explain how add negative num for --latest-limit (RhBug:1446641) (Jaroslav
  Mracek)
- trivial: don't duplicate option names (Igor Gnatenko)
- Add support for --userinstalled for repoquery command (RhBug:1278124)
  (Jaroslav Rohel)
- Fix header of search result sections (RhBug:1301868) (Jaroslav Rohel)
- Filter out src for get_best_selector (Jaroslav Mracek)
- Add minor changes in formating of documentation (Jaroslav Mracek)- po: Update translations (Igor Gnatenko)
- po: Update translations (Igor Gnatenko)
- introduce '--enableplugin' option (Martin Hatina)
- Improve detection of file patterns (Jaroslav Mracek)
- Add method _get_nevra_solution() for subject (Jaroslav Mracek)
- Do not add "*" into query filter in _nevra_to_filters() (Jaroslav Mracek)
- Remove usage of nevra_possibilities_real() (Jaroslav Mracek)
- Increase performance for downgrade_to() (Jaroslav Mracek)
- Add additional keys for get_best_query() (Jaroslav Mracek)
- Increase performance for get_best_selector() (Jaroslav Mracek)
- Increase performance for get_best_query() (Jaroslav Mracek)
- Fix "Package" text translation (RhBug:1302935) (Jaroslav Rohel)
- Create a warning if releasever is None (Jaroslav Mracek)
- Adds cost, excludepkgs, and includepkgs to Doc (RhBug:1248684) (Jaroslav
  Mracek)
- Change auto-detection of releasever in empty installroot (Jaroslav Mracek)
- Do not load system repo for makecache command (RhBug:1441636) (Jaroslav
  Mracek)
- Do not raise assertion if group inst and rmv pkgs (RhBug:1438438) (Jaroslav
  Mracek)
- yum layer using python3 (Martin Hatina)
- Filter url protocols for baseurl in Package.remote_location (Jaroslav Mracek)
- Add armv5tl to arm basearch (Neal Gompa)
- Setup additional parameters for handler for remote packages (Jaroslav Mracek)
- Use same method for user/password setting of every librepo.handle (Jaroslav
  Mracek)
- Fix PEP8 violations and remove unused import (Jaroslav Mracek)
- Handle unknown file size in download progress (Jaroslav Mracek)
- Allow to delete cashed files from command line by clean command (Jaroslav
  Mracek)
- Save command line packages into chachedir (RhBug:1256313) (Jaroslav Mracek)
- Add progress bar for download of commandline pkgs (RhBug:1161950) (Jaroslav
  Mracek)
- Fix minor typo Closes: #781 Approved by: ignatenkobrain (Yuri Chornoivan)
- Mark unremoved packages as failed (RhBug:1421244) (Jaroslav Mracek)- update release notes (Jaroslav Mracek)
- po: Update translations (Igor Gnatenko)
- Add require of subcommand for repo-pkgs command (Jaroslav Rohel)
- shell: Fix commands initialization (Jaroslav Rohel)
- po: Update translations (Igor Gnatenko)
- Add support for --location for repoquery command (RhBug:1290137) (Jaroslav
  Mracek)
- Add support of --recursive with --resolve in repoquery (Jaroslav Mracek)
- Add --recursive option for repoquery (Jaroslav Mracek)
- Add --whatconflicts for repoquery (Jaroslav Mracek)
- Add support for multiple options for repoquery (Jaroslav Mracek)
- Add multiple format option for repoquery (Jaroslav Mracek)
- Fix problem with "dnf repoquery --querytags" (Jaroslav Mracek)
- Add support of 3 options into updateinfo command (Jaroslav Mracek)
- Add inheritance of reason for obsoleting packages (Jaroslav Mracek)
- Mark installonlypkgs correctly as user installed (RhBug:1349314) (Jaroslav
  Mracek)
- Solve a problem with None names in callbacks (Jaroslav Mracek)
- Solve a problem for callbacks (Jaroslav Mracek)
- Revert "remove: CLI: --randomwait" (RhBug:1247122) (Ondřej Sojka)
- po: update translations (Igor Gnatenko)
- po: update translations (Igor Gnatenko)
- Set strings for translations (RhBug:1298717) (Jaroslav Mracek)- bump version to 2.2.0 + update release notes (Jaroslav Mracek)
- Add documentation of new API callback actions (RhBug:1411432) (Jaroslav
  Mracek)
- Fix python2 doesn't have e.__traceback__ attribute (Jaroslav Mracek)
- Do not report erasing package as None. (Jaroslav Mracek)
-�x���������������������X
�lH��������Z��$J����������������Z�Y�[��rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootdnf-4.7.0-21.el8_10.alma.1.src.rpm����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������python3-dnf@@




/usr/libexec/platform-pythondnf-datalibmodulemdpython(abi)python3-gpgpython3-hawkeypython3-libcompspython3-libdnfpython3-libdnfpython3-rpmrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PartialHardlinkSets)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)4.7.0-21.el8_10.alma.12.9.33.60.63.0-80.1.80.63.0-84.14.2-353.0.4-14.6.0-14.0.4-14.0-15.2-14.14.3g�%�g�@e-%�d� �dw6�dd��dx�c���c�E�cY!@c p�b֜�b��brj�a�e�a�q@a�b�a�b�aS@`��@`���`%@`"y@`!'�`3@`��`��`2@_���_��@_���_ @_��^��@^�?@^��^K�^4�^[�]�+�]��@]��@]��@]���]nU�]i�]S��]Ik�]�@\���\�\@\�7�\eX@\]o@\\�\Z�@\/J�\��[��[�[ā@[�#@[�\�[�h@[�-�[qr�[i��[[	@[P}@[GB�[6@[2*�Y�B@Y�@Y�p@Y�*@Y�V@Yu�@Y>�@Y"�YR@Yt�X�s�X��X��X��@X�Y�XQ4@XAb@W�@W�R�W��@W��W��W��W�@WDB@W=��W��V��V�@Vr��VI�@VC�V�VB�VB�VB�U��U�A�U�5@UȒ@U�c@U�4@U��@Uv�@Uv�@U@�U�@T�	�T���T���T.��S��S��S�;@S�i@S�E�S��Sc��SW�@S0@S&�S�S
�@Eduard Abdullin <eabdullin@almalinux.org> - 4.7.0-21.alma.1Marek Blaha <mblaha@redhat.com> - 4.7.0-21Jaroslav Rohel <jrohel@redhat.com> - 4.7.0-20Jaroslav Rohel <jrohel@redhat.com> - 4.7.0-19Nicola Sella <nsella@redhat.com> - 4.7.0-18Jaroslav Rohel <jrohel@redhat.com> - 4.7.0-17Marek Blaha <mblaha@redhat.com> - 4.7.0-16Nicola Sella <nsella@redhat.com> - 4.7.0-15Nicola Sella <nsella@redhat.com> - 4.7.0-14Nicola Sella <nsella@redhat.com> - 4.7.0-13Lukas Hrazky <lhrazky@redhat.com> - 4.7.0-12Lukas Hrazky <lhrazky@redhat.com> - 4.7.0-11Richard W.M. Jones <rjones@redhat.com> - 4.7.0-10Lukas Hrazky <lhrazky@redhat.com> - 4.7.0-8Pavla Kratochvilova <pkratoch@redhat.com> - 4.7.0-7Pavla Kratochvilova <pkratoch@redhat.com> - 4.7.0-6Pavla Kratochvilova <pkratoch@redhat.com> - 4.7.0-5Pavla Kratochvilova <pkratoch@redhat.com> - 4.7.0-4Pavla Kratochvilova <pkratoch@redhat.com> - 4.7.0-3Pavla Kratochvilova <pkratoch@redhat.com> - 4.7.0-2Pavla Kratochvilova <pkratoch@redhat.com> - 4.7.0-1Nicola Sella <nsella@redhat.com> - 4.4.2-10Nicola Sella <nsella@redhat.com> - 4.4.2-9Nicola Sella <nsella@redhat.com> - 4.4.2-8Nicola Sella <nsella@redhat.com> - 4.4.2-7Nicola Sella <nsella@redhat.com> - 4.4.2-6Nicola Sella <nsella@redhat.com> - 4.4.2-5Nicola Sella <nsella@redhat.com> - 4.4.2-4Nicola Sella <nsella@redhat.com> - 4.4.2-3Nicola Sella <nsella@redhat.com> - 4.4.2-2Nicola Sella <nsella@redhat.com> - 4.4.2-1Marek Blaha <mblaha@redhat.com> - 4.2.23-4Nicola Sella <nsella@redhat.com> - 4.2.23-3Ales Matej <amatej@redhat.com> - 4.2.23-2Nicola Sella <nsella@redhat.com> - 4.2.23-1Ales Matej <amatej@redhat.com> - 4.2.21-1Ales Matej <amatej@redhat.com> -�x�������������`��������X�l���������(L�$8����������������(L'L)L�n/php-cgi (#149596)- build /usr/bin/php with the CLI SAPI, and add /usr/bin/php-cgi,
  built with the CGI SAPI (thanks to Edward Rudd, #137704)
- add php(1) man page for CLI
- fix more test cases to use -n when invoking php- rebuild for new libpq soname- bundle from PEAR: HTTP, Mail, XML_Parser, Net_Socket, Net_SMTP
- snmp: disable MSHUTDOWN function to prevent error_log noise (#153988)
- mysqli: add fix for crash on x86_64 (Georg Richter, upstream #32282)- build shared objects as PIC (#154195)- fix PEAR installation and bundle PEAR DB-1.7.5 package- update to 5.0.4 (#153068)
- add .phps AddType to php.conf (#152973)
- better gcc4 fix for libxmlrpc- BuildRequire mysql-devel >= 4.1
- don't mark php.ini as noreplace to make upgrades work (#152171)
- fix subpackage descriptions (#152628)
- fix memset(,,0) in Zend (thanks to Dave Jones)
- fix various compiler warnings in Zend- package mysqli extension in php-mysql
- really enable pcntl (#142903)
- don't build with --enable-safe-mode (#148969)
- use "Instant Client" libraries for oci8 module (Kai Bolay, #149873)- fix build with GCC 4- install the ext/gd headers (#145891)
- enable pcntl extension in /usr/bin/php (#142903)
- add libmbfl array arithmetic fix (dcb314@hotmail.com, #143795)
- add BuildRequire for recent pcre-devel (#147448)- update to 5.0.3 (thanks to Robert Scheck et al, #143101)
- enable xsl extension (#142174)
- package both the xsl and dom extensions in php-xml
- enable soap extension, shared (php-soap package) (#142901)
- add patches from upstream 5.0 branch:
 * Zend_strtod.c compile fixes
 * correct php_sprintf return value usage- update for db4-4.3 (Robert Scheck, #140167)
- build against mysql-devel
- run tests in %check- truncate changelog at 4.3.1-1
- merge from 4.3.x package:
 - enable mime_magic extension and Require: file (#130276)- fix dom/sqlite enable/without confusion- fix phpize installation for lib64 platforms
- add fix for segfault in variable parsing introduced in 5.0.2- update to 5.0.2 (#127980)
- build against mysqlclient10-devel
- use new RTLD_DEEPBIND to load extension modules
- drop explicit requirement for elfutils-devel
- use AddHandler in default conf.d/php.conf (#135664)
- "fix" round() fudging for recent gcc on x86
- disable sqlite pending audit of warnings and subpackage split- don't build dom extension into 2.0 SAPI- ExclusiveArch: x86 ppc x86_64 for the moment- fix default extension_dir and conf.d/php.conf- update to 5.0.1
- only build shared modules once
- put dom extension in php-dom subpackage again
- move extension modules into %{_libdir}/php/modules
- don't use --with-regex=system, it's ignored for the apache* SAPIs- Merge in some spec file changes from Jeff Stern (jastern@uci.edu)- bump to 5.0.0
- add patch to prevent clobbering struct re_registers from regex.h
- remove domxml references, replaced with dom now built-in
- fix php.ini to refer to php5 not php41:7.0.33-29.el8.cloudlinux.91:7.0.33-29.el8.cloudlinux.91:7.0.33-29.el8.cloudlinux.920-imap.iniimap.so/opt/cpanel/ea-php70/root/etc/php.d//opt/cpanel/ea-php70/root/usr/lib64/php/modules/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnuASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4a7aa010082888a5052c2aff6698612f15b78067, not strippedutf-8261768155e9b23250eeea3ee85dd023fbc77770b5d121ab93618af05155efba9?���0��C��u�{���Y�@�Ǜ�]!��gdcW&���K�U�b��qi�n�
	�U�b��qQ/�b���Ҁ� ���X�	$���r���wI��!US?�_����]!��gdcW&���K�U�b��qi�n�
	�U�b��q
���>�q��X�^�n�b�LK�
y��^�Z}�8�!A=�3f2dc1ace3f8830fc6f7625dc600aad25f0b693e7f53c12d80ef7cf97�x��������������X�<m�uЩ
/��$?����������������/�.��-25.el8.cloudlinux.101:5.6.40-25.el8.cloudlinux.101:5.6.40-25.el8.cloudlinux.10imap.iniimap.so/opt/cpanel/ea-php56/root/etc/php.d//opt/cpanel/ea-php56/root/usr/lib64/php/modules/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnuASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e00a0bcc30179be2b5503e6d701ad2b23c3ad056, not strippedutf-8ff69f5f39fd1467261278382a0677d8f2a202b1037851b2dfac7f4028d0d4514?���0����z�8�o���ƫ�B�]!��gdcW&���K�U�b��qi�n~
	�U�b��q~��û9�RZ�"�چ�D�=��]j���i�D{�|��ta_�]!��gdcW&���K�U�b��qi�n~
	�U�b��q�b��Z;0�+��ۑyK���?�&�L���6��;Iz�2��E�45be04f0679673886e78fda2e65f7ed6c9a31fb28674e8aacd36b8388d9a24ad259de8679f67873a9930384f3c8720cc7b01b844iݵO
diݵ1.com> - 5.6.40-2.cloudlinux.2Darya Malyavkina <dmalyavkina@cloudlinux.com> - 5.6.40-2.cloudlinux.1Cory McIntire <cory@cpanel.net> - 5.6.40-2Darya Malyavkina <dmalyavkina@cloudlinux.com> - 5.6.40-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 5.6.40-1Cory McIntire <cory@cpanel.net> - 5.6.39-1Darya Malyavkina <dmalyavkina@cloudlinux.com> - 5.6.38-2.cloudlinux.2Ivan Danilov <idanilov@cloudlinux.com> - 5.6.38-2.cloudlinux.1Tim Mullin <tim@cpanel.net> - 5.6.38-2Cory McIntire <cory@cpanel.net> - 5.6.38-1Sergey Fokin <sfokin@cloudlinux.com> - 5.6.37-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 5.6.37-1Tim Mullin <tim@cpanel.net> - 5.6.36-3Vasiliy Kleschov <vkleschov@cloudlinux.com> - 5.6.36-2.cloudlinux.2Vasiliy Kleschov <vkleschov@cloudlinux.com> - 5.6.36-2.cloudlinux.1Vasiliy Kleschov <vkleschov@cloudlinux.com> - 5.6.36-1.cloudlinux.2Rishwanth Yeddula <rish@cpanel.net> - 5.6.36-2Ivan Danilov <idanilov@cloudlinux.com> - 5.6.36-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 5.6.36-1Ivan Danilov <idanilov@cloudlinux.com> - 5.6.35-3.cloudlinuxRishwanth Yeddula <rish@cpanel.net> - 5.6.35-3Rishwanth Yeddula <rish@cpanel.net> - 5.6.35-2Ivan Danilov <idanilov@cloudlinux.com> - 5.6.35-1.cloudlinux.1Daniel Muey <dan@cpanel.net> - 5.6.35-1Ivan Danilov <idanilov@cloudlinux.com> - 5.6.34-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 5.6.34-3Daniel Muey <dan@cpanel.net> - 5.6.34-2Daniel Muey <dan@cpanel.net> - 5.6.34-1<dan@cpanel.net> - 5.6.33-6<darren@cpanel.net> - 5.6.33-5Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.6.33-4.cloudlinux.1<darren@cpanel.net> - 5.6.33-4Cory McIntire <cory@cpanel.net> - 5.6.33-3<julian.brown@cpanel.net> - 5.6.33-2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.6.33-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 5.6.33-1<dan@cpanel.net> - 5.6.32-3<dan@cpanel.net> - 5.6.32-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.32-1<cory@cpanel.net> - 5.6.31-6Tim Mullin <tim@cpanel.net> - 5.6.31-5Dan Muey <dan@cpanel.net> - 5.6.31-4Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.6.31-3.cloudlinux.1Dan Muey <dan@cpanel.net> - 5.6.31-3Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.6.31-2.cloudlinux.1Dan Muey <dan@cpanel.net> - 5.6.31-2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> 5.6.31-1.cloudlinux.1Dmitriy Kasyanov <dkasyanov@cloudlinux.com> 5.6.31-1.cloudlinuxDmitriy Kasyanov <dkasyanov@cloudlinux.com> 5.6.30-15.cloudlinuxDan Muey <dan@cpanel.net> - 5.6.30-15Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.30-14Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.6.30-13.cloudlinux.2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.6.30-13.cloudlinux.1Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.30-13Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.30-12Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.30-11Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.30-10Jacob Perkins <jacob.perkins@cpa�x�������������P�������X�mp.
����������$|�������������������� 'exclude=a AUTOEXCL b' -> 'exclude=a b'
        sed -i '
        /exclude=.*$/ {
            # remove the auto-excludes, and optionally the space after them
            s/'"$ESCAPED_AUTOEXCL"' \?//
        }' $config_file

        # delete remaining auto-exclude comment lines in the specified range
        sed -i '/^# The exclude pattern list was extended.*/,/^exclude=.*$/ {
        /^# The exclude pattern list was extended by the CloudLinux deployment script./d
        /^# They will be automatically removed once a new CloudLinux release becomes available/d
        /^# CloudLinux automatic exclude list:/d
        }' $config_file
    fi
done

if [ -f "/etc/yum.repos.d/cloudlinux-rollout.repo.rpmnew" ]; then
    sed -e '/^sslcacert=/d' \
        -e '/^sslclientcert=/d' \
        -e '/^sslclientkey=/d' \
        -e '/^sslverify=/d' \
        -e 's/rollout.cloudlinux.com/rollout-ng.cloudlinux.com/g' \
        -i /etc/yum.repos.d/cloudlinux-rollout.repo
fi

# trigger hook to update rollout systemid
/opt/cloudlinux/rhn_hooks/post.d/rhn-update-hook.sh
exit 0/bin/shutf-80d1ae5f802d3a568be6e0463c07eb128cf37e727e5fabb4d10d5b9f9e92d294d?�����U=�B����O7�Ș�u�]!��gdcW&���K�U�b��qh���
	�U�b��q�������uU�*��[l=��s���C�>�hp-w
y�M�����:�]!��gdcW&���K�U�b��qh���
	�U�b��q���F�X�ɧ�q��hh�u�����zZ�wh�/�^��S!���cad7742604dafcc3a037fa762fa1cc11d4ba2b3690664723a9bb631480e10e0c516f2d30f5af4e58379463256ff7bc5accbc8ed5i5W�C@i5W`run-software(���
�� nautilusx�national.ko.xz@o6namespace.pyonamespace.cpython-36.pyconamespace.cpython-36.opt-1.pyc
RYiT/seed.h-ind�rsecurity_setenforce.3.gz?d�vsecurity_set_boolean.3.gzd��security_reject_unknown.3.gzrd�1security_policyvers.3.gzvd�tsecurity_mkload_policy.3.gz<d�vsecurity_load_policy.3.gzd�security_load_booleans.3.gzd�;security_getenforce.3.gzd�;%security_get_initial_context_raw.3.gz�L�rfsefcontext_compile.8.gzgn�"lsefcontext_compileC/g|�y
seekdir.3p.gz|�oseekdir.3.gze�aseek_cb_constants_test.py�%seek_cb_constants_test.cpython-36.pyc�oseedling.svg-seedling-line.svg
cseedling-fill.svg	�&�x(g
seeders.pyf-8	�&�s(seeders.cpython-311.pycvi	'��(u	seeder.py	�&�~(qseeder.cpython-311.pycq|�u
seed48_r.3.gz|�.seed48.3p.gzo|�tseed48.3.gzk-0Jcseed.rstnx`s
seed.ko.xzn-3	�&0I�z(sseeds�4�~g
sedutil.pyf-8����sedutil.cpython-36.pyccvi����isedutil.cpython-36.opt-1.pycs�
�|	sedom.tabussedispol���sedispatch.confen��gsedispatch.8.gz!�Fs
sedispatchs.pussedismoda�
/
sedfaq.txt.gz]�3	sedbus.py]Nssedbus.cpython-36.pyc]M<sedbus.cpython-36.opt-1.pyc.c�C�sed.vims8������������������� �!�"�#�$�%�&�'�(�)�*�+�,�-�.�/�0�1�2�3�4ssed.mo/C/�ssed.info.gzol|�.	sed.1p.gz�5hsed.1.gz/�����
sed-opal.h����-sedonM]isecurproto.hr�
"|securitywrap|�$csecurity_interface.py�p!security_interface.cpython-36.pyc�p'security_interface.cpython-36.opt-1.pyc�d�/!security_get_initial_context.3.gzdi!security_get_boolean_pending.3.gzx�������������X������x;�������������� 0;`	�����������������@�������-&�����������������8��Providename@x����������������������@����������������������X�lX5@�	=L�$-����������������=L<L>L�16.cloudlinux.3Tim Mullin <tim@cpanel.net> - 7.0.33-17Nikolai Mikhno <nmikhno@cloudlinux.com> - 7.0.33-16.cloudlinux.2Darya Malyavkina <dmalyavkina@cloudlinux.com> - 7.0.33-16.cloudlinux.1Tim Mullin <tim@cpanel.net> - 7.0.33-16Darya Malyavkina <dmalyavkina@cloudlinux.com> - 7.0.33-15.cloudlinux.3Nikolai Mikhno <nmikhno@cloudlinux.com> - 7.0.33-15.cloudlinux.2Nikolai Mikhno <nmikhno@cloudlinux.com> - 7.0.33-15.cloudlinux.1.1Nikolai Mikhno <nmikhno@cloudlinux.com> - 7.0.33-15.cloudlinux.1Tim Mullin <tim@cpanel.net> - 7.0.33-15Ivan Danilov <idanilov@cloudlinux.com> - 7.0.33-12.cloudlinux.3Ivan Danilov <idanilov@cloudlinux.com> - 7.0.33-12.cloudlinux.2Daniel Muey <dan@cpanel.net> - 7.0.33-14Julian Brown <julian.brown@cpanel.net> - 7.0.33-13Darya Malyavkina <dmalyavkina@cloudlinux.com> - 7.0.33-12.cloudlinux.1Ivan Danilov <idanilov@cloudlinux.com> - 7.0.33-11.cloudlinux.1Daniel Muey <dan@cpanel.net> - 7.0.33-12Tim Mullin <tim@cpanel.net> - 7.0.33-11Ivan Danilov <idanilov@cloudlinux.com> - 7.0.33-10.cloudlinux.3Ivan Danilov <idanilov@cloudlinux.com> - 7.0.33-10.cloudlinux.1Darya Malyavkina <dmalyavkina@cloudlinux.com> - 7.0.33-10.cloudlinux.2Tim Mullin <tim@cpanel.net> - 7.0.33-10Darya Malyavkina <dmalyavkina@cloudlinux.com> - 7.0.33-9.cloudlinux.3Ivan Danilov <idanilov@cloudlinux.com> - 7.0.33-9.cloudlinux.2Ivan Danilov <idanilov@cloudlinux.com> - 7.0.33-9.cloudlinux.1Cory McIntire <cory@cpanel.net> - 7.0.33-9Cory McIntire <cory@cpanel.net> - 7.0.33-8Darya Malyavkina <dmalyavkina@cloudlinux.com> - 7.0.33-7.cloudlinux.1Tim Mullin <tim@cpanel.net> - 7.0.33-7Ivan Danilov <idanilov@cloudlinux.com> - 7.0.33-6.cloudlinux.2Ivan Danilov <idanilov@cloudlinux.com> - 7.0.33-6.cloudlinux.1Julian Brown <julian.brown@cpanel.net> - 7.0.33-6Daniel Muey <dan@cpanel.net> - 7.0.33-5Tim Mullin <tim@cpanel.net> - 7.0.33-4Tim Mullin <tim@cpanel.net> - 7.0.33-3Darya Malyavkina <dmalyavkina@cloudlinux.com> - 7.0.33-2.cloudlinux.5Ivan Danilov <idanilov@cloudlinux.com> - 7.0.33-2.cloudlinux.4Ivan Danilov <idanilov@cloudlinux.com> - 7.0.33-2.cloudlinux.3Ivan Danilov <idanilov@cloudlinux.com> - 7.0.33-2.cloudlinux2.1Ivan Danilov <idanilov@cloudlinux.com> - 7.0.33-2.cloudlinux.2Darya Malyavkina <dmalyavkina@cloudlinux.com> - 7.0.33-2.cloudlinux.1Cory McIntire <cory@cpanel.net> - 7.0.33-2Darya Malyavkina <dmalyavkina@cloudlinux.com> - 7.0.33-1.cloudlinux.2Cory McIntire <cory@cpanel.net> - 7.0.33-1Darya Malyavkina <dmalyavkina@cloudlinux.com> - 7.0.32-2.cloudlinux.2Ivan Danilov <idanilov@cloudlinux.com> - 7.0.32-2.cloudlinux.1Tim Mullin <tim@cpanel.net> - 7.0.32-2Cory McIntire <cory@cpanel.net> - 7.0.32-1Sergey Fokin <sfokin@cloudlinux.com> - 7.0.31-2.cloudlinux.1Tim Mullin <tim@cpanel.net> - 7.0.31-2Cory McIntire <cory@cpanel.net> - 7.0.31-1Vasiliy Kleschov <vkleschov@cloudlinux.com> - 7.0.30-2.cloudlinux.2Vasiliy Kleschov <vkleschov@cloudlinux.com> - 7.0.30-2.cloudlinux.1Vasiliy Kleschov <vkleschov@cloudlinux.com> - 7.0.30-1.cloudlinux.2Rishwanth Yeddula <rish@cpanel.net> - 7.0.30-2Ivan Danilov <idanilov@cloudlinux.com> - 7.0.30-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 7.0.30-1Ivan Danilov <idanilov@cloudlinux.com> - 7.0.29-3.cloudlinuxRishwanth Yeddula <rish@cpanel.net> - 7.0.29-3Rishwanth Yeddula <rish@cpanel.net> - 7.0.29-2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.29-1.cloudlinux.2Daniel Muey <dan@cpanel.net> - 7.0.29-1Ivan Danilov <idanilov@cloudlinux.com> - 7.0.28-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 7.0.28-3Daniel Muey <dan@cpanel.net> - 7.0.28-2Daniel Muey <dan@cpanel.net> - 7.0.28-1<darren@cpanel.net> - 7.0.27-5Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.27-4.cloudlinux.1<darren@cpanel.net> - 7.0.27-4Cory McIntire <cory@cpanel.net> - 7.0.27-3Julian Brown <julian.brown@cpanel.net> - 7.0.27-2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.27-1.cloudlinux.1Jacob Perkins <jacob.perkins@cpanel.net> - 7.0.27-1Cory McIntire <cory@cpanel.net> - 7.0.26-1Dan Muey <dan@cpanel.net> - 7.0.25-2Jacob Perkins <jacob.perkins@cpane�x�������������0��������X�k �8u@3�$P����������������@3?3A3�at.com> 2.1.26-12Petr Lautrbach <plautrba@redhat.com> 2.1.26-11Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.1.26-10Petr Lautrbach <plautrba@redhat.com> 2.1.26-9Karsten Hopp <karsten@redhat.com> 2.1.26-8Petr Lautrbach <plautrba@redhat.com> 2.1.26-7Petr Lautrbach <plautrba@redhat.com> 2.1.26-6Petr Lautrbach <plautrba@redhat.com> 2.1.26-5Petr Lautrbach <plautrba@redhat.com> 2.1.26-4Rex Dieter <rdieter@fedoraproject.org> 2.1.26-3Rex Dieter <rdieter@fedoraproject.org> 2.1.26-2Petr Lautrbach <plautrba@redhat.com> 2.1.26-1Petr Lautrbach <plautrba@redhat.com> 2.1.25-2Petr Lautrbach <plautrba@redhat.com> 2.1.25-1Petr Lautrbach <plautrba@redhat.com> 2.1.23-36Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.1.23-35Petr Lautrbach <plautrba@redhat.com> 2.1.23-34Petr Lautrbach <plautrba@redhat.com> 2.1.23-33Jindrich Novy <jnovy@redhat.com> 2.1.23-32Jindrich Novy <jnovy@redhat.com> 2.1.23-31Jindrich Novy <jnovy@redhat.com> 2.1.23-30Petr Lautrbach <plautrba@redhat.com> 2.1.23-29Jeroen van Meeuwen <vanmeeuwen@kolabsys.com> - 2.1.23-28Petr Lautrbach <plautrba@redhat.com> 2.1.23-27Jan F. Chadima <jchadima@redhat.com> - 2.1.23-26Jan F. Chadima <jchadima@redhat.com> - 2.1.23-25Jan F. Chadima <jchadima@redhat.com> - 2.1.23-23Jan F. Chadima <jchadima@redhat.com> - 2.1.23-22Jan F. Chadima <jchadima@redhat.com> - 2.1.23-21Jan F. Chadima <jchadima@redhat.com> - 2.1.23-20Jan F. Chadima <jchadima@redhat.com> - 2.1.23-19Jan F. Chadima <jchadima@redhat.com> - 2.1.23-18Jan F. Chadima <jchadima@redhat.com> - 2.1.23-17Tomas Mraz <tmraz@redhat.com> - 2.1.23-16Jan F. Chadima <jchadima@redhat.com> - 2.1.23-15Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.1.23-14Jan F. Chadima <jchadima@redhat.com> - 2.1.23-13Jan F. Chadima <jchadima@redhat.com> - 2.1.23-12Jan F. Chadima <jchadima@redhat.com> - 2.1.23-11Jan F. Chadima <jchadima@redhat.com> - 2.1.23-10Jan F. Chadima <jchadima@redhat.com> - 2.1.23-9Stepan Kasal <skasal@redhat.com> - 2.1.23-8Jan F. Chadima <jchadima@redhat.com> - 2.1.23-7Jan F. Chadima <jchadima@redhat.com> - 2.1.23-6Jan F. Chadima <jchadima@redhat.com> - 2.1.23-5Jan F. Chadima <jchadima@redhat.com> - 2.1.23-3Tomas Mraz <tmraz@redhat.com> - 2.1.23-2Jan F. Chadima <jchadima@redhat.com> - 2.1.23-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.1.22-25Jan F. Chadima <jchadima@redhat.com> - 2.1.22-24Robert Scheck <robert@fedoraproject.org> - 2.1.22-23Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.1.22-22Tomas Mraz <tmraz@redhat.com> - 2.1.22-21Tomas Mraz <tmraz@redhat.com> - 2.1.22-20Tomas Mraz <tmraz@redhat.com> - 2.1.22-19Tomas Mraz <tmraz@redhat.com> - 2.1.22-18Tomas Mraz <tmraz@redhat.com> - 2.1.22-17Tomas Mraz <tmraz@redhat.com> - 2.1.22-16Tomas Mraz <tmraz@redhat.com> - 2.1.22-15Dennis Gilmore <dennis@ausil.us> - 2.1.22-14Tom "spot" Callaway <tcallawa@redhat.com> - 2.1.22-13.1Fedora Release Engineering <rel-eng@fedoraproject.org> - 2.1.22-13Steve Conklin <sconklin@redhat.com> - 2.1.22-12Steve Conklin <sconklin@redhat.com> - 2.1.22-11Release Engineering <rel-eng at fedoraproject dot org> - 2.1.22-10Steve Conklin <sconklin@redhat.com> - 2.1.22-9Steve Conklin <sconklin@redhat.com> - 2.1.22-8Steve Conklin <sconklin@redhat.com> 2.1.22-7Nalin Dahyabhai <nalin@redhat.com> 2.1.22-6Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.22-5Nalin Dahyabhai <nalin@redhat.com> 2.1.22-4Nalin Dahyabhai <nalin@redhat.com> 2.1.22-3Nalin Dahyabhai <nalin@redhat.com> 2.1.22-2Nalin Dahyabhai <nalin@redhat.com> 2.1.22-1Nalin Dahyabhai <nalin@redhat.com> 2.1.21-12Nalin Dahyabhai <nalin@redhat.com> 2.1.21-11Nalin Dahyabhai <nalin@redhat.com> 2.1.21-10Jesse Keating <jkeating@redhat.com> - 2.1.21-9.2Jesse Keating <jkeating@redhat.com> - 2.1.21-9.1Nalin Dahyabhai <nalin@redhat.com> 2.1.21-9Jesse Keating <jkeating@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.21-8Tom Lane <tgl@redhat.com> 2.1.21-7Tomas Mraz <tmraz@r�x������h��������XJ�kh��������Q��$A����������������Q�P�&ashes (#441084)- Fix a crash of the fuse daemon on 64bit- Update to 0.2.3- Update to 0.2.2- Moved fuse stuff to a dedicated package- Add patch with simple archive backend UI integration- Added libarchive dependency for archive backend
- Require new libsmbclient in order to get smb backend working again- Update to 0.2.1 (archive backend temporarily disabled)- Silence %post- Update to 0.2.0.1- Add patch that fixes a deadlock when foreign volume is removed- Update to 0.1.11- Update to 0.1.10- Update to 0.1.8- Add patch that fixes a smb bug that can cause short reads when copying files- Fix double free in hal volume monitor
- Ensure gconf module is built by adding build dep- Update to 0.1.7- Update to 0.1.6- Update to 0.1.5
- Reenable http/dav- Remove the http/dav stuff for now, as we don't have the latest libsoup- Update to 0.1.4
- Send USR1 in post to reload config- Update to 0.1.2- Update to 0.1.1- Initial packaging/bin/sh	1.36.2-20.el8_101.36.2-20.el8_10.build-idabdbf5dff82144a2972342c3c673f5001f636155bd0792abbafd0a7ca961e2c02e7c52fa51deac69gvfsd-smbgvfsd-smb-browsesmb-browse.mountsmb.mount/usr/lib//usr/lib/.build-id//usr/lib/.build-id/ab//usr/lib/.build-id/bd//usr/libexec//usr/share/gvfs/mounts/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=bd0792abbafd0a7ca961e2c02e7c52fa51deac69, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=abdbf5dff82144a2972342c3c673f5001f636155, strippedASCII textRRRRRRR
RRRRR
RRRR	RRRRRRRRRRRR
RRRRR
RRRR	RRRRutf-8a0f1fdc5c58008ebb98adc0b38b8988ec03d2e3e9316347fe46668bb1bb9e837?��� ��3!�^���P,��*����%�iùB
	*����%�{��@7��c sϲ�vw���h��^-����qZ�H�+��c�{��X�
`kՔ4?�$H��2�^��!�fZ>h�2Ud�\�Y/<��#�.ⴕ#��-x_A'z	<�#_�������K ���s�u��%�R��H��sv���3
�,��q�:K��3�8�9�DŽ&��F�����qS&���8��y�:�x�@��O��u���f���w�/��ԡ�ˮ��1�`��đ�0��d��t�(�(]͢�P�^�^q�{�%�7d3�?8dD�0M�����D H�Em�Z���ڸ=�R�!r��2a�����a��k���>OM˵gғu�e��e~5�y�o|�T�z|��<9�C	8 m���A �͑�K�I1S����%�n�F>0y�G���
�yڡz������6��̃�N�yޭW񣇸�IE�L��b1�%�x�T�av͏AL;�O��: 4�؜�Y�n��q��{�;@����w>�^����՛��"�ޕ|)��V�3!�^���P,��*����%�iùB
	*����%�ϸ���6�~u;Ď*ޙE"�u9�60�����[<�I��k�;#y�ýO/O�?���j�8*���aI-D���[�
�_�(^K�}�j>����	2�2���&��S��h�l�9��k�E�m�KW��d�@~��s�+kz>b%��Ύ6[2]�
�Qhv���ctY�y/�7`�N���	���f�+m.B�j5W��p���f�LU>����bvI����>���`k�@V%L�A��:���W\=C喝��f=y ��j��t���Br���F�
�v��$Iݾ���m���+���*�!3��)vY�ғ����h�6�L��7��M-��`�7�9�6�sK*0�[����	�
�=*"���NWFϚ(�X�{>�C	����O���w8k��N,9�HŹ\&WӒ���FS�N�@
�l��7�玏�d�����k�bR|��R�⎣0�2A�G�b�鿳�����0s��X�aR\Ѧ��n���z41f820321064ce3fff08c9a4c81ec9f14d84a8a498d1d02471274b557f33abf531d3aebea99cb5eec8241d4cd60c423e0bfae1d7i���i��linux.com> - 7.1.33-20Chris Castillo <chris.castillo@webpros.com> - 7.1.33-19Julian Brown <julian.brown@cpanel.net> - 7.1.33-18Vladimir D. Seleznev <vseleznev@cloudlinux.com> - 7.1.33-17.cl�x��������������������X7�l`�أ������>L�����$.����������������>L=LL�l.net> - 7.0.25-1Dan Muey <dan@cpanel.net> - 7.0.24-5<cory@cpanel.net> - 7.0.24-4Tim Mullin <tim@cpanel.net> - 7.0.24-3Dan Muey <dan@cpanel.net> - 7.0.24-2Jacob Perkins <jacob.perkins@cpanel.net> - 7.0.24-1Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.24-1.cloudlinuxDmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.23-1.cloudlinux.1Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.23-1.cloudlinuxCharan Angara <charan@cpanel.net> - 7.0.23-1Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.22-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 7.0.22-1Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.22-1.cloudlinuxDan Muey <dan@cpanel.net> - 7.0.21-2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.21-1.cloudlinux.1Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.21-1.cloudlinuxDmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.20-3.cloudlinuxDan Muey <dan@cpanel.net> - 7.0.20-3Jacob Perkins <jacob.perkins@cpanel.net> - 7.0.20-2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.20-1.cloudlinux.1Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.20-1.cloudlinuxJacob Perkins <jacob.perkins@cpanel.net> - 7.0.19-3Jacob Perkins <jacob.perkins@cpanel.net> - 7.0.19-2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.19-1.cloudlinuxJacob Perkins <jacob.perkins@cpanel.net> - 7.0.19-1Jacob Perkins <jacob.perkins@cpanel.net> - 7.0.18-5Jacob Perkins <jacob.perkins@cpanel.net> - 7.0.18-4Jacob Perkins <jacob.perkins@cpanel.net> - 7.0.18-3Jacob Perkins <jacob.perkins@cpanel.net> - 7.0.18-2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.18-1.cloudlinux.1Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.18-1.cloudlinuxCharan Angara <charan@cpanel.net> - 7.0.18-1Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.17-1.cloudlinux.2Eugene Zamriy <eugene@zamriy.info> - 7.0.17-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 7.0.17-1Cory McIntire <cory@cpanel.net> - 7.0.16-4Cory McIntire <cory@cpanel.net> - 7.0.16-3Dan Muey <dan@cpanel.net> - 7.0.16-2Jacob Perkins <jacob.perkins@cpanel.net> - 7.0.16-1Dan Muey <dan@cpanel.net> - 7.0.15-5Dan Muey <dan@cpanel.net> - 7.0.15-4Dan Muey <dan@cpanel.net> - 7.0.15-3Dan Muey <dan@cpanel.net> - 7.0.15-2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 1:7.0.15-1.cloudlinux.2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 1:7.0.15-1.cloudlinux.1Eugene Zamriy <ezamriy@cloudlinux.com> - 1:7.0.14-1.cloudlinux.3Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.14-1.cloudlinux.2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.14-1.cloudlinux.1Dan Muey <dan@cpanel.net> - 7.0.13-5Matt Dees <matt.dees@cpanel.net> 7.0.13-4S. Kurt Newman <kurt.newman@cpanel.net> - 7.0.13-3Edwin Buck <e.buck@cpanel.net> - 7.0.13-2Jacob Perkins <jacob.perkins@cpanel.net> - 7.0.13-1Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.12-2.cloudlinux.1Edwin Buck <e.buck@cpanel.net> - 7.0.12-2Jacob Perkins <jacob.perkins@cpanel.net> - 7.0.12-1Jacob Perkins <jacob.perkins@cpanel.net> - 7.0.11-2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 7.0.11-1.cloudlinux.1Jacob Perkins <jacob.perkins@cpanel.net> - 7.0.11-1Matt Dees <matt@cpanel.net> - 7.0.10-3S. Kurt Newman <kurt.newman@cpanel.net> - 7.0.10-2Jacob Perkins <jacob.perkins@cpanel.net> - 7.0.10-1Eugene Zamriy <ezamriy@cloudlinux.com> - 1:7.0.9-1.cloudlinux.1S. Kurt Newman <kurt.newman@cpanel.net> - 7.0.9-2Edwin Buck <e.buck@cpanel.net> - 7.0.9-1Darren Mobley <darren@cpanel.net> - 7.0.8-3Julian Brown <julian.brown@cpanel.net> - 7.0.8-2Daniel Muey <dan@cpanel.net> - 7.0.8-1Dan Muey <dan@cpanel.net> - 7.0.7-4S. Kurt Newman <kurt.newman@cpanel.net> - 7.0.7-3Jacob Perkins <jacob.perkins@cpanel.net> - 7.0.7-2Alexey Berezhok <aberezhok@cloudlinux.com> - 1:7.0.7-1.cloudlinux.1Kurt Newman <kurt.newman@cpanel.net> - 7.0.7-1Sergey Fokin <sfokin@cloudlinux.com> - 1:7.0.6-1.cloudlinux.1Jacob Perkins <jacob.perkins@cpanel.net> - 7.0.6-1Jacob Perkins <jacob.perkins@cpanel.net> - 7.0.5-1S. Kurt Newman <kurt.newman@cpanel.net> - 7.0.4-2Sergey Fokin <sfokin@cloudlinux.com> - 7.0.4-1.cloudlinuxDavid Nielson <david.n�x����������������������X�l��	,�������$
�����������������������.45-29Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 1:5.4.45-28.cloudlinux.3Eugene Zamriy <ezamriy@cloudlinux.com> - 5.4.45-28.cloudlinux.2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.4.45-28.cloudlinux.1Dan Muey <dan@cpanel.net> - 5.4.45-28Dan Muey <dan@cpanel.net> - 5.4.45-27Dan Muey <dan@cpanel.net> - 5.4.45-26Dmitriy Kasyanov <dkasyanov@cloudlinux.com> 5.4.45-25.cloudlinux.3Dmitriy Kasyanov <dkasyanov@cloudlinux.com> 5.4.45-25.cloudlinux.2Dmitriy Kasyanov <dkasyanov@cloudlinux.com>  5.4.45-25.cloudlinux.1Matt Dees <matt.dees@cpanel.net> 5.4.45-25Edwin Buck <e.buck@cpanel.net> 5.4.45-24S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.45-23Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.4.45-22.cloudlinux.3Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.4.45-22.cloudlinux.2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.4.45-22.cloudlinux.1Jacob Perkins <jacob.perkins@cpanel.net> 5.4.45-22Anatholy Scryabin <ascryabin@cloudlinux.com> - 5.4.45-21.cloudlinux.2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.4.45-21.cloudlinux.1Matt Dees <matt@cpanel.net> - 5.4.45-21S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.45-20Eugene Zamriy <ezamriy@cloudlinux.com> - 5.4.45-19.cloudlinux.1Darren Mobley <darren@cpanel.net> - 5.4.45-19Julian Brown <julian.brown@cpanel.net> - 5.4.45-18Dan Muey <dan@cpanel.net> - 5.4.45-17S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.45-16Alexey Berezhok <aberezhok@cloudlinux.com> - 1:5.4.45-14.cloudlinux.1Jacob Perkins <jacob.perkins@cpanel.net> 5.4.45-15Jacob Perkins <jacob.perkins@cpanel.net> 5.4.45-14Jacob Perkins <jacob.perkins@cpanel.net> 5.4.45-13Sergey Fokin <sfokin@cloudlinux.com> - 1:5.4.45-12.cloudlinux.1S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.45-12S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.45-11S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.45-10Dan Muey <dan@cpanel.net> - 5.4.45-9David Nielson <david.nielson@cpanel.net> - 5.4.45-8Sergey Fokin <sfokin@cloudlinux.com> - 1:5.4.45-7.8.cloudlinux.1Sergey Fokin <sfokin@cloudlinux.com> - 1:5.4.45-7.8.cloudlinuxS. Kurt Newman <kurt.newman@cpanel.net> - 5.4.45-7Jacob Perkins <jacob.perkins@cpanel.net> - 5.4.45-6S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.45-5Dan Muey <dan@cpanel.net> - 5.4.45-4S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.45-3Dan Muey <dan@cpanel.net> - 5.4.45-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.4.45-1Kurt Newman <kurt.newman@cpanel.net> - 5.4.44-1Trinity Quirk <trinity.quirk@cpanel.net> - 5.4.38-7Darren Mobley <darren@cpanel.net> 5.4.38-6Darren Mobley <darren@cpanel.net> 5.4.38-5Darren Mobley <darren@cpanel.net> 5.4.38-4S. Kurt Newman <kurt.newman@cpanel.net> 5.4.38-3Dan Muey <dan@cpanel.net> 5.4.38-2S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.38-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.38-0Jan Kaluza <jkaluza@redhat.com> - 5.4.16-22Remi Collet <rcollet@redhat.com> - 5.4.16-20Remi Collet <rcollet@redhat.com> - 5.4.16-18Remi Collet <rcollet@redhat.com> - 5.4.16-16Remi Collet <rcollet@redhat.com> - 5.4.16-12Remi Collet <rcollet@redhat.com> 5.4.16-10Remi Collet <rcollet@redhat.com> 5.4.16-8Remi Collet <rcollet@redhat.com> - 5.4.16-7Remi Collet <rcollet@redhat.com> 5.4.16-4Remi Collet <rcollet@redhat.com> - 5.4.16-3Remi Collet <rcollet@redhat.com> 5.4.16-2Remi Collet <rcollet@redhat.com> 5.4.16-1Remi Collet <rcollet@redhat.com> 5.4.14-3Remi Collet <rcollet@redhat.com> 5.4.14-2Remi Collet <rcollet@redhat.com> 5.4.14-1Remi Collet <rcollet@redhat.com> 5.4.13-1Remi Collet <rcollet@redhat.com> 5.4.11-1Remi Collet <rcollet@redhat.com> 5.4.10-1Remi Collet <rcollet@redhat.com> 5.4.9-1Remi Collet <rcollet@redhat.com> 5.4.8-7Remi Collet <rcollet@redhat.com> 5.4.8-6Remi Collet <rcollet@redhat.com> 5.4.8-5Remi Collet <rcollet@redhat.com> 5.4.8-6Remi Collet <rcollet@redhat.com> 5.4.8-4Remi Collet <rcollet@redhat.com> 5.4.8-4Remi Collet <rcollet@redhat.com> 5.4.8-3Joe Orton <jorton@redhat.com> - 5.4.8-2Remi Collet <rcollet@redhat.com> 5.4.8-3Remi Collet <rcollet@redhat.com> 5.4.8-2.1Remi Collet <rcollet@redhat.com> 5�x�������������r�������X�lx�������P�������/��$?����������������/�0�.��data, 10 x 11, 8-bit gray+alpha, non-interlacedPNG image data, 110 x 16, 4-bit colormap, non-interlacedPNG image data, 21 x 15, 8-bit gray+alpha, non-interlacedPNG image data, 21 x 16, 8-bit gray+alpha, non-interlacedPNG image data, 22 x 15, 8-bit gray+alpha, non-interlacedPNG image data, 13 x 12, 8-bit gray+alpha, non-interlacedPNG image data, 15 x 11, 8-bit gray+alpha, non-interlacedPNG image data, 18 x 11, 8-bit gray+alpha, non-interlacedPNG image data, 14 x 11, 8-bit gray+alpha, non-interlacedPNG image data, 23 x 18, 8-bit gray+alpha, non-interlacedPNG image data, 159 x 43, 4-bit colormap, non-interlacedPNG image data, 224 x 22, 4-bit colormap, non-interlacedPNG image data, 288 x 20, 4-bit colormap, non-interlacedPNG image data, 149 x 18, 8-bit gray+alpha, non-interlacedPNG image data, 8 x 13, 8-bit gray+alpha, non-interlacedPNG image data, 49 x 28, 8-bit gray+alpha, non-interlacedPNG image data, 100 x 18, 4-bit colormap, non-interlacedPNG image data, 1250 x 397, 8-bit colormap, non-interlacedPNG image data, 877 x 396, 8-bit colormap, non-interlacedPNG image data, 304 x 225, 8-bit colormap, non-interlacedPNG image data, 976 x 542, 8-bit/color RGBA, non-interlacedPNG image data, 847 x 356, 8-bit/color RGB, non-interlacedPNG image data, 1552 x 266, 8-bit colormap, non-interlacedPNG image data, 1054 x 456, 8-bit colormap, non-interlacedPNG image data, 871 x 325, 8-bit/color RGB, non-interlacedPNG image data, 909 x 656, 8-bit colormap, non-interlacedPNG image data, 910 x 572, 8-bit colormap, non-interlacedPNG image data, 1482 x 550, 8-bit/color RGBA, non-interlacedPNG image data, 1551 x 704, 8-bit/color RGBA, non-interlacedPNG image data, 1294 x 752, 8-bit/color RGBA, non-interlacedUTF-8 Unicode textC source, ASCII text�x��������������a�������X�l����������j��$z����������������j�i�k��up upgrade via @ syntax (RhBug:1265391) (Michal Luscon)
- spec: Mark license files as %license where available (Ville Skyttä)
- Remove unused imports (Ville Skyttä)
- Spelling fixes (Ville Skyttä)
- Fix typos in documentation (Rob Cutmore)
- parser: add support for braces in substitution (RhBug:1283017) (Dave
  Johansen)
- completion_helper: Don't omit "packages" from clean completions (Ville
  Skyttä)
- bash-completion: Avoid unnecessary python invocation per _dnf_helper (Ville
  Skyttä)
- repo: Download drpms early (RhBug:1260421) (Ville Skyttä)
- clean: Don't hardcode list of args in two places (Ville Skyttä)
- cli: don't crash if y/n and sys.stdin is None (RhBug:1278382) (Adam
  Williamson)
- sp err "environement" -> "environment" (Michael Goodwin)
- Remove -OO from #!/usr/bin/python (RhBug:1230820) (Jaroslav Mracek)
- cli: warn if plugins are disabled (RhBug:1280240) (Michal Luscon)- AUTHORS: updated (Jan Silhan)
- query: add compatibility methods (Michal Luscon)
- query: add recent, extras and autoremove methods to Query (Michal Luscon)
- query: add duplicated and latest-limit queries into api (Michal Luscon)
- format the email message with its as_string method (Olivier Andrieu)
- added dnf.i18n.ucd* functions as deprecated API (Jan Silhan)
- i18n: unicode resulting translations (RhBug:1278031) (Jan Silhan)
- po: get rid of new lines in translation (Jan Silhan)
- output: add skip count to summary (RhBug:1264032) (Michal Domonkos)
- groups: fix environment upgrade (Michal Luscon)
- Fix plural strings extraction (RhBug:1209056) (Baurzhan Muftakhidinov)
- po: fixed malformed beginning / ending (Jan Silhan)
- zanata update (Jan Silhan)
- cli: prevent tracebacks after C^ (RhBug:1274946) (Michal Luscon)- Update command_ref.rst (Jaroslav Mracek)
- Change in automatic.conf email settings to prevent email error with default
  sender name (Jaroslav Mracek)
- Replace assert_called() with assert_called_with() for Py35 support (Neal
  Gompa (ニール・ゴンパ))
- doc: improve documentation (Jaroslav Mracek)
- doc: update the instructions related to nightly builds (Radek Holy)
- Revert "Add the continuous integration script" (Radek Holy)
- Revert "cosmetic: ci: fix the Copr name in the README" (Radek Holy)
- Fix typo in Command.canonical's doctring (Timo Wilken)
- base: group_install is able to exclude mandatory packages
  (Related:RhBug:1199868) (Jan Silhan)- don't import readline as it causes crashes in Anaconda
  (related:RhBug:1258364)- Revert "completion_helper: don't get IndexError (RhBug:1250038)"- add hawkey version requirement
- revert commit #70956- doc: release notes 1.1.2 (Michal Luscon)
- sanitize non Unicode command attributes (RhBug:1262082) (Jan Silhan)
- don't redirect confirmation to stderr RhBug(1258364) (Vladan Kudlac)
- clean: add rpmdb to usage (Vladan Kudlac)
- completion_helper: don't get IndexError (RhBug:1250038) (Vladan Kudlac)
- add --downloadonly switch (RhBug:1048433) (Adam Salih)
- Add globbing support to base.by_provides() (RhBug:11259650) (Valentina
  Mukhamedzhanova)
- spec: packaging python(3)-dnf according to new Fedora guidelines
  (RhBug:1260198) (Jaroslav Mracek)
- Bug in Source0: URL in dnf.spec fixed (RhBug:126255) (Jaroslav Mracek)
- To dnf.spec added provides dnf-command(command name) for 21 dnf commands
  (RhBug:1259657) (jmracek)
- Expire repo cache on failed package download (Valentina Mukhamedzhanova)
- cosmetic: ci: fix the Copr name in the README (Radek Holy)
- Add the continuous integration script (Radek Holy)
- Set proper charset on email in dnf-automatic (RhBug:1254982) (Valentina
  Mukhamedzhanova)
- doc: improve configuration description (RhBug:1261766) (Michal Luscon)
- remove: show from which repo a package is (Vladan Kudlac)
- list: show from which repo a package is (RhBug:1234491) (Vladan Kudlac)
- Spelling/grammar fixes (Ville Skyttä)
- install: fix crash when terminal window is small (RhBug:1256531) (Vladan
  Kudlac)
- install: mark unification of the progress bar (Vladan Kudlac)
- fix translations in python3 (RhBug:1254�x�����P
�P�������X\�l��������Hh������\��$L����������������\�[�]��0.5.5-1Aleš Kozumplík <ales@redhat.com> - 0.5.4-1Aleš Kozumplík <ales@redhat.com> - 0.5.3-1Aleš Kozumplík <ales@redhat.com> - 0.5.2-1Aleš Kozumplík <ales@redhat.com> - 0.5.1-1Aleš Kozumplík <ales@redhat.com> - 0.5.0-1Aleš Kozumplík <ales@redhat.com> - 0.4.19-1Aleš Kozumplík <ales@redhat.com> - 0.4.18-1Aleš Kozumplík <ales@redhat.com> - 0.4.17-1Aleš Kozumplík <ales@redhat.com> - 0.4.16-1- Added patch for almalinux bugtracker- automatic: catch OSError, not SMTPException on smtp errors (RHEL-71545)
- automatic: Check availability of config file (RHEL-71545)- Remove /usr/bin from sys.path to avoid accidentally importing garbage (RHEL-1245)
- Fix japanese translations (RHEL-6393)
- Fix substitution in kay-value-pair list in add_new_repo (RHEL-11786)- Document symbols in `dnf history list` output (RhBug:2172067)- Return an error when transaction fails (RhBug:2170093)- Omit src RPMs from check-update (RhBug:2151910,2203069)
- automatic: Fix online detection with proxy (RhBug:2022440,2189851)- Update translations- Ignore processing variable files with unsupported encoding (RhBug:2141215)
- Better explain traceback of rpm.error with dnf- Document changes to offline-upgrade command (RhBug:1939975,2139324)- Add support for rollback of group upgrade rollback (RhBug:2016070)
- Move system-upgrade plugin to core (RhBug:2054235)
- Fix plugins unit tests + unload plugins upon their deletion (RhBug:2134309)- Allow passing plugin parameters with dashes in names (RhBug:1980712)
- Fix upgrade from file to noarch pkg (RhBug:2006018)
- Add support for group upgrade rollback (RhBug:2016070)
- Expose plugin unload method to API (RhBug:2047251)
- Add doc related to --destdir and --downloadonly options (RhBug:2100811)
- Set default value for variable to prevent crash (RhBug:2091636)
- Don't include resolved advisories for obsoletes with sec. filters (RhBug:2101421)- [doc] Describe how gpg keys are stored for `repo_ggpcheck`
- Add only relevant pkgs to upgrade transaction (RhBug:2097757)- Backport fix for leaks of libsolv's page file descriptors in Base object
  resolves: rhbz#2087734
- Include instructions for regenerating patches.- Add documentation for query api flags
- Fix processing of download errors
- Fix history undo on a Reason Change
- Fix remove when no repos are enabled
- Improve "proxy" configuration option documentation- Rebuild with new release number- Allow destdir option with modulesync command- Bump release number because of conflicting version of 8.5 build- Add fail_fast parameter to _download_remote_payloads() method
- Throw CompsError when a group or environment is not found for the install methods
- Respect cacheonly in python dnf API (RhBug:1862970)
- [doc] Improve description of multilib_policy=all (RhBug:1996681,1995630)
- [doc] Document default colors- Improve signature checking using rpmkeys (RhBug:1967454)- Fix covscan issue: dnf/rpm/miscutils.py: fix usage of _()- Update to 4.7.0
- New optional parameter for filter_modules enables following modular obsoletes based on a config option module_obsoletes
- Fix module remove --all when no match spec (RhBug:1904490)
- Make an error message more informative (RhBug:1814831)
- Expand history to full term size when output is redirected (RhBug:1852577) (RhBug:1852577,1906970)
- Print additional information when verifying GPG key using DNS
- Enhanced detection of plugins removed in transaction (RhBug:1929163)
- Improve repo config path ordering to fix a comps merging issue (RhBug:1928181)
- Keep reason when package is removed (RhBug:1921063)
- Improve mechanism for application of security filters (RhBug:1918475)
- [API] Add new method for reset of security filters
- Remove hardcoded logfile permissions (RhBug:1910084)
- Preserve file mode during log rotation (RhBug:1910084)
- Increase loglevel in case of invalid config options
- Prevent traceback (catch ValueError) if pkg is from cmdline
- Check for specific key string when verifing signatures (RhBug:1915990)
- Use rpmkeys binary to verify package signature (�x�����L8@�������Xk�l�L�t$L�$4����������������$L#L%L�zip subpackage
- add php-json subpackage- Update to 5.6.7
  http://www.php.net/releases/5_6_7.php- update to 5.6.7RC1- Update to 5.6.6
  http://www.php.net/releases/5_6_6.php- Update to 5.6.5
  http://www.php.net/releases/5_6_5.php- fix php-fpm.service.d location- update to 5.6.5RC1
- add base system path in default include path
- FPM: enable ACL for Unix Domain Socket- Update to 5.6.4
  http://www.php.net/releases/5_6_4.php
- add sybase_ct extension (in mssql sub-package)
- xmlrpc requires xml- Update to 5.6.4
  http://www.php.net/releases/5_6_4.php- update to 5.6.4RC1- add embedded sub package
- filter all libraries to avoid provides- FPM: add upstream patch for https://bugs.php.net/68421
  access.format=R doesn't log ipv6 address
- FPM: add upstream patch for https://bugs.php.net/68420
  listen=9000 listens to ipv6 localhost instead of all addresses
- FPM: add upstream patch for https://bugs.php.net/68423
  will no longer load all pools- Update to PHP 5.6.3
  http://php.net/releases/5_6_3.php- update to 5.6.3RC1
- new version of systzdata patch, fix case sensitivity
- ignore Factory in date tests
- disable opcache.fast_shutdown in default config
- add php56-cgi command in base system- Update to PHP 5.6.2
  http://php.net/releases/5_6_2.php- Update to PHP 5.6.1
  http://php.net/releases/5_6_1.php
- use default system cipher list by Fedora policy
  http://fedoraproject.org/wiki/Changes/CryptoPolicy
- add system php library to default include_path- enable libvpx on EL 6 (with libvpx 1.3.0)
- add php56-phpdbg command in base system- PHP 5.6.0 is GA
- add lsphp56 command in base system- initial spec for PHP 5.6 as Software Collection
- adapted from php 5.6 spec file from remi repository
- adapted from php 5.5 spec file from rhscl 1.1- fileinfo: fix out-of-bounds memory access CVE-2014-2270
- fileinfo: fix extensive backtracking CVE-2013-7345- gd: fix NULL deref in imagecrop CVE-2013-7327
- gd: drop vpx support, fix huge memory consumption #1075201- fix patch name
- fix memory leak introduce in patch for CVE-2014-1943
- fix heap-based buffer over-read in DateInterval CVE-2013-6712- fix infinite recursion in fileinfo CVE-2014-1943- fix heap overflow vulnerability in imagecrop CVE-2013-7226- allow multiple paths in ini_scan_dir #1058161- add security fix for CVE-2013-6420- rebuild with test enabled
- add dependency on php-pecl-jsonc- update to PHP 5.5.6
- buildstrap build- update to PHP 5.5.5
- mod_php only for httpd24- update to PHP 5.5.4
- improve security, use specific soap.wsdl_cache_dir
  use /var/lib/php/wsdlcache for mod_php and php-fpm
- sync short_tag comments in php.ini with upstream
- relocate RPM macro- update to PHP 5.5.3
- improve system libzip patch
- fix typo and add missing entries in php.ini- update to PHP 5.5.1 for php55 SCL- rebuild for new httpd-mmn value- remove ZTS conditional stuf for ligibility
- add mod_php for apache 2.4 (from httpd24 collection)- improve mod_php, pgsql and ldap description
- add missing man pages (phar, php-cgi)
- add provides php(pdo-abi) for consistency with php(api) and php(zend-abi)
- use %__isa_bits instead of %__isa in ABI suffix #985350- add security fix for CVE-2013-4113
- add missing ASL 1.0 license- run tests during build- rebase to 5.4.16
- fix hang in FindTishriMolad(), #965144
- patch for upstream Bug #64915 error_log ignored when daemonize=0
- patch for upstream Bug #64949 Buffer overflow in _pdo_pgsql_error, #969103
- patch for upstream bug #64960 Segfault in gc_zval_possible_root- remove wrappers in /usr/bin (#966407)- rebuild for libjpeg (instead of libjpeg_turbo)
- fix unowned dir %{_datadir}/fpm and %{_libdir}/httpd (#956221)- update to 5.4.14
- clean old deprecated options- update to 5.4.13
- security fixes for CVE-2013-1635 and CVE-2013-1643
- make php-mysql package optional (and disabled)
- make ZTS build optional (and disabled)
- always try to load mod_php (apache warning is usefull)
- Hardened build (links with -z now option)
- Remove %config from /etc/rpm/macros.php- update to 5.4.11
- fix �x��������������/�������Xm���������t�'�$�����������������'�-�&�8c4a421e324f0382f1768f0eb060b276cc5f8f0bff624b2988925e42b5e47c06b558495a68513d2d78097156f70c306953a56f844caad62e29d248f2c45e8a512607464b59b414d5e0aa13c290dbab0c272f67bc9e84285f203c2ec399f6fea3d6f160f821a228dd4c7aacdd9afd61fc811b18efb201cb9bb66a4c908b4d890f47a53701c9944d7634fa14f9fac8a9edf4cb3c752b2f37cb21d7256f6c4c19f30d40c74a33ebec3e4404d151a1c5fbfe62f92f850ef9f7cdb248b5fd61df96b62d7067d841a555708cd801b19a7f6d5bd3d0631026b4f9e792f5181ff12e8fccf3878ebc817e46f5d907b56fe55fbe7d7e81584baed6bc1eaa5734cc52521585167ff6941f4e5c9cc0313e223708c001a851c195b14ea58f4f0898a631514c2ee0f6516429b33b756b0e574748ce040509e089c29a34ea183552f087df10f2a5f3126a453145f1a862427fc4b9cff5cfe0b49cf462da63fb68fab717b191a3fb3c85f0c86d992f94df5a47694be1e50d28cadead39b71c7fe905c1f3dcb192990a2b30c71e1a3b511fbdacce968f334406958966b4ec1610c0c6edfc964e0350bdf47f9c5fe4203ab75170c4922ebfa2983c796e534135ea50a52e638cae4fd60aa2c2009ab63f63de9b07e1e5880d25dba886fad1f3cb9ce1d4167ca86fedd148c29d575de6d7e0f1e191cb397be6289704c04d76fde1592fcbb919b8779ac407f32d6d091d833fded906e9bb34b4779a6afe90b0c0a141a3f9cdc021538fa48bd4d0116104f49c63b43fccfc72fcc10d55b15999e10fadc5c6acc53183d65d4e8d0ca24f16c345285fd0ba4e9e4487c15c3eb76929caa97e3f531d98dcfc2e6db0516f5a3e9f7a92f4a3dbcc63f81635a1e97f8eddbfc23ed158843bd8a741fcbb737f79879d18c87a0b910b9c89e63421310ed45de068a09f453f53790edd8040336d4db1243c9bb360c9e54f909c0ce0727d31a6ba54c10ee12cb8bea9c33547b8633358cbf119875bffea11587fa57f698a5c50a0408863a4fe5cf542a32bef7e5174e0f937a14c9cec70ee22eb43f40df3d95e506a6f1cd652d2b03b2c2dd228590355f1c19786a4e4aaf398227ad79428716c534374b61a72f054c5d0ee6a6447e38aa642a313e866ad7869a7b1bcb5865300d737c24f25663c20afe4417b7baf22d42b2734b962ac1e9c0000a45528e8c61be7b7ff3bf01c73430da1ee43abc8b75b8824de793e85a9b8b6f6aee1871da4e8ad7451904b0d13375ffc50d8638bec99bfb49efb09712b1e0a8a31a981827f6b9c110778cdaec142d8fa2bad2591979c1891bd6de54b5b4d7103f82e4563b88b72a89c700b04ce7d748e7b8357b8f8c908c49bb81f3ced557e3ab95a0480ac86b0a80deb4a37a690afa12b45b5bd1c3a0c93134bd01458817c751dc6c81fdf8db95054ad1de933aca00bd512df900280690c7fdf022be547cf9f1191302fb8c1880aaef5eb134bb04067b5626cc909a126b7717d261e40052ab5e45e7621ada76095fe35508db257485a4a4046cca20fa4aafdb0e623ff5a93d2aa6f0e6ad5aa624799151bf4c6815c9222b261655c1d811e79323a7ce87b725ebd74e09afebb9ca291da2e4cf24fb4289b4db6ef3f42ad00a4bd7a7167592731c71f4da0ee5227d8440d52871157dab9c572ffeddf1019f29ad0890ebc89993b878bd851bcc0d316e097bd4d029297de35620a72575459dfef6910393dc99c4873697282e6737426c8e4f3a60217ff1ca92b7f2dfa698303d9cfa7dc37325abbe1ee0928b0f1a9beb72544a31483b3ed53a73018c296340bd9c8988278c07db2841a3b07ed65ee19c5a676ea451cee5362aa6931e9e514f33388aae5df07713769566fe0c232840aef3fc41316631f01d5275f13f49a21c0396865131375c6f1bf4d0ee0c94e2d4602120a9947912dafa8c4ea234fa7c4c06e004e255e4ddb6ccc0a6c8ba404cd3211acfac409b71c920f49606ba1f6b0c7ef6a64987569e8307a12c63848945251f63151bd756fbaaffeb994a82f7d558ac9e7e49cc8c365d661abc5f7bd27b23df1b77b82751841df81a663a3be6c9dc3ed2acb21a34dd0484a4321f2fa59ccad7ec79925bfddbc7aab0ed56a330760c22b81832fc72db2b510abde65c3bb58943261ffcc29ca781b891acd7885e4dbd27a2de9e78a2a69d9107fe4a40785f3f00037af4424ce01c7f5b9d34a03faae18e5713fa258a856494cf2c9f08157bfb61903e45e4d67e055b2c696fbecd6ee4f4b4fa881958c28da577a7a502d6a75a3cf53d409f07933487912cd3d0ee9dc8174c75ebcd5b3a70deec30480fcdc4d297b6c668d623bc7e1754435cb80545d093a27b2b827629707ca7302a35f27cd6b03600ed263d8bab5e71782fe3f3b7b91618387f49ba5ac2bbafda077a20fd7dc04f2ff81c4eea069069fe2111caa708851eea6b0b6f6a87cf37c3d50b42d74bef922c0fedbeba728fc70c0718be8463c6f19fe8943135072f2bcc60397f4e20a68d68f7450028e53fea883e5bfdd9f09e23e46afc34cbb7fb7ffa47e9a1ca76a38b5d6a2f846a0bfbeb85de9241bfbda31ee97751fec695a147a9de7089a44edb021d3523de191c51e552a7bdeaf74752a84be410faf88e47014fc35ef1f008570dfd966de14a66789d237b4a71db8f3ce36eeed40a2e40cdfa76213427d2da9fe88853ac001cd16601d1f2ea2320be72aca369d8609aff5dca4e4965208166227503310c2e90c43eef9ba3baca15b056730b0dc5c81f6838b47ad84497d4cc3361aaf557c54497a163fa339f136bb9ea28976c969830b70ed6d2eb4�x������U(�������XKVl��`���$������������������
��atch [bz#1749134]
- Resolves: bz#1743477
  (Since bd94bc06479a "spapr: change default interrupt mode to 'dual'", QEMU resets the machine to select the appropriate interrupt controller. And -no-reboot prevents that.)
- Resolves: bz#1746790
  (qemu core dump while migrate from RHEL7.6 to RHEL8.1)
- Resolves: bz#1747836
  (Call traces after guest migration due to incorrect handling of the timebase)
- Resolves: bz#1749134
  (I/O error when virtio-blk disk is backed by a raw image on 4k disk)- kvm-trace-Clarify-DTrace-SystemTap-help-message.patch [bz#1516220]
- kvm-socket-Add-backlog-parameter-to-socket_listen.patch [bz#1726898]
- kvm-socket-Add-num-connections-to-qio_channel_socket_syn.patch [bz#1726898]
- kvm-socket-Add-num-connections-to-qio_channel_socket_asy.patch [bz#1726898]
- kvm-socket-Add-num-connections-to-qio_net_listener_open_.patch [bz#1726898]
- kvm-multifd-Use-number-of-channels-as-listen-backlog.patch [bz#1726898]
- kvm-pseries-Fix-compat_pvr-on-reset.patch [bz#1744107]
- kvm-spapr-Set-compat-mode-in-spapr_core_plug.patch [bz#1744107]
- Resolves: bz#1516220
  (-trace help prints an incomplete list of trace events)
- Resolves: bz#1726898
  (Parallel migration fails with error "Unable to write to socket: Connection reset by peer" now and then)
- Resolves: bz#1744107
  (Migration from P8(qemu4.1) to P9(qemu4.1), after migration, qemu crash on destination with error message "qemu-kvm: error while loading state for instance 0x1 of device 'cpu'")- kvm-memory-Refactor-memory_region_clear_coalescing.patch [bz#1743142]
- kvm-memory-Split-zones-when-do-coalesced_io_del.patch [bz#1743142]
- kvm-memory-Remove-has_coalesced_range-counter.patch [bz#1743142]
- kvm-memory-Fix-up-memory_region_-add-del-_coalescing.patch [bz#1743142]
- kvm-enable-virgl-for-real-this-time.patch [bz#1559740]
- Resolves: bz#1559740
  ([RFE] Enable virgl as TechPreview (qemu))
- Resolves: bz#1743142
  (Boot guest with multiple e1000 devices, qemu will crash after several guest reboots: kvm_mem_ioeventfd_add: error adding ioeventfd: No space left on device (28))- kvm-redhat-s390x-Rename-s390-ccw-virtio-rhel8.0.0-to-s39.patch [bz#1693772]
- kvm-redhat-s390x-Add-proper-compatibility-options-for-th.patch [bz#1693772]
- kvm-enable-virgl.patch [bz#1559740]
- kvm-redhat-update-pseries-rhel8.1.0-machine-type.patch [bz#1744170]
- kvm-Do-not-run-iotests-on-brew-build.patch [bz#1742197 bz#1742819]
- Resolves: bz#1559740
  ([RFE] Enable virgl as TechPreview (qemu))
- Resolves: bz#1693772
  ([IBM zKVM] RHEL AV 8.1.0 machine type update for s390x)
- Resolves: bz#1742197
  (Remove iotests from qemu-kvm builds [RHEL AV 8.1.0])
- Resolves: bz#1742819
  (Remove iotests from qemu-kvm builds [RHEL 8.1.0])
- Resolves: bz#1744170
  ([IBM Power] New 8.1.0 machine type for pseries)- kvm-RHEL-disable-hostmem-memfd.patch [bz#1738626 bz#1740797]
- Resolves: bz#1738626
  (Disable memfd in QEMU)
- Resolves: bz#1740797
  (Disable memfd in QEMU)- kvm-x86-machine-types-pc_rhel_8_0_compat.patch [bz#1719649]
- kvm-x86-machine-types-q35-Fixup-units_per_default_bus.patch [bz#1719649]
- kvm-x86-machine-types-Fixup-dynamic-sysbus-entries.patch [bz#1719649]
- kvm-x86-machine-types-add-pc-q35-rhel8.1.0.patch [bz#1719649]
- kvm-machine-types-Update-hw_compat_rhel_8_0-from-hw_comp.patch [bz#1719649]
- kvm-virtio-Make-disable-legacy-disable-modern-compat-pro.patch [bz#1719649]
- Resolves: bz#1719649
  (8.1 machine type for x86)- kvm-spec-Update-seavgabios-dependency.patch [bz#1725664]
- kvm-pc-Don-t-make-die-id-mandatory-unless-necessary.patch [bz#1741451]
- kvm-display-bochs-fix-pcie-support.patch [bz#1733977 bz#1740692]
- kvm-spapr-Reset-CAS-IRQ-subsystem-after-devices.patch [bz#1733977]
- kvm-spapr-xive-Fix-migration-of-hot-plugged-CPUs.patch [bz#1733977]
- kvm-riscv-roms-Fix-make-rules-for-building-sifive_u-bios.patch [bz#1733977 bz#1740692]
- kvm-Update-version-for-v4.1.0-release.patch [bz#1733977 bz#1740692]
- Resolves: bz#1725664
  (Update seabios dependency)
- Resolves: bz#1733977
  (Qemu core dumped: /home/ngu/qemu/hw/intc/xics_kvm.c:321: ics_kvm_se�x���������������������X|l��������h$������T��$D����������������T�U��J�`?�Hd����	%�	?�\�`�����������	�����	@		R	
	d	
�	LQ	
M\	Q�	V�	[�\	`$`0`la(a�8a��9d�:|)�GT�	HX�	I\�	X]�Y]�\]�	]b 	^w-bz�d{�e{�f{�l{�t|	u�$	v�Hw��	x��	y����������������������D�X�\6����6
�����D�H	�Tg�Xh�\Cpython3-dnf4.7.021.el8_10.alma.1Python 3 interface to DNFPython 3 interface to DNF.g��s390x-builder01.almalinux.org@(AlmaLinuxAlmaLinuxGPLv2+AlmaLinux Packaging Team <packager@almalinux.org>Unspecifiedhttps://github.com/rpm-software-management/dnflinuxnoarch8m5�6�77dfkyy��"�"���HH��%�%� I ���'*'*77##����V�V�������ggD_D_KuKu�����<<xix�!�!�	1	1��A�A����(��-�.aa���}{gh��zz��		yy��(�(�,�,�����ee:t:t��QQWW**��__6Q6QaaOO��?t��	:�F%Sm
�A�]�2z���&l	sJ2~/	�f]4Z�9f�`����:':'
	
	jjO��
j	@�
qq7�8XF�F�<�:%,;��M~0!�(rT�<<^�^�F��+�o%V3QL&�	�	�hhY��e~-faO��qq&�&�66.W>���A�A�A큤A큤������������������������������������������������������������������������������������������������������������������A큤A큤��������������������������������������������������A큤A큤����������������������������������������������������������������������������������������������������������������������������������������������������������������A큤A큤������������������������A큤A큤��������������������������������A큤A큤����������������������������A큤A큤��������������������������������������A큤A큤��������������g��g��g��g��`tf�g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��`tf�g��`tf�g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��`tf�g��g��`tf�g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��gЈx����� F��������XPk��������p5¹�$R����������������¹ù���t
- spec file cleanup (based on #894199)- fix #882305 - agetty: unstable /dev/tty* permissions
- fix #885314 - hexdump segfault
- fix #896447 - No newlines in piped "cal" command
- fix libblkid cache usage (upstream patch)
- fix #905008 - uuidd: /usr/sbin/uuidd has incorrect file permissions- fix #889888 - wipefs does not completely wipe btrfs volume- upgrade to upstream maintenance release 2.22.2- sources cleanup- fix #872787 - su: COMMAND not specified- backport upstream runuser(1)
- enable su(1)- apply pathes from upstream stable/v2.22 branch
- fix #865961 - wipefs -a should use O_EXCL- upgrade to the release 2.22.1- remove obsolete references to e2fsprogs- upgrade to the release 2.22
- enable eject(1) from util-linux, obsolete original eject package
- fix #853164 - setuid program should have full RELRO
- fix #851230 - probe_ntfs: /usr/sbin/blkid was killed by SIGSEGV- upgrade to the release 2.22-rc2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.22/v2.22-ReleaseNotes
- add sulogin, utmpdump, lslocks, wdctl- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- replace udev dependenceis with systemd- upgrade to bugfix release 2.21.2
- fix #814699 - namei(1) incorrectly resolves relative symlinks
- fix #820707 - Impossible to unmount nfsv4/krb5 mounts after network disconnect
- fix #816877 - libmount does not close device fd before mount(2)
- fix #822705 - unable to login after installing- upgrade to bugfix release 2.21.1- upgrade to release 2.21- fix #788703 - /run/blkid does not exist- upgrade to the release 2.21-rc2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.21/v2.21-ReleaseNotes
- add {fsck,mkfs}.minix
- add new command chcpu(8)
- add new command prlimit(1)
- enable raw(8) command
- move 60-raw.rules from /etc from /usr/lib/udev/rules.d
- move blkid cache from etc to /run/blkid- install everything in /usr
  https://fedoraproject.org/wiki/Features/UsrMove- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- fix #748216 - util-linux requires pam >= 1.1.3-7
- remove ddate(1)- Rebuilt for glibc bug#747377- upgrade to the release 2.20.1
  ftp://ftp.infradead.org/pub/util-linux/v2.20/v2.20.1-ReleaseNotes- upgrade to the release 2.20- upgrade to the release 2.20-rc2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.20/v2.20-rc2-ChangeLog- upgrade to the release 2.20-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.20/v2.20-ReleaseNotes- fix #716483 - /var/tmp --(BIND-mounted)--> /tmp disrupts/hangs bootup
- fix #709681 - failure to mount if a mount point ends with a slash in /etc/fstab
- fix #709319 - 'mount -a' mounts already mounted directories
- fix kernel version parsing- upgrade to the release 2.19.1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19.1-ReleaseNotes- upgrade to the release 2.19.1-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19.1-rc1-ChangeLog- fix #682502 - Broken source URL to floppy tarball, new version available
- upgrade to floppy-0.18- upgrade to the release 2.19
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19-ReleaseNotes
- remove /sbin/mount.tmpfs -- integrated to mount(8)- fix #665062 - add support for the postlogin PAM stack to util-linux-ng- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- upgrade to the release 2.19-rc3
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19-rc3-ChangeLog- upgrade to the release 2.19-rc2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19-rc2-ChangeLog
- fix #671893 - SELinux is preventing /bin/chown from 'setattr' accesses
  on the file mounts.- clean up specfile (review #667416)- upgrade to the release 2.19-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19-ReleaseNotes- fix #645640 - new "-s" parameter parsing in agetty does not work
- add -l (lock) support to fsck- fix #623685 - please extend agetty to not require a baud rate to be specified- fix #620924 - /sbin/mount.tmpfs uses not available /usr/bin/id- fix #615719 - tmpfs mount fails with '�x�����
�������XGm�h
������b��$r����������������b�c��Gy�?t�d��
��	$�	A�`�d�����������	�������	$
0H�
�&Dh��(X(S((�8�
9�
:G�
GpHHp`IpxXp�Yp�\p�]p�^qAbq�dr�er�fr�lr�tr�usvs$ws�xs�ys�#�tx�t|�t��t�t�t�6ww"6
yXy��y�y�y�gy�hy�Cmesa-libGL23.1.44.el8_10.alma.1Mesa libGL runtime librariesMesa libGL runtime libraries.g��ex64-builder02.almalinux.org��AlmaLinuxAlmaLinuxMITAlmaLinux Packaging Team <packager@almalinux.org>Unspecifiedhttp://www.mesa3d.orglinuxx86_64*��A�A�����g��Vg��Vg��Vg���g��Rg���4ac6b32f6e65d108f5b23f72727fe51c168354dc3c22ba21b9805e7ffe9d6a6d../../../../usr/lib64/libGLX_mesa.so.0.0.0libGLX_mesa.so.0.0.0/usr/lib64/libGLX_mesa.so.0rootrootrootrootrootrootrootrootrootrootrootrootmesa-23.1.4-4.el8_10.alma.1.src.rpm������������������������libGLX_mesa.so.0()(64bit)mesa-libGLmesa-libGL(x86-64)@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@



@libX11-xcb.so.1()(64bit)libX11.so.6()(64bit)libXext.so.6()(64bit)libXfixes.so.3()(64bit)libXxf86vm.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.8)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libdrm.so.2()(64bit)libexpat.so.1()(64bit)libglapi.so.0()(64bit)libglvnd-glx(x86-64)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libpthread.so.0(GLIBC_2.3.2)(64bit)libxcb-dri2.so.0()(64bit)libxcb-dri3.so.0()(64bit)libxcb-glx.so.0()(64bit)libxcb-present.so.0()(64bit)libxcb-randr.so.0()(64bit)libxcb-shm.so.0()(64bit)libxcb-sync.so.1()(64bit)libxcb-xfixes.so.0()(64bit)libxcb.so.1()(64bit)libxshmfence.so.1()(64bit)mesa-libglapi(x86-64)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)1:1.2.0-123.1.4-4.el8_10.alma.13.0.4-14.6.0-14.0-15.2-14.14.3g�I@g��ft�e_>�d�\@dkY@cӼ�c��@c��@c\�c~@cn9@b�L@b��@a��@a�@@`�]�`��@`�!@`�O@`+��_�=�_�@_�@_�$�_�^@_*�@^��^��^��^��^ϧ�^˳@^Nt�^G�@^2�@]��@]��]�|@]M`@]H@\�@\��\�9�\�P�\�g�\��\�@\�+@\P@@\I�\�@[�@[��[��[��[��@[ug@[b�@[W�[?Y�[*A�[*A�['��[
@�Z�K@Z�V�Z�%�Z�H@Z���Z�
�Z�v@Ze�@ZJ"�Z��Z�Y�e�Y�e�Y��Y�Y��Y�d�Y�{�Y�{�Y�X@Y�z�Y���Y��@Y��Y�?@Y�@Yx�@Yl��Yg`�YW��YG��YG��YA%@Y5G�Y5G�Y&�@YR@Y�@Y.�X��X���X��X�
@X��@X��@X��@X���X���X�e@X�e@X�@X���X�M@X���X~@Xwo�Xo��XN�@X=m�X*��X�@X�@X�@X��X
��X��W��@Wށ�W�^@W�^@W�:�W���W�]@W�]@W�@W�8�W��Wj}�Wg�Wg�W_�W_�WN�@W%�W�@W�@V�V�V��V��@V�w�V�=@V��@V���V��@V�G�V�S@V�u�V^�@VQ�@V;D�V;D�V*!@V(�V'~@VC�V	@V��U�Y�U�e@U�p�U��U�@U�@�U���U���U���U��@U���U�a@UY�@UX��UKS�U4�@U&i�T�\@T�@T�~�T��@T��@T��@T�6�T�6�T�6�T��@T��@T��@T���T�B@T��@T�M�T��@T�@T���T�p@T�{�T�{�T��@T}��Tpz�Tl�@T`��TO�@TN3�T&��T
�@T
�@S��S��@S��@S�0�S�@S��S��S��S���S��@S�\�S���S�D�S�P@S��x�������������8�������X!�l`�������<��$,����������������<�=�;����c���c���c���`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<`�T<c���`�T<`�T<ba233a95f97938818fa6d84e88ba77bc9ac9994b605486de692553e248b1a6cff8560fbf050380b453edc923a3adb4048b7c1620fbe178d53575b048b5b194071274a0dd064cbee5728cdac2f4213dd673ddef2a49cf9da42f8155552fe9721200bd486a870cad3dcd822dadbc46e864e7ead2e29120b791e31b14c309b2c2b0a8fa0dfc07877a7b9b87eaec9f13f3553e56d3aa2baaf923f2a63c077873687752ca60b97069384f653c451d4e0226e408f7022c084645eb51e862a49b6376ec6967adbad7508bcc04f4e2b7daa79e005bf82da259ebbe6e1b1d675ae9f9d42ce6e3c0240b808d15ca92c9b381b428c7c857275362d8505160ebbec3decc971aad03e3aa0e7624b85da9939e492ca9c6b16e64d8c22f772ba2216081bc70e6459b086b545da4cf06ed672b54a147f8c4e78bdd0c3b69949087fc10fac5f6e40f910d1b0d9650c1af13a62b40b32679ad0dfaf6f77c67ff47bf542f3f3c847fdf5184aff86d503379515234f36e374cb3a4df94074bf1a07a5ebe8bbbea942ee6af4c1d647f48afe054ac4c83694489300b2dd8bfc61a79ad70a97826526b0d50c0af1021b1fc442786082fa26212ce87def8cf874f80f4917e9d34da4415720315dd063f9aed392f1379fb566294ce0ef4c79df758b6a5b13afaf4bfab3266b312855711eddbd2ff3fd87c8082819a734b7ed4b25eed21dc7c5e80afb21eb5ace3b015341b40b3358457fad5f261364d7c0126da75ea7d22d7f370cca6e6fdc7b9fb39c806dbe5ee0070968e68019ab2495c8b044eb88726e5bcfb82978d8b0ef5e50e2cae63e4300890063476c26cc404a9ba0def24389dff37634d7095dade52bdd5f4297f88a6aa3cfd5c9433f64a930d13b32e6a1fe935f0550b2bfb6339c259a7d0b6534644c3909a12dddbca647eafc1666e019209c7b28ecc7eeff391c168770894985bd69c7d0c3477315d945f31e31a70aa161e2b27f66d2d9d269e70649d1888043627b794860dd74fc2e9a9b43993ef4e73c7c049456a83b4fb2172b5901b9d9257a1e086513587ba5008adee5c1024c19b8fcdc3c7e63c981c67d527cf98d2b2286d4662dec6a3db6482ede903c29190e52c4ac71188bbfe722e0ebf435062672886a81921a508511692be946a9d3bdbb982b90031f13d554c5ad78933f31468e07b0bb6126a8e004dc9d45ff0abef425c47d13d721e2f282d0cc597e098e56dd1b4b10f198435b1f19c1f06e91857b901b487a0b93d7d3a7bb150fc929724b391929d64fe73f70b3571c27471be22ee1e4d5e29a8d11e152b87cdcd79f94bd859b64117a9b19a37f9f2066cf958b99f182a65f1da9f9cf5270bebbefd9191aa33494e518221724ad8005a189278d44da13df01bbb3ce6cc17cb5c5ef7931f180f6498aa012a9dbf7b50d7c4632f1e9052a279eda22805e5f209361da3e27735a0c40655bfe9e74259000bab9a0fd122ffa7f1808019cd936768a54d4a799525187adf3b6954c88abdd8500a4165557f0ea7ae948a07c666627666faae05334de079b68a70e5a17dceca2ee2215d13056ebd7f14de1d8a2b0b385d0d4ea739d8721cb79968a2d54cf025607e8d6fc013a8af8be35db4c5220c51a5add1c73395694e009b34df418714731f54ce499834d419434d49a3b8eb9e5f9752b9c1098a65842652c48d4a5fc4dcc10b366ed79498da90f01c2648bf231391a11870f0918fb2598cc2ca7b5eb12a61116d056a53a7d049617439d70b5dd933e6f06881f415d2ff954b094f041974f8ce660e82fa0cd540c79edb2ad874642b8dc05d9fed95624b00b85ea243c32f1645a8483da0a6f2e49b0c57702314cdec9fc66c2987567f9770ef4f00ff4015604ea6a84a2b89eb32548a9f19982df60264eb419d0580ced54cde103e3e236a88e4641b7c9f0cc643d7e493a09c4034ed2c37a7c756e6ed4bab5fad47fd9a3dc2f9adce65a088ec01aaeb924ef5fddf69cf31835a987fbaa86fd388a90631d8e9d8910b85a7f9a8436dbf�x���������������������X"[l��������	��$����������������	�
���r-ptcr.patch [bz#1639069]
- kvm-ppc-spapr_caps-Add-SPAPR_CAP_NESTED_KVM_HV.patch [bz#1639069]
- kvm-Re-enable-CONFIG_HYPERV_TESTDEV.patch [bz#1651195]
- kvm-qxl-use-guest_monitor_config-for-local-renderer.patch [bz#1610163]
- kvm-Declare-cirrus-vga-as-deprecated.patch [bz#1651994]
- kvm-Do-not-build-bluetooth-support.patch [bz#1654651]
- kvm-vfio-helpers-Fix-qemu_vfio_open_pci-crash.patch [bz#1645840]
- kvm-balloon-Allow-multiple-inhibit-users.patch [bz#1650272]
- kvm-Use-inhibit-to-prevent-ballooning-without-synchr.patch [bz#1650272]
- kvm-vfio-Inhibit-ballooning-based-on-group-attachment-to.patch [bz#1650272]
- kvm-vfio-ccw-pci-Allow-devices-to-opt-in-for-ballooning.patch [bz#1650272]
- kvm-vfio-pci-Handle-subsystem-realpath-returning-NULL.patch [bz#1650272]
- kvm-vfio-pci-Fix-failure-to-close-file-descriptor-on-err.patch [bz#1650272]
- kvm-postcopy-Synchronize-usage-of-the-balloon-inhibitor.patch [bz#1650272]
- Resolves: bz#1610163
  (guest shows border blurred screen with some resolutions when qemu boot with -device qxl-vga ,and guest on rhel7.6 has no  such question)
- Resolves: bz#1639069
  ([IBM 8.0 FEAT] POWER9 - Nested virtualization in RHEL8.0 KVM for ppc64le - qemu-kvm side)
- Resolves: bz#1645840
  (Qemu core dump when hotplug nvme:// drive via -blockdev)
- Resolves: bz#1650272
  (Ballooning is incompatible with vfio assigned devices, but not prevented)
- Resolves: bz#1651195
  (Re-enable hyperv-testdev device)
- Resolves: bz#1651994
  (Declare the "Cirrus VGA" device emulation of QEMU as deprecated in RHEL8)
- Resolves: bz#1654651
  (Qemu: hw: bt: keep bt/* objects from building [rhel-8.0])- kvm-block-Make-more-block-drivers-compile-time-configura.patch [bz#1598842 bz#1598842]
- kvm-RHEL8-Add-disable-configure-options-to-qemu-spec-fil.patch [bz#1598842]
- Resolves: bz#1598842
  (Compile out unused block drivers)- kvm-configure-add-test-for-libudev.patch [bz#1636185]
- kvm-qga-linux-report-disk-serial-number.patch [bz#1636185]
- kvm-qga-linux-return-disk-device-in-guest-get-fsinfo.patch [bz#1636185]
- kvm-qemu-error-introduce-error-warn-_report_once.patch [bz#1625173]
- kvm-intel-iommu-start-to-use-error_report_once.patch [bz#1625173]
- kvm-intel-iommu-replace-more-vtd_err_-traces.patch [bz#1625173]
- kvm-intel_iommu-introduce-vtd_reset_caches.patch [bz#1625173]
- kvm-intel_iommu-better-handling-of-dmar-state-switch.patch [bz#1625173]
- kvm-intel_iommu-move-ce-fetching-out-when-sync-shadow.patch [bz#1625173 bz#1629616]
- kvm-intel_iommu-handle-invalid-ce-for-shadow-sync.patch [bz#1625173 bz#1629616]
- kvm-block-remove-bdrv_dirty_bitmap_make_anon.patch [bz#1518989]
- kvm-block-simplify-code-around-releasing-bitmaps.patch [bz#1518989]
- kvm-hbitmap-Add-advance-param-to-hbitmap_iter_next.patch [bz#1518989]
- kvm-test-hbitmap-Add-non-advancing-iter_next-tests.patch [bz#1518989]
- kvm-block-dirty-bitmap-Add-bdrv_dirty_iter_next_area.patch [bz#1518989]
- kvm-blockdev-backup-add-bitmap-argument.patch [bz#1518989]
- kvm-dirty-bitmap-switch-assert-fails-to-errors-in-bdrv_m.patch [bz#1518989]
- kvm-dirty-bitmap-rename-bdrv_undo_clear_dirty_bitmap.patch [bz#1518989]
- kvm-dirty-bitmap-make-it-possible-to-restore-bitmap-afte.patch [bz#1518989]
- kvm-blockdev-rename-block-dirty-bitmap-clear-transaction.patch [bz#1518989]
- kvm-qapi-add-transaction-support-for-x-block-dirty-bitma.patch [bz#1518989]
- kvm-block-dirty-bitmaps-add-user_locked-status-checker.patch [bz#1518989]
- kvm-block-dirty-bitmaps-fix-merge-permissions.patch [bz#1518989]
- kvm-block-dirty-bitmaps-allow-clear-on-disabled-bitmaps.patch [bz#1518989]
- kvm-block-dirty-bitmaps-prohibit-enable-disable-on-locke.patch [bz#1518989]
- kvm-block-backup-prohibit-backup-from-using-in-use-bitma.patch [bz#1518989]
- kvm-nbd-forbid-use-of-frozen-bitmaps.patch [bz#1518989]
- kvm-bitmap-Update-count-after-a-merge.patch [bz#1518989]
- kvm-iotests-169-drop-deprecated-autoload-parameter.patch [bz#1518989]
- kvm-block-qcow2-improve-error-message-in-qcow2_inactivat.patch [bz#1518989]
- kvm-bloc-qcow2-drop-dirty_bitmaps_loaded-state-variable.patch [bz�x�������������(��������X#�l���������������|��$l����������������|�{�}��6/site-packages//usr/lib/python3.6/site-packages/dnf-plugins//usr/lib/python3.6/site-packages/dnf//usr/lib/python3.6/site-packages/dnf/__pycache__//usr/lib/python3.6/site-packages/dnf/cli//usr/lib/python3.6/site-packages/dnf/cli/__pycache__//usr/lib/python3.6/site-packages/dnf/cli/commands//usr/lib/python3.6/site-packages/dnf/cli/commands/__pycache__//usr/lib/python3.6/site-packages/dnf/conf//usr/lib/python3.6/site-packages/dnf/conf/__pycache__//usr/lib/python3.6/site-packages/dnf/db//usr/lib/python3.6/site-packages/dnf/db/__pycache__//usr/lib/python3.6/site-packages/dnf/module//usr/lib/python3.6/site-packages/dnf/module/__pycache__//usr/lib/python3.6/site-packages/dnf/rpm//usr/lib/python3.6/site-packages/dnf/rpm/__pycache__//usr/lib/python3.6/site-packages/dnf/yum//usr/lib/python3.6/site-packages/dnf/yum/__pycache__/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -march=z13 -mtune=z14 -fasynchronous-unwind-tables -fstack-clash-protectioncpioxz2noarch-redhat-linux-gnuPython script, ASCII text executabledirectorypython 3.6 byte-compiledASCII text	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~�����������������������������x����������������������X$�l��������0������}��$m����������������}�|�~���������������������������������������������������������������������������������������������RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRpython3-unboundrpm-plugin-systemd-inhibitutf-80fffc70579c2f412c445229f4421cb28bd4fe69f9e5f0335891a72e14a84632b?������3!�^���P,��*����%�g��
	*����%�A8�&��s5F�c�צּ.�%��.�Q${
��
�(�c8�Z�Y
�6�QCٳ�*�^��I��(��7�I@��͘N��h����pOI�K&��"��͢
�=����ԗź�vJ�����!Rb�% F�b��7����/c��V�����?x1���Jn댞m3o��vy���w5��藂�����#��i�V3��^wK��ܝ��5�S%�:C�`�]R8
;�0v�w%�3���k�cR,�pY��^$�>��sQҸ�3���\��=z-��ؐ�8�&u����|k;���1@G�
Ɓ:N�+4g�e_�Z���3�Jp!!��U']���Ge���|��$x��FC��88}ƕv^�%�7���
l;���.�)<�HfO�=9��=��b�5��!
��1�*�~���S| 9�#������ֈ�Ё�;��6晳������"Ÿ5�N|�+$�g1n/W��M�#���G�*�?�D(]��A�q3Hƻ)Q���0D�%��#��lJ=�|=2�Nx�j�3!�^���P,��*����%�g��
	*����%�^ҳ��/�y�	5�5p��/$�16?X$�z��7BE�*o�T��A):�
u���*>��n��[$wNu߉�6��
�*����8*��!���4������8V��L��J{���ҿA��'U"MBY�4�w�"��F^~��NN�q�v?ň5�fڤ�P��}��ΡN�Ĉ3dC�B��BZ�#�n
�x�U�
�C{�I[w~�6^f�F)��C2ٜ�|��$�f��*�q���f����o��ƣ��ٿy��x�ȸm�)���*�6����)
�y���+P�P��dE�#f(�����QCc‘��W�����L0��\�_O�]Dfh�M�*:^S�E�I�4\]���:���Cl����6{�D���;R�k�h��i�^~>]���b�M�E8�gj+�K��^^j1tPf�l�=0t*���ػ���F��w5��Lx5wf��J�|$�Ad�l��
�j��VL�"�s~ "��2�m9��{۫��W��vHa622fab5f1a6d1e304170c6cd1aa0c73f568b4acb07ae7eba5b32533fd64030c3e869b38b9a1eb2e0376ad806ee16ea2e36b7d3di0d�x���������������������X%�l���������������_��$O����������������_�^�`��nd failing scriptlets (RhBug:1724779)
- Don't show older install-only pkgs updates in updateinfo (RhBug:1649383,1728004)
- Add --ids option to the group command (RhBug:1706382)
- Add --with_cve and --with_bz options to the updateinfo command (RhBug:1750528)- Update to 4.2.11
- Improve modularity documentation (RhBug:1730162,1730162,1730807,1734081)
- Fix detection whether system is running on battery (used by metadata caching timer) (RhBug:1498680)
- New repoquery queryformat: %{reason}
- Print rpm errors during test transaction (RhBug:1730348) 
- Fix incorrectly marked profile and stream after failed rpm transaction check (RhBug:1719679)
- Show transaction errors inside dnf shell (RhBug:1743644)
- dnf-automatic now respects versionlock excludes (RhBug:1746562)
- [doc] Add user_agent and countme options
- [history] Don't store failed transactions as succeeded
- [history] Do not require root for informative commands
- [dnssec] Fix UnicodeWarning when using new rpm (RhBug:1699650)
- Apply excludes before modular excludes (RhBug:1709453)
- Improve help for command line arguments (RhBug:1659328)
- Add new modular API method ModuleBase.get_modules
- Mark features used by ansible, anaconda and subscription-manager as an API- Prevent reinstalling modified packages with same NEVRA (RhBug:1728252,1644241,1760825)- Remove patch to not fail when installing modular RPMs without modular metadata- Fix: --setopt and repo with dots (RhBug:1746349)- Prevent printing empty Error Summary (RhBug:1690414)- Update localizations from zanata (RhBug:1689982)
- Accept multiple specs in repoquery options (RhBug:1667898,1656801)
- Prevent switching modules in all cases (RhBug:1706215)
- Change synchronization of rpm transaction to swdb (RhBug:1737328)
- Print rpm error messages during transaction (RhBug:1677199)
- Report missing default profile as an error (RhBug:1669527,1724564)
- Describe a behavior when plugin is removed (RhBug:1700741)- Add patch to not fail when installing modular RPMs without modular metadata- Update to 4.2.7
- Fix package reinstalls during yum module remove (RhBug:1700529)
- Fail when "-c" option is given nonexistent file (RhBug:1512457)
- Reuse empty lock file instead of stopping dnf (RhBug:1581824)
- Propagate comps 'default' value correctly (RhBug:1674562)
- Better search of provides in /(s)bin/ (RhBug:1657993)
- Add detection for armv7hcnl (RhBug:1691430)
- Fix group install/upgrade when group is not available (RhBug:1707624)
- Report not matching plugins when using --enableplugin/--disableplugin
  (RhBug:1673289) (RhBug:1467304)
- Add support of modular FailSafe (RhBug:1623128)
- Replace logrotate with build-in log rotation for dnf.log and dnf.rpm.log
  (RhBug:1702690)- Update to 4.2.6
- Use improved config parser that preserves order of data
- Follow RPM security policy for package verification
- Update modules regardless of installed profiles
- [conf] Use environment variables prefixed with DNF_VAR_
- Allow adjustment of repo from --repofrompath (RhBug:1689591)
- Allow globs in setopt in repoid part
- Add command abbreviations (RhBug:1634232)
- Installroot now requires absolute path
- librepo: Turn on debug logging only if debuglevel is greater than 2 (RhBug:1355764,1580022)
- Document cachedir option (RhBug:1691365)
- Enhance documentation - API examples
- Enhance documentation of --whatdepends option (RhBug:1687070)
- Update documentation: implemented plugins; options; deprecated commands (RhBug:1670835,1673278)
- [doc] Add info of relation update_cache with fill_sack (RhBug:1658694)
- Rename man page from dnf.automatic to dnf-automatic to match command name
- Fix alias list command (RhBug:1666325)
- Fix behavior  of ``--bz`` option when specifying more values
- Add protection of yum package (RhBug:1639363)
- Fix ``list --showduplicates`` (RhBug:1655605)
- Retain order of headers in search results (RhBug:1613860)
- Solve traceback with the "dnf install @module" (RhBug:1688823)
- Fix multilib obsoletes (RhBug:1672947)
- Do not remove group package if other packages depend on it
- Re�x����������������������X&�l�)��	�4�$x�����������������4�4�4�eaac76b24a4bc3e543d866e793c130deea8d3d2e7dabee2f92102808efb8568../../../../usr/bin/oddjob_request../../../../usr/sbin/oddjobdrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootoddjob-0.34.7-3.el8.src.rpm��������������������������������������������������������������������������������������������������������������������������������������������������������config(oddjob)oddjoboddjob(x86-64)@	@@@@@@@@@@@@@



@/bin/bash/bin/sh/bin/sh/bin/sh/bin/shconfig(oddjob)dbuslibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.27)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libdbus-1.so.3()(64bit)libdbus-1.so.3(LIBDBUS_1_3)(64bit)libselinux.so.1()(64bit)libxml2.so.2()(64bit)libxml2.so.2(LIBXML2_2.4.30)(64bit)libxml2.so.2(LIBXML2_2.5.8)(64bit)psmiscrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)systemd-sysvsystemd-unitssystemd-unitssystemd-units0.34.7-3.el83.0.4-14.6.0-14.0-15.2-14.14.3# Save the current service runlevel info, in case the user wants to apply
# the enabled status manually later, by running
#   "systemd-sysv-convert --apply oddjobd".
/usr/bin/systemd-sysv-convert --save oddjobd >/dev/null 2>&1 ||:
# Do this because the old package's %postun doesn't know we need to do it.
/sbin/chkconfig --del oddjobd >/dev/null 2>&1 || :
# Do this because the old package's %postun wouldn't have tried.
/bin/systemctl try-restart oddjobd.service >/dev/null 2>&1 || :
exit 0oddjobd0.31.3c�#@b��@_ו_~�@_~�@^�I�^�I�\l@[H�@Z��@Z|;�Y�@Yy�X��@X���V�=@U���U���U���U���U�a@T�L�T�L�S�@S���SVY�SC�SC�SC�Q���Q��Q�P�9@P��P��@P��@P>@P	H@O�MZj�MQ0@MQ0@M>�@M!�@L��L�*@L�A@L��K���K`*�K]��Jj�I��@I1.�H=I@G��Fޚ@F�<@F*�E�K@DȪ�D�p@D�p@D�p@D�p@D�p@D��DWI�DWI�DWI�DWI�DWI�D;�@D;�@D;�@D;�@D;�@D;�@D;�@D;�@D;@D�D�C�@Cˊ�C�P@C�[�C��@C��@Alexander Bokovoy <abokovoy@redhat.com> - 0.34.7-3Alexander Bokovoy <abokovoy@redhat.com> - 0.34.7-2Alexander Bokovoy <abokovoy@redhat.com> - 0.34.7-1Alexander Bokovoy <abokovoy@redhat.com> - 0.34.5-4Alexander Bokovoy <abokovoy@redhat.com> - 0.34.5-3Alexander Bokovoy <abokovoy@redhat.com> - 0.34.5-2Alexander Bokovoy <abokovoy@redhat.com> - 0.34.5-1Nalin Dahyabhai <nalin@redhat.com> - 0.34.4-7Fedora Release Engineering <releng@fedoraproject.org> - 0.34.4-6Iryna Shcherbina <ishcherb@redhat.com> - 0.34.4-5Fedora Release Engineering <releng@fedoraproject.org> - 0.34.4-4Fedora Release Engineering <releng@fedoraproject.org> - 0.34.4-3Fedora Release Engineering <releng@fedoraproject.org> - 0.34.4-2Nalin Dahyabhai <nalin@redhat.com> - 0.34.4-1Fedora Release Engineering <releng@fedoraproject.org> - 0.34.3-3Fedora Release Engineering <releng@fedoraproject.org> - 0.34.3-2Nalin Dahyabhai <nalin@redhat.com> - 0.34.3-1Nalin Dahyabhai <nalin@redhat.com> - 0.34.2-1Nalin Dahyabhai <nalin@redhat.com> - 0.34.1-1Nalin Dahyabhai <nalin@redhat.com> - 0.34-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.33-5Nalin Dahyabhai <nalin@redhat.com>David King <amigadave@amigadave.com> - 0.33-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.33-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.33-2Nalin Dahyabhai <nalin@redhat.com> 0.33Nalin Dahyabhai <nalin@redhat.com> 0.32.1-1Nalin Dahyabhai <nalin@redhat.�x�������������z�������X'8m����������+��$;����������������+�*�,��hp, pgsql and ldap description
- add missing man pages (phar, php-cgi)
- add provides php(pdo-abi) for consistency with php(api) and php(zend-abi)
- use %__isa_bits instead of %__isa in ABI suffix #985350- add security fix for CVE-2013-4113
- add missing ASL 1.0 license- run tests during build- rebase to 5.4.16
- fix hang in FindTishriMolad(), #965144
- patch for upstream Bug #64915 error_log ignored when daemonize=0
- patch for upstream Bug #64949 Buffer overflow in _pdo_pgsql_error, #969103
- patch for upstream bug #64960 Segfault in gc_zval_possible_root- remove wrappers in /usr/bin (#966407)- rebuild for libjpeg (instead of libjpeg_turbo)
- fix unowned dir %{_datadir}/fpm and %{_libdir}/httpd (#956221)- update to 5.4.14
- clean old deprecated options- update to 5.4.13
- security fixes for CVE-2013-1635 and CVE-2013-1643
- make php-mysql package optional (and disabled)
- make ZTS build optional (and disabled)
- always try to load mod_php (apache warning is usefull)
- Hardened build (links with -z now option)
- Remove %config from /etc/rpm/macros.php- update to 5.4.11
- fix php.conf to allow MultiViews managed by php scripts- update to 5.4.10
- remove patches merged upstream
- drop "Configure Command" from phpinfo output
- prevent php_config.h changes across (otherwise identical)
  rebuilds- update to 5.4.9- fix php.conf- filter private shared in _httpd_modir
- improve system libzip patch to use pkg-config
- use _httpd_contentdir macro and fix php.gif path
- switch back to upstream generated scanner/parser
- use system pcre only when recent enough- improves php.conf, no need to be relocated- clarify Licenses
- missing provides xmlreader and xmlwriter
- change php embedded library soname version to 5.4- fix mysql_sock macro definition- fix standard build (non scl)- fix installed headers- use libldap_r for ldap extension- add missing scl_prefix in some provides/requires- make php-enchant optionnal, not available on RHEL-5
- make php-recode optionnal, not available on RHEL-5
- disable t1lib on RHEL-5- enable tidy on RHEL-6 only
- re-enable unit tests- minor macro fixes for RHEL-5 build
- update autotools workaround for RHEL-5
- use readline when libedit not available (RHEL-5)- update to 5.4.8
- define both session.save_handler and session.save_path
- fix possible segfault in libxml (#828526)
- use SKIP_ONLINE_TEST during make test
- php-devel requires pcre-devel and php-cli (instead of php)
- provides php-phar
- update systzdata patch to v10, timezone are case insensitive- php-fpm: create apache user if needed
- php-cli: provides cli command in standard root (scl)- add configtest option to init script
- test configuration before service reload
- fix php-fpm service relocation
- fix php-fpm config relocation
- drop embdded subpackage for scl- missing requires on scl-runtime
- relocate /var/lib/session
- fix php-devel requires
- rename, but don't relocate macros.php- initial spec rewrite for scl build- fix typo in systemd macro- php-fpm: enable PrivateTmp
- php-fpm: new systemd macros (#850268)
- php-fpm: add upstream patch for startup issue (#846858)- systemd integration, https://bugs.php.net/63085
- no odbc call during timeout, https://bugs.php.net/63171
- check sqlite3_column_table_name, https://bugs.php.net/63149- most failed tests explained (i386, x86_64)- fix for http://bugs.php.net/63126 (#783967)- patch to ensure we use latest libdb (not libdb4)- really fix rhel tests (use libzip and libdb)- fix test to enable zip extension on RHEL-7- remove session.save_path from php.ini
  move it to apache and php-fpm configuration files- update to 5.4.7
  http://www.php.net/releases/5_4_7.php
- php-fpm: don't daemonize- enable php-fpm on secondary arch (#849490)- update to 5.4.6
- update to v9 of systzdata patch
- backport fix for new libxml- update to 5.4.5- also provide php(language)%{_isa}
- define %{php_version}- drop BR for libevent (#835671)
- provide php(language) to allow version check- add missing provides (core, ereg, filter, standard)- update to 5.4.�x�������������Pi�������XB_l���������t������������$��������������������edhat-enable-opengl-add-build-and-runtime-deps.patch [bz#1618412]
- Resolves: bz#1618412
  (Enable opengl (for intel vgpu display))
- Resolves: bz#1619804
  (kernel panic in init_amd_cacheinfo)- kvm-redhat-Disable-vhost-crypto.patch [bz#1625668]
- Resolves: bz#1625668
  (Decide if we should disable 'vhost-crypto' or not)- kvm-target-i386-sev-fix-memory-leaks.patch [bz#1615717]
- kvm-i386-Fix-arch_query_cpu_model_expansion-leak.patch [bz#1615717]
- kvm-redhat-Update-build-configuration.patch [bz#1573156]
- Resolves: bz#1573156
  (Update build configure for QEMU 2.12.0)
- Resolves: bz#1615717
  (Memory leaks)- kvm-Fix-libusb-1.0.22-deprecated-libusb_set_debug-with-l.patch [bz#1622656]
- Resolves: bz#1622656
  (qemu-kvm fails to build due to libusb_set_debug being deprecated)- kvm-redhat-remove-extra-in-rhel_rhev_conflicts-macro.patch [bz#1618752]
- Resolves: bz#1618752
  (qemu-kvm can't be installed in RHEL-8 as it Conflicts with itself.)- kvm-Migration-TLS-Fix-crash-due-to-double-cleanup.patch [bz#1594384]
- Resolves: bz#1594384
  (2.12 migration fixes)- kvm-Add-qemu-keymap-to-qemu-kvm-common.patch [bz#1593117]
- Resolves: bz#1593117
  (add qemu-keymap utility)- Fixing an issue with some old command in the spec file- Fix an issue with the build_configure script.
- Resolves: bz#1425820
  (Improve QEMU packaging layout with modularization of the block layer)- kvm-migration-stop-compressing-page-in-migration-thread.patch [bz#1594384]
- kvm-migration-stop-compression-to-allocate-and-free-memo.patch [bz#1594384]
- kvm-migration-stop-decompression-to-allocate-and-free-me.patch [bz#1594384]
- kvm-migration-detect-compression-and-decompression-error.patch [bz#1594384]
- kvm-migration-introduce-control_save_page.patch [bz#1594384]
- kvm-migration-move-some-code-to-ram_save_host_page.patch [bz#1594384]
- kvm-migration-move-calling-control_save_page-to-the-comm.patch [bz#1594384]
- kvm-migration-move-calling-save_zero_page-to-the-common-.patch [bz#1594384]
- kvm-migration-introduce-save_normal_page.patch [bz#1594384]
- kvm-migration-remove-ram_save_compressed_page.patch [bz#1594384]
- kvm-migration-block-dirty-bitmap-fix-memory-leak-in-dirt.patch [bz#1594384]
- kvm-migration-fix-saving-normal-page-even-if-it-s-been-c.patch [bz#1594384]
- kvm-migration-update-index-field-when-delete-or-qsort-RD.patch [bz#1594384]
- kvm-migration-introduce-decompress-error-check.patch [bz#1594384]
- kvm-migration-Don-t-activate-block-devices-if-using-S.patch [bz#1594384]
- kvm-migration-not-wait-RDMA_CM_EVENT_DISCONNECTED-event-.patch [bz#1594384]
- kvm-migration-block-dirty-bitmap-fix-dirty_bitmap_load.patch [bz#1594384]
- kvm-s390x-add-RHEL-7.6-machine-type-for-ccw.patch [bz#1595718]
- kvm-s390x-cpumodel-default-enable-bpb-and-ppa15-for-z196.patch [bz#1595718]
- kvm-linux-headers-asm-s390-kvm.h-header-sync.patch [bz#1612938]
- kvm-s390x-kvm-add-etoken-facility.patch [bz#1612938]
- Resolves: bz#1594384
  (2.12 migration fixes)
- Resolves: bz#1595718
  (Add ppa15/bpb to the default cpu model for z196 and higher in the 7.6 s390-ccw-virtio machine)
- Resolves: bz#1612938
  (Add etoken support to qemu-kvm for s390x KVM guests)Mass import from RHEL 7.6 qemu-kvm-rhev, including fixes to the following BZs:

- kvm-AArch64-Add-virt-rhel7.6-machine-type.patch [bz#1558723]
- kvm-cpus-Fix-event-order-on-resume-of-stopped-guest.patch [bz#1566153]
- kvm-qemu-img-Check-post-truncation-size.patch [bz#1523065]
- kvm-vga-catch-depth-0.patch [bz#1575541]
- kvm-Fix-x-hv-max-vps-compat-value-for-7.4-machine-type.patch [bz#1583959]
- kvm-ccid-card-passthru-fix-regression-in-realize.patch [bz#1584984]
- kvm-Use-4-MB-vram-for-cirrus.patch [bz#1542080]
- kvm-spapr_pci-Remove-unhelpful-pagesize-warning.patch [bz#1505664]
- kvm-rpm-Add-nvme-VFIO-driver-to-rw-whitelist.patch [bz#1416180]
- kvm-qobject-Use-qobject_to-instead-of-type-cast.patch [bz#1557995]
- kvm-qobject-Ensure-base-is-at-offset-0.patch [bz#1557995]
- kvm-qobject-use-a-QObjectBase_-struct.patch [bz#1557995]
- kvm-qobject-Replace-qobject_incref-QINCREF-qobject_decre.patch [bz#15�x�����x�X�������X,�l0��+	'n�$7����������������'n(n�-�1c8cd3a2fd79ab5eb712d690e03c8d1e919265bdb003f17057c050b505871ac3ddcb2c445e90e5518455578735b793a8eebe01b0294b7054bad51db6e86d777d5748658d57e95de8db2212fec93fd3a5ef8d64c5274ebba9e5d22dc0b8e90be4ada298db1c32af0b7a71ec0183c60ecf08b317a9cb83801ffa6cb49b61e72d0940cd031ed13e5b8fc8eb7a9f58fcc69b77f6019b227cc72144909217158e9783a49234e99643c108c83b33a6b3f25f3a6e02a2308f5866163be89dcec8b5cf34e868176aca05312270dbcc632add844ef56d2a6eddde0c95d1ca1194599cba3de9b3ac6fef80aeaa3936ab52472357dfbf1aaaccb2d5ab572a4807f1e3365338510718091c30626be1f55bdb61662c011240648a48c151696a3d8d1470fa6de3f414bba9e3466b2bbe47a6a16db20f91aa7403614614ffc2cc0686da8cfd00687200e2d42318ff9056c5033358a57a1cd6c5f6df1913784d7cb2220e18eeca61dcbe5d8e77ebb4556032e83abce79dcb44fd322998d57f55d4566dae49ea18bb290ab0596bec5fb8704c34b20d08922a2c7b2348ebb2e58a29c7068c5bc1c5301130b0b7bfbea96d979697f4b3928cf2b7427041373eb2ba5c422df80706a0997278fd06ec5f59bd65ddc5f137814fbf1e10ff2480581144e3f135dd8a9b51fc20822d0765083f5332e532c3615cf182e970458d7d20726ba224d5d8b062200fbcad62e17db83435c5195579a705a70234ebab84936989f0809b9a24b7c85284ec90ac404cb37396a5431dafc7bf8f1f17e3fe9a4a3bb94dea772310c21896eece5a48de0856b31654c379026d4f439afc28d82f9c0431eae3568e8dd1afa7465f514539894b868df45b6f183a40a06e3dca1999fe5153742d106e76b17238c70af74539b8f5a5913e5a85ba517db93b53056b60a878a51eca9611c56a56c94f0f697a57ca9a5b4b6fc199b9f456d3be1310513ebd7211fa0e0279c7c9c396ab890e8d3812c30786866f4ffdfd3a92a2e37ba73efdebf3e34b7486a690f3efd7850d53707b90281796e451e323eae44eec5b26c4b28a1c2a5cb394b3fff1acf2eea72ea0c8921afc00a2d91eae4d4de050f58e630fb76f59b9acec8f6b0398329717431523c0ef10f82b09c73686df854ddb2b512d3cef01f48807da38cd36e4e18aa12298442c687052b7856a0b97e6942899bed61ae4098ff49c4fc87f18c16902ae0abd74bd91ffa97cbccbcce9bc45d12244e477eaab63c52f924c55d10a0b829fab0b07e9db16a4d796f1d3dc038f53b4f2ac0ed55d8c1a2470c6d653b7b7785243894fd26d50f4cfdc669400e16a1255b6bd7797ec89f904a26ae872be535882b7057854df10d678f3dc373170ad1adca97bcdbdd46f48ab1a60121ce26f5124ecfafdf1f7bf749de117cd719c3fa5863966b289c01b727192a611efcba86da1673df933fd038b5ff04c0ed6157da1fb1ac375e3fcdb2c024cc2bc87fbf8bdd5761d73403607fc9c6a1eda0a8e1d49a8744233d4bda2d75ee0ae9b4065beb220896c69c7e8ece9f2694f9b5fe7117caba7622c04a4afa20c9ebff3509605f214e02fe9c584f0381d057a993a39c9d7aa9613ed563c32c5e546058631d2922f65b85309d785ab3e414ffa05e30670a46706b458554c647d33d273be70c2311449720bd0dc494161366fe638cdff0dd1fc47c6d1966c9ed64e649d1fa87a8b3081a63b04d155c3b3e7992703c5931e8c52d7ddee37d044b672d05949635f482f796192dfad829b8ce0d423674ef8ca2de4c8adb9e174fb96fe7bd978713240bc74ffd60af238c8ce18991b18bc276861e02926605451841d4ec27a7955f21091a4b8f293d0894d57d3717519192343e7e7d81421e96fd09d250a7999f602875c9d1c0875c55687317342865fc35d5eb064dfbf094631089a971ccbbd9da06a5a44fec1f41daa7e5bdb9e83f35b76ecb08029e6e79c392f7f6556fe2b09fdd68201d8851c70056de579cf35c8926ae835d23ad3dddf780fda9d42244a5a89a1b0d8b3a440aac679c120e2bef70d07de5517c1b88e23c63229d33ae6f98c649cb512b099760048e60b725f4fc34c5ae31b5ddfcb7d3d1c3c48d0b0e98b65bbfd2f0e88c3be9679ccc9843ceb6a7468b4eb57119d16e2c7eca7678a3320762e117285ea194a3dff28410192e5fb9b4d2bea761812d3c7173e628bd9047657ea3902da2557927dfc69b05197befadf97babf8fbdab515d125528d628bc79436401c72b46797f5960746abf4d7368958e2aa7c05e0f2074e702b7bc937eab7769421d3276ee8c5fb89256cfcb0b4f6c66d41c9e99e15e00947738d0eddc88b2af5d846020f82e27103232c259ae65334196bb7dc461350888419e8ad300f5c33a4cd202134b7ea79fa8a5b9f2000256ad685d5fad6dc308d07ed0baf8c1b26498e709d7272d36cc73a776bc26dc3546552a42d14f4498f891c056f8ff2a22156a91b0b59e2665693d5a5e6dc56736756af80d20ea67b437f204934af8623f14ee7be213d4313b9f0ac5dbcefd5bb0f026ecc15eff7843cc714f50aae9a2dbc5d3839450a8e8e90a361a71a286e7f26278c1c76f7aa4c79847ccb46bd98d0ec3aee16b33e07f059767b45c7543f886d2660fc69e768effca2cab4138e17a55660fcef03192c617e9d585d5f49b5d34541203de996146ce7352ad4243ff194068393118860ffe5a6173b92680b933ed62b87b6dc0a7d851444e7b5058bb0e7c631571820e031e492e4e49e420d51a44008998c3bda7268e0c078fdb69aa8c2e8a9cd4ab03eb15d282001eba4efa208594664ed3d91�x�������������`H�������X*^l�uM��$��������������������dump once the block mirror job paused for no enough target space)- kvm-check-Only-test-ivshm-when-it-is-compiled-in.patch [bz#1621817]
- kvm-Disable-ivshmem.patch [bz#1621817]
- kvm-mirror-Fail-gracefully-for-source-target.patch [bz#1637963]
- kvm-commit-Add-top-node-base-node-options.patch [bz#1637970]
- kvm-qemu-iotests-Test-commit-with-top-node-base-node.patch [bz#1637970]
- Resolves: bz#1621817
  (Disable IVSHMEM in RHEL 8)
- Resolves: bz#1637963
  (Segfault on 'blockdev-mirror' with same node as source and target)
- Resolves: bz#1637970
  (allow using node-names with block-commit)- kvm-redhat-make-the-plugins-executable.patch [bz#1638304]
- Resolves: bz#1638304
  (the driver packages lack all the library Requires)- kvm-seccomp-allow-sched_setscheduler-with-SCHED_IDLE-pol.patch [bz#1618356]
- kvm-seccomp-use-SIGSYS-signal-instead-of-killing-the-thr.patch [bz#1618356]
- kvm-seccomp-prefer-SCMP_ACT_KILL_PROCESS-if-available.patch [bz#1618356]
- kvm-configure-require-libseccomp-2.2.0.patch [bz#1618356]
- kvm-seccomp-set-the-seccomp-filter-to-all-threads.patch [bz#1618356]
- kvm-memory-cleanup-side-effects-of-memory_region_init_fo.patch [bz#1600365]
- Resolves: bz#1600365
  (QEMU core dumped when hotplug memory exceeding host hugepages and with discard-data=yes)
- Resolves: bz#1618356
  (qemu-kvm: Qemu: seccomp: blacklist is not applied to all threads [rhel-8])- kvm-migration-postcopy-Clear-have_listen_thread.patch [bz#1608765]
- kvm-migration-cleanup-in-error-paths-in-loadvm.patch [bz#1608765]
- kvm-jobs-change-start-callback-to-run-callback.patch [bz#1632939]
- kvm-jobs-canonize-Error-object.patch [bz#1632939]
- kvm-jobs-add-exit-shim.patch [bz#1632939]
- kvm-block-commit-utilize-job_exit-shim.patch [bz#1632939]
- kvm-block-mirror-utilize-job_exit-shim.patch [bz#1632939]
- kvm-jobs-utilize-job_exit-shim.patch [bz#1632939]
- kvm-block-backup-make-function-variables-consistently-na.patch [bz#1632939]
- kvm-jobs-remove-ret-argument-to-job_completed-privatize-.patch [bz#1632939]
- kvm-jobs-remove-job_defer_to_main_loop.patch [bz#1632939]
- kvm-block-commit-add-block-job-creation-flags.patch [bz#1632939]
- kvm-block-mirror-add-block-job-creation-flags.patch [bz#1632939]
- kvm-block-stream-add-block-job-creation-flags.patch [bz#1632939]
- kvm-block-commit-refactor-commit-to-use-job-callbacks.patch [bz#1632939]
- kvm-block-mirror-don-t-install-backing-chain-on-abort.patch [bz#1632939]
- kvm-block-mirror-conservative-mirror_exit-refactor.patch [bz#1632939]
- kvm-block-stream-refactor-stream-to-use-job-callbacks.patch [bz#1632939]
- kvm-tests-blockjob-replace-Blockjob-with-Job.patch [bz#1632939]
- kvm-tests-test-blockjob-remove-exit-callback.patch [bz#1632939]
- kvm-tests-test-blockjob-txn-move-.exit-to-.clean.patch [bz#1632939]
- kvm-jobs-remove-.exit-callback.patch [bz#1632939]
- kvm-qapi-block-commit-expose-new-job-properties.patch [bz#1632939]
- kvm-qapi-block-mirror-expose-new-job-properties.patch [bz#1632939]
- kvm-qapi-block-stream-expose-new-job-properties.patch [bz#1632939]
- kvm-block-backup-qapi-documentation-fixup.patch [bz#1632939]
- kvm-blockdev-document-transactional-shortcomings.patch [bz#1632939]
- Resolves: bz#1608765
  (After postcopy migration,  do savevm and loadvm, guest hang and call trace)
- Resolves: bz#1632939
  (qemu blockjobs other than backup do not support job-finalize or job-dismiss)- kvm-Re-enable-disabled-Hyper-V-enlightenments.patch [bz#1625185]
- kvm-Fix-annocheck-issues.patch [bz#1624164]
- kvm-exec-check-that-alignment-is-a-power-of-two.patch [bz#1630746]
- kvm-curl-Make-sslverify-off-disable-host-as-well-as-peer.patch [bz#1575925]
- Resolves: bz#1575925
  ("SSL: no alternative certificate subject name matches target host name" error even though sslverify = off)
- Resolves: bz#1624164
  (Review annocheck distro flag failures in qemu-kvm)
- Resolves: bz#1625185
  (Re-enable disabled Hyper-V enlightenments)
- Resolves: bz#1630746
  (qemu_ram_mmap: Assertion `is_power_of_2(align)' failed)- kvm-i386-Disable-TOPOEXT-by-default-on-cpu-host.patch [bz#1619804]
- kvm-r�x��������������7�������X+�l��������`���$9���������������������
rability when parsing multipart request body). (CVE-2023-0662)- EA-11208: Update ea-php81 from v8.1.14 to v8.1.15- EA-11075: Correct default value description for log_errors in php.ini- EA-11133: Update ea-php81 from v8.1.13 to v8.1.14
- PDO::quote() may return unquoted string). (CVE-2022-31631)- EA-11070: Update ea-php81 from v8.1.12 to v8.1.13- EA-11039: Ensure php.ini is marked as a config file on debian based systems- EA-11021: Update ea-php81 from v8.1.11 to v8.1.12
- GD: OOB read due to insufficient input validation in imageloadfont(). (CVE-2022-31630)
- Hash: buffer overflow in hash_update() on long parameter. (CVE-2022-37454)- EA-10958: Update ea-php81 from v8.1.10 to v8.1.11- ZC-10009: Add changes so that it builds on AlmaLinux 9- ZC-10260: Link deb against libcurl 4 explicitly- EA-10916: Update ea-php81 from v8.1.9 to v8.1.10- EA-10865: Update ea-php81 from v8.1.8 to v8.1.9- EA-10821: Update ea-php81 from v8.1.7 to v8.1.8
- (Heap buffer overflow in finfo_buffer). (CVE-2022-31627)- EA-10758: Update ea-php81 from v8.1.6 to v8.1.7- EA-10705: Update ea-php81 from v8.1.5 to v8.1.6- EA-10634: Update ea-php81 from v8.1.4 to v8.1.5- EA-10577: Update ea-php81 from v8.1.3 to v8.1.4- EA-10532: Update litespeed to 8.0.1- EA-10506: Update ea-php81 from v8.1.2 to v8.1.3- EA-10451: Update ea-php81 from v8.1.1 to v8.1.2- ZC-9600: Fix Ubuntu 21 global regs problem- ZC-9589: Update DISABLE_BUILD to match OBS- ZC-9587: Build php-sodium- EA-10366: Update ea-php81 from v8.1.0 to v8.1.1- ZC-9524: Released tarball- ZC-9479: Build php8.1 on Ubuntu- ZC-8130: Build php8.11:8.1.34-1.el8.cloudlinux.21:8.1.34-1.el8.cloudlinux.21:8.1.34-1.el8.cloudlinux.220-snmp.inisnmp.so/opt/cpanel/ea-php81/root/etc/php.d//opt/cpanel/ea-php81/root/usr/lib64/php/modules/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnuASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b15a9cc03c71ec2749a8efe45db0f98c385bd5f3, not strippedutf-8c9b9fa0bad1d98ba5347628778746c918aeadb09e9c143f6d5cee229365f753e?���`�$��W�w�=�)�[�m��4�]!��gdcW&���K�U�b��qi�n�
	�U�b��q��z��0��"y��!Q5����z�jyr������r&/C�9
�]!��gdcW&���K�U�b��qi�n�
	�U�b��qd����Ѣ��Z��Ofc,�rm[�+����m"R�����K0d563591c5c41055c3f5e9616cf5335af2242bbe262618b174aba0102d4680e46d375bb151627e2eac41af94b24ec3f521e3100fiݵ]V�iݵ1ar other adjacent bits (Alaa Hleihel) [1789382]
- [netdrv] net/mlx5e: en_accel, Add missing net/geneve.h include (Alaa Hleihel) [1789382]
- [netdrv] net/mlx5e: Fix q counters on uplink representors (Alaa Hleihel) [1789382]
- [netdrv] net/mlx5: Fix command entry leak in Internal Error State (Alaa Hleihel) [1789382]
- [netdrv] net/mlx5: Fix forced completion access non initialized command entry (Alaa Hleihel) [1789382]
- [netdrv] net/mlx5: DR, On creation set CQ's arm_db member to right value (Alaa Hleihel) [1789384 1789382]
- [infiniband] RDMA/mlx5: Set GRH fields in query QP on RoCE (Alaa Hleihel) [1789382]
- [netdrv] net/mlx5e: Get the latest values from counters in switchdev mode (Alaa Hleihel) [1789382]
- [netdrv] net/mlx5e: Don't trigger IRQ multiple times on XSK wakeup to avoid WQ overruns (Alaa Hleihel) [1789382]
- [netdrv] net/mlx5: Fix failing fw tracer allocation on s390 (Alaa Hleihel) [1789382]
- [netdrv] net/mlx5e: Fix pfnum in devlink port attribute (Alaa Hleihel) [1789382]
- [netdrv] net/mlx5e: Fix nest_level for vlan pop action (Alaa Hleihel) [1789382]
- [netdrv] net/mlx5e: Add missing release firmware call (Alaa Hleihel) [1789382]
- [netdrv] net/mlx5: Fix frequent ioread PCI access during recovery (Alaa Hleihel) [1789382]�x�������������@'�������X,3m*�9������&��$6����������������&�%�'��o partial
  CVE-2022-31629 fix
- CVE-2024-3096: Disallow null character in bcrypt password to fix bug causing
  password_verify to erroneously return true- EA-11821: Patch to build with the latest ea-libxml2- CVE-2023-3247: Fix missing randomness check for SOAP HTTP Digest- Fix for hardened PHP
- CVE-2023-3823: Fix external entity loading in XML without enabling by
  sanitizing libxml2 globals before parsing
- CVE-2023-3824: Fix buffer mismanagement in phar_dir_read()- Add MySQL 8 charset's support
- Backport native api for MySQL 8 compatibility
- Fix tests charsets processing- Fix for hardened PHP
- CVE-2023-0567: Fix validation of malformed BCrypt hashes
- CVE-2023-0568: Fix array overrun when appending slash to paths
- CVE-2023-0662: Fix DOS vulnerabality by limiting number of parsed
  multipart body parts and printing upload limit exceed error message only once- Fix for Harden PHP
- CVE-2022-31631: Fix integer overflow that could cause PDO::quote() to return an improperly quoted string- Fix for harden PHP
- CVE-2022-31628: Fix potential infinite recursion in phar wrapper when using quine gzip file
- CVE-2022-31629: Add cookie integrity validation- Fix for Harden PHP
- CVE-2021-21705: add user name and password validation in filters module- ELS-189: Fix for Harden PHP
- CVE-2022-31625: Fix freeing of uninitialized memory leading to RCE
- CVE-2022-31626: Fix buffer overflow in mysqlnd driver leading to RCE- EA4D-337: Enable webp support for php-gd module in CL8.- EA-10532: Update litespeed to 8.0.1- ZC-9589: Update DISABLE_BUILD to match OBS- CVE-2021-21703: fix error in php fpm shared memory organization leading to privilage escalation
- CVE-2021-21707: fix handling of paths with percent encoded NULL byte- ALTPHP-1190: Update hardened php- ALTPHP-1164: Update hardened php
- EA4D-293: Added unixIDBC requires- EA-9013: Disable %check section- ALTPHP-1132: Update hardened php- EA4D-266: Update php-fpm lve patch- EA4D-267: enable systemd fpm service for cl8
- Update litespeed patches for litespeed-7.9- EA-9625: Update litespeed to 7.9- ALTPHP-1053: Update move_override_ini patch
- ALTPHP-1038: Update litespeed log patch- Fix Bug #73809: Phar Zip parse crash - mmap fail
- Fix Bug #77322: PharData::addEmptyDir('/') Possible integer overflow
- Fix Bug #77961: Slow reqursive functions with MySQL
- Fix Bug #80366: Potential issue in ext/standard/iptc.c: Return Value Not Checked- AAP-178: Added disable killing of PHP-FPM parent process in LVE when not enough of memory- ALTPHP-997: Fix Local-Master values after updating LiteSpeed- EA-9390: Fix build with latest ea-brotli (v1.0.9)- Fix for build for CentOS 8- Fix bug #79699: PHP parses encoded cookie names so malicious `__Host-` cookies can be sent (CVE-2020-7070)
- Fix bug #80007: Potential type confusion in unixtojd() parameter parsing- MODLS-815: override_ini processing patch added
- MODLS-818: Litespeed SAPI updated to 7.8- EA-9281: Update litespeed from upstream to 7.8- Fix bug #62890: default_socket_timeout=-1 causes connection to timeout
- Fix bug #70362: Can't copy() large 'data://' with open_basedir
- Fix bug #73527: Invalid memory access in php_filter_strip
- Fix bug #74267: segfault with streams and invalid data
- Fix bug #79787: mb_strimwidth does not trim string
- Fix bug #79877: getimagesize function silently truncates after a null byte- MODLS-741: Make LSCRIU log messages with timestamps
- MODLS-804: Improve mod_lsapi & lsphp error reporting in case of php memory limit reached- EA-9189: Update litespeed from upstream to 7.7- EA4D-197: Fix ea-php specs for using our litespeed patches- Fix bug #78221: DOMNode::normalize() doesn't remove empty text nodes
- Fix bug #78875: Long variables cause OOM and temp files are not cleaned (CVE-2019-11048)
- Fix bug #78876: Long variables in multipart/form-data cause OOM and temp files are not cleaned (CVE-2019-11048)
- Fix bug #79497: stream_socket_client() throws an unknown error sometimes with <1s timeout
- Fix bug #79514: Memory leaks while including unexistent file
-�x���������������������X-UmU
�*��������$=�������������������`?
��$�-�	6�	r��������	JV](�X�Y�
,�Xh\mQINBGU2rNoBEACSi5t0nL6/Hj3d0PwsbdnbY+SqLUIZ3uWZQm6tsNhvTnahvPPZ
BGdl99iWYTt2KmXp0KeN2s9pmLKkGAbacQP1RqzMFnoHawSMf0qTUVjAvhnI4+qz
MDjTNSBq9fa3nHmOYxownnrRkpiQUM/yD7/JmVENgwWb6akZeGYrXch9jd4XV3t8
OD6TGzTedTki0TDNr6YZYhC7jUm9fK9Zs299pzOXSxRRNGd+3H9gbXizrBu4L/3l
UrNf//rM7OvV9Ho7u9YYyAQ3L3+OABK9FKHNhrpi8Q0cbhvWkD4oCKJ+YZ54XrOG
0YTg/YUAs5/3//FATI1sWdtLjJ5pSb0onV3LIbarRTN8lC4Le/5kd3lcot9J8b3E
MXL5p9OGW7wBfmNVRSUI74Vmwt+v9gyp0Hd0keRCUn8lo/1V0YD9i92KsE+/IqoY
Tjnya/5kX41jB8vr1ebkHFuJ404+G6ETd0owwxq64jLIcsp/GBZHGU0RKKAo9DRL
H7rpQ7PVlnw8TDNlOtWt5EJlBXFcPL+NgWbqkADAyA/XSNeWlqonvPlYfmasnAHA
pMd9NhPQhC7hJTjCiAwG8UyWpV8Dj07DHFQ5xBbkTnKH2OrJtguPqSNYtTASbsWz
09S8ujoTDXFT17NbFM2dMIiq0a4VQB3SzH13H2io9Cbg/TzJrJGmwgoXgwARAQAB
tDZNeVNRTCBSZWxlYXNlIEVuZ2luZWVyaW5nIDxteXNxbC1idWlsZEBvc3Mub3Jh
Y2xlLmNvbT6JAlQEEwEIAD4WIQS8pDQXw7SF3RKOxtS3s7eIqNN4XAUCZTas2gIb
AwUJA8JnAAULCQgHAgYVCgkICwIEFgIDAQIeAQIXgAAKCRC3s7eIqNN4XLzoD/9P
lpWtfHlI8eQTHwGsGIwFA+fgipyDElapHw3MO+K9VOEYRZCZSuBXHJe9kjGEVCGU
DrfImvgTuNuqYmVUV+wyhP+w46W/cWVkqZKAW0hNp0TTvu3eDwap7gdk80VF24Y2
Wo0bbiGkpPiPmB59oybGKaJ756JlKXIL4hTtK3/hjIPFnb64Ewe4YLZyoJu0fQOy
A8gXuBoalHhUQTbRpXI0XI3tpZiQemNbfBfJqXo6LP3/LgChAuOfHIQ8alvnhCwx
hNUSYGIRqx+BEbJw1X99Az8XvGcZ36VOQAZztkW7mEfH9NDPz7MXwoEvduc61xwl
MvEsUIaSfn6SGLFzWPClA98UMSJgF6sKb+JNoNbzKaZ8V5w13msLb/pq7hab72HH
99XJbyKNliYj3+KA3q0YLf+Hgt4Y4EhIJ8x2+g690Np7zJF4KXNFbi1BGloLGm78
akY1rQlzpndKSpZq5KWw8FY/1PEXORezg/BPD3Etp0AVKff4YdrDlOkNB7zoHRfF
HAvEuuqti8aMBrbRnRSG0xunMUOEhbYS/wOOTl0g3bF9NpAkfU1Fun57N96Us2T9
gKo9AiOY5DxMe+IrBg4zaydEOovgqNi2wbU0MOBQb23Puhj7ZCIXcpILvcx9ygjk
ONr75w+XQrFDNeux4Znzay3ibXtAPqEykPMZHsZ2sbkCDQRlNqzaARAAsdvBo8WR
qZ5WVVk6lReD8b6Zx83eJUkV254YX9zn5t8KDRjYOySwS75mJIaZLsv0YQjJk+5r
t10tejyCrJIFo9CMvCmjUKtVbgmhfS5+fUDRrYCEZBBSa0Dvn68EBLiHugr+SPXF
6o1hXEUqdMCpB6oVp6X45JVQroCKIH5vsCtw2jU8S2/IjjV0V+E/zitGCiZaoZ1f
6NG7ozyFep1CSAReZu/sssk0pCLlfCebRd9Rz3QjSrQhWYuJa+eJmiF4oahnpUGk
txMD632I9aG+IMfjtNJNtX32MbO+Se+cCtVc3cxSa/pR+89a3cb9IBA5tFF2Qoek
hqo/1mmLi93Xn6uDUhl5tVxTnB217dBT27tw+p0hjd9hXZRQbrIZUTyh3+8EMfmA
jNSIeR+th86xRd9XFRr9EOqrydnALOUr9cT7TfXWGEkFvn6ljQX7f4RvjJOTbc4j
JgVFyu8K+VU6u1NnFJgDiNGsWvnYxAf7gDDbUSXEuC2anhWvxPvpLGmsspngge4y
l+3nv+UqZ9sm6LCebR/7UZ67tYz3p6xzAOVgYsYcxoIUuEZXjHQtsYfTZZhrjUWB
J09jrMvlKUHLnS437SLbgoXVYZmcqwAWpVNOLZf+fFm4IE5aGBG5Dho2CZ6ujngW
9Zkn98T1d4N0MEwwXa2V6T1ijzcqD7GApZUAEQEAAYkCPAQYAQgAJhYhBLykNBfD
tIXdEo7G1Lezt4io03hcBQJlNqzaAhsMBQkDwmcAAAoJELezt4io03hcXqMP/01a
PT3A3Sg7oTQoHdCxj04ELkzrezNWGM+YwbSKrR2LoXR8zf2tBFzc2/Tl98V0+68f
/eCvkvqCuOtq4392Ps23j9W3r5XG+GDOwDsx0gl0E+Qkw07pwdJctA6efsmnRkjF
2YVO0N9MiJA1tc8NbNXpEEHJZ7F8Ri5cpQrGUz/AY0eae2b7QefyP4rpUELpMZPj
c8Px39Fe1DzRbT+5E19TZbrpbwlSYs1iCzS5YGFmpCRyZcLKXo3zS6N22+82cnRB
SPPipiO6WaQawcVMlQO1SX0giB+3/DryfN9VuIYd1EWCGQa3O0MVu6o5KVHwPgl9
R1P6xPZhurkDpAd0b1s4fFxin+MdxwmG7RslZA9CXRPpzo7/fCMW8sYOH15DP+Yf
UckoEreBt+zezBxbIX2CGGWEV9v3UBXadRtwxYQ6sN9bqW4jm1b41vNA17b6CVH6
sVgtU3eN+5Y9an1e5jLD6kFYx+OIeqIIId/TEqwS61csY9aav4j4KLOZFCGNU0FV
ji7NQewSpepTcJwfJDOzmtiDP4vol1ApJGLRwZZZ9PB6wsOgDOoP6sr0YrDI/NNX
2RyXXbglnQ1yJZVSH3/3eo6knG2qTthUKHCRDNKdy9Qqc1x4WWWtSRjh+zX8AvJK
2q1rVLH2/3ilxe9wcAZUlaj3id3TxquAlud4lWDz
gpg-pubkeya8d3785c6536acdagpg(MySQL Release Engineering <mysql-build@oss.oracle.com>)-----BEGIN PGP PUBLIC KEY BLOCK-----
Version: rpm-4.14.3 (NSS-3)

mQINBGU2rNoBEACSi5t0nL6/Hj3d0PwsbdnbY+SqLUIZ3uWZQm6tsNhvTnahvPPZ
BGdl99iWYTt2KmXp0KeN2s9pmLKkGAbacQP1RqzMFnoHawSMf0qTUVjAvhnI4+qz
MDjTNSBq9fa3nHmOYxownnrRkpiQUM/yD7/JmVENgwWb6akZeGYrXch9jd4XV3t8
OD6TGzTedTki0TDNr6YZYhC7jUm9fK9Zs299pzOXSxRRNGd+3H9gbXizrBu4L/3l
UrNf//rM7OvV9Ho7u9YYyAQ3L3+OABK9FKHNhrpi8Q0cbhvWkD4oCKJ+YZ54XrOG
0YTg/YUAs5/3//FATI1sWdtLjJ5pSb0onV3LIbarRTN8lC4Le/5kd3lcot9J8b3E
MXL5p9OGW7wBfmNVRSUI74Vmwt+v9gyp0Hd0keRCUn8lo/1V0YD9i92KsE+/IqoY
Tjnya/5kX41jB8vr1eb�x���������������������X.m�"������i��$y����������������i�h�
ncy on r600 (FD.o #73511)- fix buildrequires llvm 3.4-5 to 3.4-6, because 3.4-5 is not available for F20- 10.1.1 upstream release- Disable DRI3 in F20, it requires libxcb bits we haven't backported.- Initial ppc64le enablement (no hardware drivers or vdpau yet)- mesa: Don't optimize out glClear if drawbuffer size is 0x0 (fdo #75797)- rebuild against backported llvm 3.4-5 for radeonsi GL 3.3 support.- disable r600 llvm compiler (upstream advice)- mesa: Bump version to 10.1 (final) (Ian Romanick)
- glx/dri2: fix build failure on HURD (Julien Cristau)
- i965: Validate (and resolve) all the bound textures. (Chris Forbes)
- i965: Widen sampler key bitfields for 32 samplers (Chris Forbes)- 10.1-rc3- really 10.1-rc2- 10.1-rc2- 10.1rc1
- Drop upstreamed patches- 10.0.3 upstream release- Fix accidentally inverted logic that meant radeonsi_dri.so went missing
  on all architectures instead of just ppc and s390. Sorry!- Fix a thinko in previous commit wrt libdrm_nouveau2.- Fix up building drivers on AArch64, enable LLVM there.
- Eliminate some F17 cruft from the spec, since we don't support it anymore.
- Conditionalize with_radeonsi on with_llvm instead of ppc,s390 && >F-17.
- Conditionalize libvdpau_radeonsi.so.1* on with_radeonsi instead of simply
  with_llvm to fix a build failure on AArch64.- Enable OpenCL (RHBZ #887628)
- Enable r600 llvm compiler (RHBZ #1055098)�23.1.4-4.el8_10.alma.123.1.4-4.el8_10.alma.1.build-idd2517ef443f55d0dc47bfc17edb78304e61711ablibGLX_mesa.so.0libGLX_mesa.so.0.0.0libGLX_system.so.0/usr/lib//usr/lib/.build-id//usr/lib/.build-id/d2//usr/lib64/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d2517ef443f55d0dc47bfc17edb78304e61711ab, stripped#PRRRRRR	RR
RRRRRR
RRR RRRRRRRR!RRRRRRRRR&utf-8b34aafcaadeeffb1c88ee2e71872766b4c15ff64b5dc17ec1cffff46f3b01360?���@�\�3!�^���P,��*����%�g�N|
	*����%����8vI�Һ{�~���B��(���m���@�e�X�H$�>�Ft�4�(	��'�m�ij]�')��P�*�|L>�F�L"�^(��l�0����;rԫ�t>��v��Zr�C�k~]��D�ϣ�{JiO�p��A�L�B�QolT!6�ӆ�`C�/~�BDl�#�]y�Pr�l�KK�=�8k�D��-ٰ�Ty���q�y�YZs���k���ā�lyt�V�p,�X<Ԏ{C��c�S�V!���/l��"1N��s�@,�V�V�x��3�"(����%t@
]�{G:�g��a�R��)�A��ܼ>�������s�'�|	�Aq���p�^g��t&�K��w$|V�����<~�[�_1g�
3��Y�Xۊ��c6����J8�[��]�g������9��`Z�y�Z��Q�[1ʇ�&��Ne����fhY����8{|UeA�Fj�m�b�t��q�F%����]�U'�
ۦf$M&��qM�'�7ݺ��u1�~��L��,Tx��3!�^���P,��*����%�g�N|
	*����%�ڥ�:�$i�{�c��"֌�>8"H5�r�^dϰ�U����Tj��>CA��Q;(o�҇UaDp-�4�f�R�Ѝ���?q��c�?�g��T%`�7M����##$D���DH��t�I�ZV��?t��E�|��^5b}y,yI���L�;g�����C�*��_�3�;$�1��Pt��$o�M�;�ӅF��ڦ�^�8>Leœ����_�����yi=3Irn�F�јbn����t?�vm�$�h�ٳ|� �u�&=y�}��֡�ڿ@�n���x����r�Ys�m	P9Y�ɗ먙ODg��D�=�{���V��U��&r���,��:���7{�����yш�U���,Ŷ�ea�,T]��C`�ls��S뾗�5T�B�A�T:�$!\٣�|�� ����{��YͩF�F]ێ�.-(�g���ڠ�+�"j0�tw����GG�̏:���Ե��?�G
��!��%}7@��h�P1��kc��c`�B0��6
9bd18acc0f5918b2ff51203e7cca837413b3ef4faf728b4c943b32dc1da7c00da5cba7ca4bbd0e502b2b0089c89a1eaf5ee161dei0m�i0�/usr/share/locale/fiu/B/usr/share/locale/ew�/usr/share/locale/es_PE/
/usr/share/locale/en_GB/L�/usr/share/locale/eg	/usr/share/locale/da_DK/��x����������������������X/?mh4 ��������*�$�����������������*�*�I`8?\d����	�	Q�,�0�L�P�Z�d�k�	�����������	
4�
D��	N	p	�	�
H^(�8��9P�:,P�=S�GS�HTITLXT`YTl\T�]T�^U�bV�dX6eX;fX>lX@tXXuX�vX�wZ�x[<y[��[��[��[��\\(\,�]�]��
_�_��```,g`0h`4Clogrotate3.14.06.el8Rotates, compresses, removes and mails system log filesThe logrotate utility is designed to simplify the administration of
log files on a system which generates a lot of log files.  Logrotate
allows for the automatic rotation compression, removal and mailing of
log files.  Logrotate can be set to handle a log file daily, weekly,
monthly or when the log file gets to a certain size.  Normally,
logrotate runs as a daily cron job.

Install the logrotate package if you need a utility to deal with the
log files on your system.d(�Yx64-builder02.almalinux.org8�AlmaLinuxAlmaLinuxGPLv2+AlmaLinux Packaging Team <packager@almalinux.org>Unspecifiedhttps://github.com/logrotate/logrotatelinuxx86_64# If /var/lib/logrotate/logrotate.status does not exist, create it and copy
# the /var/lib/logrotate.status in it (if it exists). We have to do that in pre
# script, otherwise the /var/lib/logrotate/logrotate.status would not be there,
# because during the update, it is removed/renamed.
if [ ! -d /var/lib/logrotate/ -a -f /var/lib/logrotate.status ]; then
  mkdir -p /var/lib/logrotate
  cp -a /var/lib/logrotate.status /var/lib/logrotate
fi����t \'F�)�A�큤A큤����A�A���A큤A큤����A큤d(�SZN�Z��ud(�Sd(�MZ���d(�Sd(�Yd(�Yd(�Yd(�Sd(�YZ��Xd(�YZN�Z(d(�Rd(�Sd(�Ya2b9806ef76e901d9d19173acc13cbead3ce816d726f2736b34f4381f4d281063650710b79bac4fb10a3fee8fd99e91d51425cae792d1630407570ef86b4ca057f64bae051c1727236f9dabe11526f1d1aad26aa53c1d0b8425efee746f5fbe881eec3d3e01e4263ffc6aab6aeee74f3b260f1df4c692525312608f7a60db048c8090335b3d2d05f24ab97657b41e6b60b838f05307638decbd0c4e151d51095213dd8420db4884064f16d3da014384c6dcfb0f4e01a6d2a12070d2bfd0cecf663dd4c6dbc53573ba94715d8420535ea4bfce75ae20238583c8199c0795881eb8177f97513213526df2cf6184d8ff986c675afb514d4e68a404010521b880643e2676b71de801a4f0ab3329d6211e50010d2a99a7f4779af380f3f39616504c74a36406f5757094d553692c97366f1a68339917823fb752d625a8578fdfdc50d../../../../usr/sbin/logrotate�@rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlogrotate-3.14.0-6.el8.src.rpm����������������������������������������������������������������������������config(logrotate)logrotatelogrotate(x86-64)@@@@@@@@@@@@@@@



@/bin/sh/bin/shconfig(logrotate)coreutilslibacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.27)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc�x�������������p������X0k�����������'�$�����������������'qD�'�7db01db8648d74f11de337e97d2dc6c62318aa4d8098d449eec754d7a515b8561e1d077089188318a5fad7355b77574a3ac612f6e14fe097274ed588da0a396d38bb1cca23e2851d40ad7aae53870832de5a04ea3ae66f28dec18d926a2d93720330ff8093d9f27d11934025f4ac0ba93af8e7844e23cb61c789c38eb92955c815eb68f98a4eb6d0268aeb2dc6c13cd18585624a22967528596fb6d4ce03f6f7b07600a7352f9917eeb6ed30992579a2d4e810ad98d53e2dfdae11b7d0f44b56e757d4c7d011064b4b1d279f00c9c7c9cee868159e572c47c2dc0950098f3b73870e7476c6395471a3ed0ad510579e0455c4d41da6c6a1109118ee5be422f0455d4910d714049a5119251e8ddeed149cbf703c330df7f7742cc1d2eff164b5d60276cd72b14685625de03e874bc6dacc671994deec386864245aad8409c7815a15e832f3b77a4bc6a260bb9470e09e04f9541d3057d75bce71c850ff1314b962085bdb841e575d89d4883719abc3dcc44743a756b27e29feb1cce626199151c9f992be37da9fb533087ae94215ce731a18f20b56052ce58e5de5a5802a8cfe2b2a8127781799303ff898b67bd11cafba4533e9039acf7e9fd343a57538e980c8100d91076a04fc7d6a3f1cd0bc16a3deb855cd3662e11be451c706d4c2fb9df0a649775b3c8c28d33c0680f711d164b30a2a0b9a841133d11888b53ae0ccdbca2fbf5371ffee250df872d5507e2758bce348a82de5fc75902c7ec18afc20d2bd7033ac21bceaba71e82ff384c063b0779b542d7e267f19d41c39f808daf66961059eb05836d5b9e618a85f09e85db78e17bcd552beecde75ea6bb9aba368911902171c6411ed9eec6200635eee90bfa3a3df414ff1a9a9429346ac98dd0286bdcaec5ed3684233657d308a0b6373ca2527b08799bcc936ea321f30c2db3397cc8be26cfe54290f41bd36a42961010cc10f20e75a42df5ce0d6661c93718af754c6bf779bb21f0867b19e8f0d3b1343094ed1e9cfa6fcd5e502cfb6698f606a6d92aebd59da5fc2318647dee874939141593c8491c9f575803baeb49fcee48218ddfaed34ff481bc588f08ea31cd64b257b5745e042be3653e33fc170dad5de6cff37e6405d425c469eefd0bba41b7997dc2de21354ecc9d4915c6cb6d1c4addcc328f4ec3dad86abb4f1bf952ce260b9a9c71c122cb25ee4125b67cf3f73dd25106e1643c002f947827749476e58d21180429d6d13ad35cd390206ee40b9e67d9bd42291f89c495db9efd3a3a5d8470a72447891b036aab2664e45db5fbc753eb0490de53277c6ea4c9210deef8810d7686f60b523b98f4c9006f4e91bd67a3cd0429ce906c857ef02195c69226b261a844e9625706fd77a45fdca7529186357ef06c0e29e1632cd3c17c70a5c914b767a9184253aaa6881e7a250f5e397f6c57b5048062d1501059605968dca8fb15fb552cee0d77251eb7f256bdc00cf6a22f68a817a4f567f6e72cc7de2d6a3e654f558885d3ad6c5f3f2e7ed9733a99f55cfbd8a6e544cd7bb3ece945b8c5003092738ab2b919d5336a58e17c9bb14003be5aa1b71dacc993ba91fca280d29e80ceaf8de89be0048d338b38c2f3c5622ada8377c23e5f2fc11bb67fda4061c33fd9d1d39fac0ed63d1cd4475870f796ba2356740968e1560ea9932fc1584c0cce8eb48a918275ebf7864adae9722625fc1b5e4b0aaf828f799a08c81e0165e2131895df2d6375ea665686289baab87154e91d00741748489b992b919da9493cff8c31b81e3dcb285b0a684c9d6a3a5b8151d6802c5092b31a7fcb1f90489798efee399c0e93c006448a69ca034ee4db9149bd9a0a95ce2db116df577d921d5cca68f4b3d25bcf9854f2bcaa65e4bfde4bccf0a94c336b77e00c07d9968f857a358fd3d0f4eff510a368da5ef776b9ba3158f23452c0083940536d093abf4b91c54f89f9b4f8a531d945a7916e1785f220c5ef2ea5c50c98e7a7c0a32e63703ca21448deeafcd8530f6829148d7b8a280e5d9bd76955aa3d62ead32d2c17318e6b20c8a5217105dd3f79d8c895978b89a29b3499a03e8eeaed15fdac92ebb2ed5c99b2156c3051392932e909376016f988a3a8c0fdd8d1389bafc9cb9ee843dafef5f9c2af1ab5f81027c063a0433951f33fd3a86896df2d895685693ec2bfdd6a3b70544715af0a46ed2453595ec57e2b6cca67b9773c1180f2acf92071a4faa619f125a34cf73f6c4fa2c690a301552b1e9ad2f6f6e434817aa56a3d92bb50689d439b696837855d7eae39882e76c9d780eed10037d099a91ecf756c0bd588529f8c110a38053a368f20dd9d8af4539014c794bf024193598a0d1b7f50b06a23528a044f74b3f6462078441605aa9fd0edf98e3ea0c8f0c46938954d80703539c59435ee1a260233ecd314d49476659eee067b488d8d832814ef437431b39a29db680c810c8dfe471ba92d8ed14cc56c82b36e02c9b7a985adcf402f1250b273fa1fbc545f9abd900c4746ee1bf28d9ee4abb1fed45412d825d30461038cd7e3ed3f8c95c1147ab3f3764522bdd00ea2ff4a8ae045537feb52b494db7e747fa05c2f3f738b830a80c93c4cde4f3c463f88c39737249162da0dc1ab3c2ebb37e5440d2cbea4d41c19d4edbbc07a8adc4b5b354bdd7d690fc127f8780f590286a3ddb9834b1445d4fcd90be107001888e5697a765838elibmariadbclient.alibmariadbclient.alibmariadbclient.a�x���������������������X,m`
	(�����A��$Q����������������A�B��H�l?�d����0�	4�	`�<�@�X�\�g�r�v�	���������	�
��~
������ ��hl�(�8��9
��:`��G��H��I��X��Y��\�,]�4^�Eb��d��e��f��l��t�u�v� ������������� �0_��_
�����X�\�`g�dh�hCea-php56-php-imap5.6.4025.el8.cloudlinux.10A module for PHP applications that use IMAPThe ea-php56-php-imap module will add IMAP (Internet Message Access Protocol)
support to PHP. IMAP is a protocol for retrieving and uploading e-mail
messages on mail servers. PHP is an HTML-embedded scripting language.i�j�build.cloudlinux.com�CloudLinuxCloudLinuxPHPCloudLinux Packaging Team <packager@cloudlinux.com>Development/Languageshttp://www.php.net/linuxx86_641p����i�j3i�j630ad26302882f692a8d2811cfaacd321a18edad586ea470c496fd8af85190e7ca7e2fa76e43ca96056f856126644daec8e5f91f7abf61aa5831c894e11309effrootrootrootrootea-php56-php-5.6.40-25.el8.cloudlinux.10.src.rpm��������config(ea-php56-php-imap)ea-php56-php-imapea-php56-php-imap(x86-64)@@@@@@@@@@@@@@@



@config(ea-php56-php-imap)ea-php56-php-cli(x86-64)ea-php56-php-common(x86-64)libc-clientlibc-client.so.2007()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcom_err.so.2()(64bit)libcrypt.so.1()(64bit)libcrypto.so.1.1()(64bit)libgssapi_krb5.so.2()(64bit)libk5crypto.so.3()(64bit)libkrb5.so.3()(64bit)libpam.so.0()(64bit)libssl.so.1.1()(64bit)opensslrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)1:5.6.40-25.el8.cloudlinux.101:5.6.40-25.el8.cloudlinux.101:5.6.40-25.el8.cloudlinux.103.0.4-14.6.0-14.0-15.2-1ea-php56-php-recode1:5.6.40-25.el8.cloudlinux.104.14.3i�q@i���i��i��i�5�i�A@i��@iy�@iM'@iJ�@i.�h�;@h�C�h�C�ht�@h$��h#4@h#4@g�g���g��@g
d�f�X@f`S@f;i@e\��ej�d�]@d��@dJ�c�G�c[�@cMC�b��b�l�b\@a�@a��a;H�`�i@`ٹ�`��`dd@`[)�`B@`7�@`��`2@_��_�]@_���_�P�_Wr@_R,@_3�_*�@_�@^��^��^�U@^��@^|�@^{G�^`�^`�^^F�^Y�^��]��]�)�]��]�@]�@]z3@]rJ@]o�@]S��]5�@]#0@];�]�]�@\�P�\��@\���\��\�r@\��\^��\Z�@\J�@\J�@\=�@\	@\&@[ٙ@[��[�Q@[^��[W�[O+�[D��[3|@[�[{@Z�@Z�@Z؄�Z�3@ZԐ@Z�J@Z�@Z�&�Z���Z���Z��@Zg#�Za�Z`�@ZX�@ZWQ�ZT��ZP�@ZOh�Z)-@ZN�Y��Y�@Y�Y�A@Y�o@Y�3�Y�J�Yw2�YoI�Yd��Ycl@YS�@YK�@YK�@YJ_�Y;@Y�Y�@Y]�X�:@X��@X�P@X�C�X��@X��@X��@X�	@X�e@X�p�X��X��X���XQ4@XJ��XEV�X@�X.�@X.�@X-��X$a@X$a@X�X�W�W�v@W�v@W��@W��@W�@W��W��W��@Ws�@Wq@Wg�W_�W^�@W^�@WM|�WH6�W3�W!�@WK�V�b�V�x�V��V��@V��@V��@V��@V��@V�S@Vr��Vr��Vj��Vh�VV�@VE�V7P@V�@Vq�U�U�@U�L@U�n�U�n�Um��Ud`@U:�U@T�	�TH�TD�@T5'@Sr	@S,)�S?�S��R�@R��@R��@R��R�R�R�R�R_�@R:�@R��Q��@Q�Y@Q�Y@Q��Q��Q��@Q��@Q��Qy�Qf��Q@j@P��@PѬ@P��P�@P�@P�*�P��@P��@P�)�P�)�P���P���P���P���P���P�5@P{��Px@Pl(�Pj�@Pi��Pi��Pe�@P`K@PY��PY��PY��PXb@PW�PS@P2&�P.2@P	H@O�@O�@O��O��@O�\@O�s@O��@O��@Ov�OtN�OpZ@OpZ@OP�@O?��O-�O�O�@O	�@N��N��N��@N��@N�@NoE�NS�x��������������������X@�l�2�L	9������$)����������������9�:�8��eac243eb8dc5d9bb2bfbab30ee5c9cb5de238080d9cbc378721f1a195b889bf13cf1f91a68218d382c8701f9d8cec5e5f7de8758628d0c7eb1cef383b227fc74ac094245c2a657334f856cb355ce5234d85397be2233c3b4aba0cfdccfd38bc172759c58f63e011cabb3de5698190a2e84fb655c39d29f5676a2216d1a79bc281fffdb68b4a1c1f7baf0d34c0d0ca9d2e52f73b8f550882283f8ad8f2b6ef0adbed6ed560d82fe1424e3fd8e1536d1019e7e61b3eea9379be619aff7bb40b5370a6849fade89c6792fe3a00df3d2736dc7a14b4b1a8b790714d6936f587d9cb878874b13ef34fbcaaf16f5612d89e5dcb113e30f5f0512ebdcee3ced3e5672396d1a2a029f28ee2e379d0b85eefaae2fab225ac324cd280b72f828ffb6b5ff95e78f85d118f0048abfc3281ea7aa50be1360a4932f56f41fbe3669018038f2ec6d48f6064c06e54e1ed90271a2b5df56cb01c315dab405de7e4abb62e1a4cbb89fe00afefc0cb4a43e3d540608e50c4b3087fca2af9d838d48a223f7864ea6d8f1100b4212074768edc15b2c9ea5cc13c6c88d5c52d36b184c3c78184742b2485b5ef95fa599d94149032d0a194c2f8b8da906d5944faf0597f2b9ded1620946ace1b31794af00ee2ce22a6e219ab6671ed3eed2bc9c671401f9f736b991f34b8a2032a93cd77f3a35059b15c7f63831f335ba6a60ddc4d7fdc6c7fdd64c4d59fc003d4ffe6d709aa8016be056fa495c9e0bb9631b38ac3215da83b79ee45f4ce9121e4a4ad6295cd71f8140ea9a6eddddb287f7c8c07834adb0cbdc6c50a13b7d4a5f8afef5bfef4bd579d0e3dd37ab232bab9106b4bbfafaee389a4351764bd89fc5828f9df70c064c9c5a2683f6c86c234619e8d6af7d42629b7a49db9760a69b567ea05955be23fba73918a6df3da9b9a5c8d7a96830acbb6c4c5e904e680a636c8b93c87f299a52003962ce7e20a0ab20b2120e8f05c7b0556e3c76c0e8c7c62a9fe379b3a077e45ef7decb0b6c93db9f27ea9e359b9b4b52b65559e6418426c3cb70a0aea37f70a36cb73bf624f4d190772cfcd2b6c6257c1f4ba6387c95d9b7fd61f0f3b056ebbf7f0a416f305b7ac014a14d27fc23c23270b388a88a6de29ddb8721d361d163d35386e8030e51675bca1da43135aabfe6dd4fed12e78595d28269363da93b5b95e3ac8a99f7801fe174c8cf20e27af9174a01bddc216cfb8cd594cc04ffd4cf0e9727a5fd5ba6e8794044cb46e48d042994d9562631c93efad97cbbf36b50a633c42139988393b072028b28b8a55ecf34b64fe807f11df0f021f222ae7fcb68040f930340312f925e72010396030918266bebf931104056c6aa381cfc0fcd661711f28003af043afc01db65f8647f46fbb3ec5417af55e0670a0bdd997b736238bb247c4b1201ee07717cd56563ae05d29a4d404ed4608827d02faefd98a43a871ac742c26d9a0c1863a90630cf7f7d89b562262b0de1e24b2b020f67b3623b5f2ed9f31978444807e790805708b22d22cf9fbb599497199cbebb089dcbbddd00741be2133bfa88d14da7ab2e9beb36c0baa79e8930232737b3ad3ed1cee14d588eece60698da86d5f9f8ac26d96fd4de7bcacb405a1233134572e3c19780f60506487f9cf290a5c2d7e380607f9480565244a6b6e2d29445afd0d73332559c5e91a03ca62571caabe372ce26c9fe2135d0b6b93839853af970e400a65e482363f01274c2e8b49665574019d75373db679d425093071c0e91b35411839ffd4574a400a057cde35dd9fe4f0fff50d41e05d970327701b942db11650cdc7749805322dae36adba5900e5af77034869a51412e4d0fe873e24593df85237ea3abe2a0046d9d59ea62d1958a233f2994fa06cb7fc5e92699ac01595ebb09f4d434c7f2fc40266b9dbe655b0c60b3678694592c8ce7efa598aa16f2a5c2c6c737ed7aaabfc32768dfc5c512591cd706d4d9c334eefbdd490a7910fd8300981c9168792f42ad9ce2eea56bbd90778b3846f74f3d60301077b1feabecc3c9efd3ff3dbaea9991504283aea294d98e11e3871471c24a63764836173219276011db578bb0138363a9b96509ed87c2a4683fab9fbe9d146fdd1f2a6c6a807e4a728361795412239cd644c919d376cc080013de325bbcea25cb436f9347f8cf9e3f1f63265beac30e01189ce2a897eafbf1b0bd0a7cf7b0f466307d302f03b7a7c332af8ec136f459336120398fbb03d8549fdc3f2d20e1b7d64e6823eedcf1bd2ef645ecde08b36456b00bde70aee46217f766129ed5a2bae02bce06ff18c0c20705faa4d9a193c9a889b7a3809f2009b6e8d9346162a8517b855fbaba871850c17e36f030594a785ca2b800a415c17432619c43efcb7e7b623c79d105bfa0828703256494f8cd9b229e931c9e2d4085ae19a7039fb8c461369553494c5a483d087e5b0435825abe1820153a6c7dee143d7964b08b0db188b2d69d4c1afb243303d31ab4025db7b35ddba31079db39135048e1f84cda0cfefb2b4139fe2c0633994161d8792c1e497972a2fcdef92830989a86d56b1e3952464bc41abc621728e16a7440830343dfb6ac2374a02bde94963ba87761e1793872a1dbf1e34edb697d950026635c31740f19dc35020ddf613b77a519a757610bcb31d4f8e5d73d2d07347a670f27b50fd2774d79501636a26289be65bb6663ef743e8e4e91245c9d58298593ce1bf8be3da59dbb3a4bd97a72eea57cd6222e5aff9f87422bc9dae08fc91f9f83258051dd36679547aac3b92fe1720a902d1f107dbcd2b92764f58420e036318d10fa594d64f05b61fa7f�x�������������س�������X3�l��ȍ)�$����������������))�)�c5ade72735f603e0523b71f0f18da6d466c3a336bcd151097a17a2a9cb5774c4dd136fb1c9bc252ec79e0b17c8e34e03531348af6f8e90b9868c1bc9384f8fde3f1b6f746c58e8c3a8710c7b654fd998ce83a5f8fb665640a9cb825a0e835dd5d7a149bc97da23b674c14a0e2374800ad0bd0b01d4c826bfbc23459b19834938331e22fbcd4716d775d65d17ea4b75a37a810e6a13d09935570165d3e1aeab3dbf5ebfaa90e50ea37a1588b4737ad53ba5dd68f23db3e5a7055ac79d00d80eca2aa7116bb955af030ff932074fba0dc9db3f69916d584133aa495eddad06d5142aaaa50596d79baf8687e77da1c331d8d174dcb85a99c6c99f2caf84c0fa480ddbfd310a0fcf385f3e47d7ed185470b106c29db902844a727c5b2ae60d8731d2692ccb9677dc084fecd65a327e23c0a8309a1ed0244d73ae8d778a4b95d3a303835d0bea9906595db278a191013e2e657daeffcb4ce5c9404334aecab4dc67733c7837c05b289a4b6f994bdea15b5ebdb7c38c8dcca285f14848b6d2674931d492ef6a4ed1a1145e73f5f60dfc29fae14c77227b2120c955dc81dbc1646afc73f1dfd33e99555dde85dd55f379420365b663c746a0b5a33fb8fbb5c59523d39aa70007cab9a9ff06489bdf81bbc9f1f4b2bb7b1a3bd04018e1f992fe121dda6cbccce25cfcc580c18d938bc22132ab08bd0a20b0bde4fbf9626b66f7c8dda920cc54f785f26f68b8c6507af410803246189f5bed6ed2ac823f5b5980635d9104bab95000c12b7fdb869bc7d9090fa6ef415fc8cc162f263c3a7983155b1871a3d064d97f3ba82187829e9f1bd5529a9faa011504f976f7fa25d40bf061606ea13a782b90641bf94a3dae058564720a75d09ee186d9afc307129b124cddeed0c6ee5d6ed315d8b50b2874c1c5daafed9369132903341f2b78960d2fcf7b5eaeb7b43fc40e539967b974e0635c1f3c765d5ba6ce95f535d903ab270fc7f91c13d667f44516883666a55cf4a7f717607f5512745b1f9f50608eb66ca1e099f750a3643dcaf32aedccc3cd71df0bf5c62383953328595c7923c8713e3bff3a8351099027f197cd712490ea52e16fe0b4d9af8c403cbda1e4523d25c817dd6c380ade1ce383d1919abf61e9120be7f71298be0e7c5bd8c9029ad6fa26e6f85aa080cf4f0b81f1c9cc4ff99f2f6aedc4e625321bc412bbafeaf7e3f9c7148a05b3044880c2c4d1d079d3d39e6c8348d4cca627add01f35e07ef49dd78c13677d10998551873e4072282dc3bf27d08bb575f533061943307451b09ccbfa6c591c9b35bfc59ca535ba580348dfe89ae730bd8df65086995b4f1cdc06c268b22a803922c59ce8bb63f526f53b9a847395004f6a6b8f2f2e2d8fc3df490fe28b660b1a84f178694071d7d1f285616723de3f01f948d78451039c010e3cd8fc0987286caa3a5cfb99c1451de4059f09dc366125f0e8fd5b9ef14644e4a088bab02f33b9b8444aa14a86926f478ea21dabd1e8b2cc14f9817f5663f99fcedf6fdc3f804d14e033c6d0ac89ecb19769a3cc35f204b58a8555950fed7062bb0fadbaaf3ede63de1af6bba038b84315f92052c641c5fb3e976ad9303f14e7bce41926554b54a560481d222ae3721bd93f4b35eb37333ddf74865f8dc243715e9c407c15e8c13bfb6327ff7bf9c79edad49cd830c1fb5ec8e0bed58bd2c4556cd5ab02c993118a1ff5045e7492230b819f9ddc45d5728346ad4b50715de9826f3978a03da9b7937b669517c958e16691cc1d621ec69722fe16473ce173936da179cf7db8e43c037b19cbfa18ab1d79b3d2d8f54cf04eed4d0ffeedc6e6fa873b19614c266f3d3232203c44a08f714a0deeeb7d6a202af3705dd2fef0a1ba4e4d9cf6152b76e71c99c01847386fc753a9a427e6e2edcfb2b161f84242768b116c7298c93952455945cb32ec166a3c518731d8abfeafe510bc0b39f654ec511d4853ee16d7b021b14b990fb91ac76611a48f22bc1b507f278a14c7f3bd6ca978201f3869f4f3d99f4e712df1b26d646adcdc54a623b59f7889a3dca2ca87490e1e32419fca062760b63848cdb105011d32bfad4dd3d1ff885c29e50a5bcda4795c6c3b6e98137fda3abe7e733e3371cae2ff88c6567bc02fb5d1f85929de95ef45fe6dd26dd45c577272079eff29ffcd7a86ee497f4b079bb243c9e605ddf1e860c16ae0741267b79f194a8a5c4e3d126bbfe3b382b3d16608c66d4eec9598e3020f37ee511e16e0faa4be89e9041cc5a90e8dc89d7f6550b00a27ae5bfd180a3210d398778cdcbff9066cf721cf9b7e43c6336493a5fae645f1eccec2268c2308e150d0168513d6ff98f1b7a157d0a8897901b4209a4947e75ecbf204b1cf1fa7a4e8b8bc66cc11acca592290395ac286aebd8efdbe0ff136294c2d61d77b5feff2a9997230f8fe9851f02573a3b89b465b906ab95b635b07869a1c447b154a28569822a4eb2abd54ed38349267409da35f7cb433a0b71312fee224be9dd4f007caed0dc966145c53e98796f6ca95874b5a041b6093177c3569457b847c839a8b451ab92884e53081b73bb5ecc54c94c9a54736a9302430c2aa105555671d6a3392a0e6d466bd563f6384f0a835c7c82c66a8aa33be11401b076f1373b3a533d90e254e887ad2a5446c7a09ab7f5ef130ab43e2e814d2e729f2d7b710743d249914306c3e26284c358ea7cfd7c1e613be2bf516a63504958678e281c94d6dd6d04e7cfffd4bdf0d6debac9ab1e98857e8b415b215281a3c084d92fcfe4cc7c01b83287476c6b3a84181ce17b90b0fe389c4223f5cba8f5c2ee56d63db�x�������������P��������X4!l��������x,
���$1�����������������������ullbyte). (CVE-2019-11045)
- Updated Litespeed SAPI to 7.6- EA-8762: Update litespeed from upstream to 7.6- Fix #76342: file_get_contents waits twice specified timeout
- Fix #76859 stream_get_line skips data if used with data-generating filter
- Fix #78579: mb_decode_numericentity: args number inconsistency
- Fix bug #78599 (env_path_info underflow can lead to RCE) (CVE-2019-11043)- ZC-4361: Fix bogus changelog dates- Fixed CVE-2019-13224- Apply allow_coredump patch for MODLS-694- EA-8549: Build php-fpm with pcntl- MODLS-689: Apply crash_limit patch- Fix #69100: Bus error from stream_copy_to_stream
- Fix #75457: heap-use-after-free
- Fix #77946: Bad cURL resources returned by curl_multi_info_read
- Fix #78333: Exif crash (bus error) due to wrong alignment and invalid cast- Fix bug #77124
- Fix bug #78192 PDO SQLite SegFault when reuse statement after schema has changed
- Fix #78212: Segfault in built-in webserver
- Fix bug #78222 (heap-buffer-overflow on exif_scan_thumbnail)
- Fix bug #78256 (heap-buffer-overflow on exif_process_user_comment)- EA-8576: Update litespeed from upstream to 7.5- EA-8558: Update litespeed from upstream to 7.4.2- Update litespeed 7.4.3 version- EA-8538: Update litespeed from upstream to 7.4- Fix bug #77967 - Bypassing open_basedir restrictions via file uris
- Fix #77973: Uninitialized read in gdImageCreateFromXbm
- Fix bug #77988 - heap-buffer-overflow on php_jpg_get16
- Fix bug #78069 - Out-of-bounds read in iconv.c:_php_iconv_mime_decode() due to integer overflow
- AAP-272: fix error with uid comparison- Fixed bug #50020 (DateInterval:createDateFromString() silently fails)
- Fixed bug #76717
- Fix #77024: SplFileObject::__toString() may return array
- Fixed bug #77664 (Segmentation fault when using undefined constant in custom wrapper)
- Fix bug #77677: WCOREDUMP not available on all systems
- Fixed bug #77697 (Crash on Big_Endian platform)
- Fix #77700: Writing truecolor images as GIF ignores interlace flag
- Fixed bug #77722
- Fixed bug #77742
- Fixed bug #77765
- Fix #77921: static.php.net doesn't work anymore
- Fix bug #77934 (php-fpm kill -USR2 not working)
- Fix #77943: imageantialias($image, false); does not work
- Fix #77944: Wrong meta pdo_type for bigint on LLP64
- Fixed bug #77945- ZC-5036: Add find-latest-version (assumes PHP is checked out next ro ea-tools)- EA-8342: Update litespeed to new upstream update of 7.3- EA-8342: Update litespeed to 7.3- Apply graceful_stop patch to ea-php- Fix bug #51068 (glob:// do not support current path relative)
- Fix bug #77390 (feof might hang on TLS streams in case of fragmented TLS records)
- Fix bug #77396 - Null Pointer Dereference in phar_create_or_parse_filename
- Fix #77431 SplFileInfo::__construct() accepts NUL bytes
- Fixed bug #77494 (Disabling class causes segfault on member access)
- Fix bug #77540 - Invalid Read on exif_process_SOFn
- Fix #77546 iptcembed broken function
- Fix bug #77563 - Uninitialized read in exif_process_IFD_in_MAKERNOTE
- Fix bug #77586 - phar_tar_writeheaders_int() buffer overflow
- Fix bug #77630 - safer rename() procedure
- LSAPI sem_timedwait synchronization fixed- ALTPHP-698: Add patch with the ability change url in Wordpress to Hardened php- MODLS-627: Fix php_value priority issue 
- MODLS-626: Update LiteSpeed patches for V 7.2- Update litespeed to the lastest version (7.2)- EA4D-129: Apply mod_lsapi_mode patch- Fix bug #77242: heap out of bounds read in xmlrpc_decode()
- Fix bug #77247: heap buffer overflow in phar_detect_phar_fname_ext
- Fix bug #77270: imagecolormatch Out Of Bounds Write on Heap
- Fix bug #77371: heap buffer overflow in mb regex functions - compile_string_node
- Fix bug #77380: Global out of bounds read in xmlrpc base64 code
- Fix bug #77418: Heap overflow in utf32be_mbc_to_code- EA4D-116: Update SIGTERM cleanup patch- Ported multiple fixes from upstream versions- MODLS-545: KeepListener behavior disabled to prevent lsphp DoS- Fixed php-fpm installing directories it does not own (EA-7526)- ALTPHP-539: Improved Litespeed SIGTERM cl�x�������������Ȓ�������X5Mm(X����������������$�������������������D>
���������������xsgbVQE@4/#
���������������ythcWRFA50$�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
z
u
i
d
X
S
G
B
6
1
%
 



���������������{vjeYTHC72&!���������������|wkfZUID83'"�
�
�
�
�
�
�
�
�
�
�
�
�
�
}
x
l
g
[
V
J
E
9
4
(
#




�	�	�	�	�	�	�	�	�	�	�	�	�	�	~	y	m	h	\	W	K	F	:	5	)	$					��������������zni]XLG;6*%���������������{oj^YMH<7+&	���������������|pk_ZNI=8,'
���������������}ql`[OJ>9-(���������������~rma\PK?:.)���������������snb]QL@;/O�w'OD�O�w'OD�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_�O�w�6_����Ѧ��>[;�	��q��(D��q�t�����u��$��>[;p��>[;&)@+�н-�G̎����ͥ���>[;�	�=��q�R��7��q������u����>[;dn,�>[; 5�$�Iq��-��>[;��<����Τ�����F����>[;]	l,��q����E��q�pLL���u
�,�>[;�m��>[;�44+��$����#�>[;e(H�>[;a&�O�w�\J����K�����릣|Q�>[;
	87��q���:��q�r� _�>[;�3\���$����$����D,�>[;-������+�)�� c��z����ʍ�p��q�0�(?��q�	�L_�>[;}k�<�>[;13d��$���ب���J��>[;�'<%�>[;i�#�O�w��m�������>[;:|8��q��.�>��q�ʄ4�8j�J�,1�>[;�j�����&(�>[;3'p.�>[;+���q�X�tQ��q��y�>[;ji���>[;2�c�[�<��������G��j}d1��M����>[;���&�>[;��`��q�b�`H��q����?�
�����>[; h!�>[;z1���������oV�.�N�O�w�EG���~8+~�U�4���}>[;�8s|>[;L|S{�q����`y�q����"x
����tw>[;�P�ww�� �r>[;%�Gq�oV	n8�p>[;�7pG��&��n>[;���+l>[;�H<k�q�V8�biJ�=�m<�hE�1h3�=h	
��|��Bg��Ib�]t�a�oV�,l`>[;%l�`G��5P8B^����|�]>[;��y\>[;��@[�q�TtYE�1O3�X	>[;�D��W>[;�/H5V�oV�.�P>[;�$!P�Â���NG��4L9N���5��2M>[;�~xL�q�޲(}IE�1�%�H	>[;�9��G>[;K.80FVg�}�|,C����d,B�oV�.$@O�w�B?�Â��pM>\�=�4�k>>[;$�;�q��@�~9E�1�%�8	>[;�-6������2>[;�
�+0O�w���/�q���L.���_��->[;~}�,>[;��=+�q�[@X)>[;58H'�f#��`�"���b��">[;�
�% �q�;��L��뵓 �>[;��q�9?`0/��>[;�7�<�2�(��a���9��v�@����>[;�LU>[;g
h#O�wXM�q����C>[;�qu�q��h	�����>[;�6�>[;�*x+�A�A&�7�T��0�@��$��x������
�������X�l�#��
)�$����������������)�-)���������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£i£eaa9b94c14225cd1d62b4c276dc570d336162b9bca2d8e90507862cf11f3f0299f12ff61302871c519d6ad338bc103d95b83cf858b8f82c3df90f95655641b5bcbb1a13a4d503cdb7857fc3072f956c6fe49246a390581c1e029ffdf790023b180baa34df5f945aee937f67a3f2d222dc2bc101e54ea8e3d63b651622a31419ecce202e74c246cefd3ab6c57341b2a3fdd61955128c8e4fd15d3bc1ad74fe1820f992e210cf67be4006c7248456d234292e6d63ab19fb1a54d84ac1e6fe4b9753847203f5a047f90654042574f2a76d877e5d3d3838382a00bff69d261b5009c313d68f719e58d69055174735985bc399c3489d57df5b6c7720a8dadf9f1ffa9e5987b1ac606ae89bc4b7365681e28d55eeb7a4db33b3c7059369e0e8f5c2a391e124e07fe33cad87a0871098f06361518c350f565b628af9f458a62b4f6e786a3be9e165aa9ee297daec�x������e
Xq�������XA�l�	^
L�$����������������LLL�Orton <jorton@redhat.com> 5.0.2-5Joe Orton <jorton@redhat.com> 5.0.2-4Joe Orton <jorton@redhat.com> 5.0.1-4Joe Orton <jorton@redhat.com> 5.0.1-3Joe Orton <jorton@redhat.com> 5.0.1-2Joe Orton <jorton@redhat.com> 5.0.1-1Tom Callaway <tcallawa@redhat.com>Tom Callaway <tcallawa@redhat.com>- EA4D-797: revert to use system libxml2 lib for all platforms
- EA4D-811: remove libphp7.so from _root_httpd_moddir to fix file conflicts- Update php-fpm patch to v4 for per-domain resource isolation support- EA4D-793: Update php-fpm LVE patch- EA4D-789: Add CVE-2015-9253, CVE-2019-9023, CVE-2019-19246, CVE-2021-21704 security patches- remove ea-mod_php provide and require- EA4D-773: Rebuild ea-phpXX on rhel>=9 with system libxml2 as cPanel- EA4D-746: Update php-fpm lve patch to extract doc_root from php_admin_values
  for CageFS per-domain isolation- EA4D-731: Fix for ea-libxml2 2.15+- build for rhel10
- build with alt-libicu65 and alt-pcre for rhel10- EA4D-714: Fix gd.so linking against ea-brotli- EA4-136: Fix libxml2 v2.15.0 compatibility- ZC-12167: Correct libxml2 problem- Security fixes
- CVE-2025-1220: fix null byte termination in hostnames
- CVE-2025-6491: fix NULL pointer dereference in PHP SOAP extension via large
  XML namespace prefix- EA4D-677: rebuild with new libtidy 5.8.0- EA4D-642: Fix for ea-libxml2 2.13+- Security fixes
- CVE-2019-9025: fix possible memcpy() execution with negative argument in
  mb_split()
- CVE-2019-11034: fix possible infoleak or crush caused by read past allocated
  buffer in exif_process_IFD_TAG()
- CVE-2019-11036: fix infoleak of crash via read past allocated buffer in
  exif_process_IFD_TAG()
- CVE-2019-11035: fix potential infoleak or crash via read past allocated buffer
  in exif_iif_add_value()
- CVE-2019-9022: fix DNS response parsing- Security fixes
- CVE-2025-1219: fix wrong `content-type` on redirect in libxml streams
- CVE-2025-1217: http stream wrapper: fix handling folded headers
- CVE-2025-1734: http stream wrapper: fix handling headers with invalid name and no colon
- CVE-2025-1861: fix http redirect location truncation- Security fixes
- CVE-2017-9120: Integer overflow in mysqli_real_escape_string()
- CVE-2017-9119: handle memory limit error during string reallocation correctly
- CVE-2017-9118: fix out of bounds access in php_pcre_replace_impl
- CVE-2020-7071: avoid parse_url() returning a wrong host to user- Security fixes
- CVE-2024-8929: fix various heap buffer over-reads for mysqlnd- Security fixes
- CVE-2024-11233: fix single byte overread with convert.quoted-printable-decode
  filter
- CVE-2024-11234: fix HTTP fulluri CRLF injection
- Bug #74960: fix heap buffer overflow via str_repeat
- CVE-2024-11236: prevent integer overflow in quoters causing OOB writes- Security fixes
- CVE-2024-8925: Fix data integrity violation while parsing multipart/form-data
  boundaries larger than the read buffer
- CVE-2024-8927: Fix bypass of cgi.force_redirect configuration- ALTPHP-1839: Change lsapi naming- Fix for hardened PHP
- CVE-2024-5458: Fix early-out for ipv6 hostname validation, ensure full check
  is performed- Fix for hardened PHP
- CVE-2024-2756: fix __Host-/__Secure-cookie bypass due to partial
  CVE-2022-31629 fix
- CVE-2024-3096: Disallow null character in bcrypt password to fix bug causing
  password_verify to erroneously return true- build for rhel8 with system openssl- EA-11821: Patch to build with the latest ea-libxml2
- ZC-10950: Add debug_package nil back w/ second directive (3rd item will be ZC-10951)
- ZC-10936: Clean up Makefile and remove debug-package-nil- CVE-2023-3247: Fix missing randomness check for SOAP HTTP Digest- Fix for hardened PHP
- CVE-2023-3823: Fix external entity loading in XML without enabling by
  sanitizing libxml2 globals before parsing
- CVE-2023-3824: Fix buffer mismanagement in phar_dir_read()- Fix for hardened PHP
- CVE-2023-0567: Fix validation of malformed BCrypt hashes
- CVE-2023-0568: Fix array overrun when appending slash to paths
- CVE-2023-0662: Fix DOS vulnerabality by limiting numbe�x�������������0a�������X8�lh��������h��$x����������������h�i�g���@6���6��5�a@5R�5<�@4��@4j�4a�@4T�@4O<@4.�3�|@Iker Pedrosa <ipedrosa@redhat.com> - 2:4.6-23Iker Pedrosa <ipedrosa@redhat.com> - 2:4.6-22Iker Pedrosa <ipedrosa@redhat.com> - 2:4.6-21Iker Pedrosa <ipedrosa@redhat.com> - 2:4.6-19Iker Pedrosa <ipedrosa@redhat.com> - 2:4.6-18Iker Pedrosa <ipedrosa@redhat.com> - 2:4.6-17Iker Pedrosa <ipedrosa@redhat.com> - 2:4.6-16Iker Pedrosa <ipedrosa@redhat.com> - 2:4.6-15Iker Pedrosa <ipedrosa@redhat.com> - 2:4.6-14Iker Pedrosa <ipedrosa@redhat.com> - 2:4.6-13Iker Pedrosa <ipedrosa@redhat.com> - 2:4.6-12Iker Pedrosa <ipedrosa@redhat.com> - 2:4.6-11Iker Pedrosa <ipedrosa@redhat.com> - 2:4.6-10Iker Pedrosa <ipedrosa@redhat.com> - 2:4.6-9Tomáš Mráz <tmraz@redhat.com> - 2:4.6-8Tomáš Mráz <tmraz@redhat.com> - 2:4.6-7Tomáš Mráz <tmraz@redhat.com> - 2:4.6-6Tomáš Mráz <tmraz@redhat.com> - 2:4.6-5Tomáš Mráz <tmraz@redhat.com> - 2:4.6-4Tomáš Mráz <tmraz@redhat.com> - 2:4.6-2Tomáš Mráz <tmraz@redhat.com> - 2:4.6-1Björn Esser <besser82@fedoraproject.org> - 2:4.5-9Björn Esser <besser82@fedoraproject.org> - 2:4.5-8Tomáš Mráz <tmraz@redhat.com> - 2:4.5-7Tomáš Mráz <tmraz@redhat.com> - 2:4.5-6Tomáš Mráz <tmraz@redhat.com> - 2:4.5-5Tomáš Mráz <tmraz@redhat.com> - 2:4.5-4Fedora Release Engineering <releng@fedoraproject.org> - 2:4.5-3Fedora Release Engineering <releng@fedoraproject.org> - 2:4.5-2Tomáš Mráz <tmraz@redhat.com> - 2:4.5-1Fedora Release Engineering <releng@fedoraproject.org> - 2:4.3.1-3Tomáš Mráz <tmraz@redhat.com> - 2:4.3.1-2Tomáš Mráz <tmraz@redhat.com> - 2:4.3.1-1Tomáš Mráz <tmraz@redhat.com> - 2:4.2.1-11Tomáš Mráz <tmraz@redhat.com> - 2:4.2.1-10Tomáš Mráz <tmraz@redhat.com> - 2:4.2.1-9Tomáš Mráz <tmraz@redhat.com> - 2:4.2.1-8Tomáš Mráz <tmraz@redhat.com> - 2:4.2.1-7Tomáš Mráz <tmraz@redhat.com> - 2:4.2.1-6Tomáš Mráz <tmraz@redhat.com> - 2:4.2.1-5Tomáš Mráz <tmraz@redhat.com> - 2:4.2.1-4Tomáš Mráz <tmraz@redhat.com> - 2:4.2.1-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2:4.2.1-2Tomáš Mráz <tmraz@redhat.com> - 2:4.2.1-1Tomáš Mráz <tmraz@redhat.com> - 2:4.1.5.1-22Tomáš Mráz <tmraz@redhat.com> - 2:4.1.5.1-21Tomas Mraz <tmraz@redhat.com> - 2:4.1.5.1-20Tomas Mraz <tmraz@redhat.com> - 2:4.1.5.1-19Tomas Mraz <tmraz@redhat.com> - 2:4.1.5.1-18Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2:4.1.5.1-17Tom Callaway <spot@fedoraproject.org> - 2:4.1.5.1-16Tomas Mraz <tmraz@redhat.com> - 2:4.1.5.1-15Tomas Mraz <tmraz@redhat.com> - 2:4.1.5.1-14Tomas Mraz <tmraz@redhat.com> - 2:4.1.5.1-13Tomas Mraz <tmraz@redhat.com> - 2:4.1.5.1-12Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2:4.1.5.1-11Tomas Mraz <tmraz@redhat.com> - 2:4.1.5.1-10Tomas Mraz <tmraz@redhat.com> - 2:4.1.5.1-9Tomas Mraz <tmraz@redhat.com> - 2:4.1.5.1-8Tomas Mraz <tmraz@redhat.com> - 2:4.1.5.1-7Tomas Mraz <tmraz@redhat.com> - 2:4.1.5.1-6Tomas Mraz <tmraz@redhat.com> - 2:4.1.5.1-5Tomas Mraz <tmraz@redhat.com> - 2:4.1.5.1-4Tomas Mraz <tmraz@redhat.com> - 2:4.1.5.1-3Tomas Mraz <tmraz@redhat.com> - 2:4.1.5.1-2Tomas Mraz <tmraz@redhat.com> - 2:4.1.5.1-1Peter Vrabec <pvrabec@redhat.com> - 2:4.1.5-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2:4.1.5-4Peter Vrabec <pvrabec@redhat.com> - 2:4.1.5-3Peter Vrabec <pvrabec@redhat.com> - 2:4.1.5-2Peter Vrabec <pvrabec@redhat.com> - 2:4.1.5-1Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.3-14Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2:4.1.4.3-13Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.3-12Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.3-11Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.3-10Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.3-9Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.3-8Miloslav Trmač <mitr@redhat.com> - 2:4.1.4.3-7Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.3-6Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.3-5Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.3-4Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.3-3Peter Vrabec <pvrabec@redh�x��������������P�������X9Ql�K����$��������������������17 bz#1773517 bz#1779036 bz#1782111 bz#1782175 bz#1783965]
- kvm-iotests-Test-handling-of-AioContexts-with-some-block.patch [bz#1745606 bz#1746217 bz#1773517 bz#1779036 bz#1782111 bz#1782175 bz#1783965]
- kvm-target-arm-monitor-query-cpu-model-expansion-crashed.patch [bz#1801320]
- kvm-docs-arm-cpu-features-Make-kvm-no-adjvtime-comment-c.patch [bz#1801320]
- Resolves: bz#1745606
  (Qemu hang when do incremental live backup in transaction mode without bitmap)
- Resolves: bz#1746217
  (Src qemu hang when do storage vm migration during guest installation)
- Resolves: bz#1773517
  (Src qemu hang when do storage vm migration with dataplane enable)
- Resolves: bz#1779036
  (Qemu coredump when do snapshot in transaction mode with one snapshot path not exist)
- Resolves: bz#1779078
  (RHVH 4.4: Failed to run VM on 4.3/4.4 engine (Exit message: the CPU is incompatible with host CPU: Host CPU does not provide required features: hle, rtm))
- Resolves: bz#1781637
  (qemu crashed when do mem and disk snapshot)
- Resolves: bz#1782111
  (Qemu hang when do full backup on multi-disks with one job's 'job-id' missed in transaction mode(data plane enable))
- Resolves: bz#1782175
  (Qemu core dump when add persistent bitmap(data plane enable))
- Resolves: bz#1783965
  (Qemu core dump when do backup with sync: bitmap and no bitmap provided)
- Resolves: bz#1787291
  (RHVH 4.4: Failed to run VM on 4.3/4.4 engine (Exit message: the CPU is incompatible with host CPU: Host CPU does not provide required features: hle, rtm) [rhel-8.1.0.z])
- Resolves: bz#1801320
  (aarch64: backport query-cpu-model-expansion and adjvtime document fixes)- kvm-ppc-Deassert-the-external-interrupt-pin-in-KVM-on-re.patch [bz#1776638]
- kvm-xics-Don-t-deassert-outputs.patch [bz#1776638]
- kvm-ppc-Don-t-use-CPUPPCState-irq_input_state-with-moder.patch [bz#1776638]
- kvm-trace-update-qemu-trace-stap-to-Python-3.patch [bz#1787395]
- kvm-redhat-Remove-redundant-fix-for-qemu-trace-stap.patch [bz#1787395]
- kvm-iscsi-Cap-block-count-from-GET-LBA-STATUS-CVE-2020-1.patch [bz#1794503]
- kvm-tpm-ppi-page-align-PPI-RAM.patch [bz#1787444]
- kvm-target-arm-kvm-trivial-Clean-up-header-documentation.patch [bz#1647366]
- kvm-target-arm-kvm64-kvm64-cpus-have-timer-registers.patch [bz#1647366]
- kvm-tests-arm-cpu-features-Check-feature-default-values.patch [bz#1647366]
- kvm-target-arm-kvm-Implement-virtual-time-adjustment.patch [bz#1647366]
- kvm-target-arm-cpu-Add-the-kvm-no-adjvtime-CPU-property.patch [bz#1647366]
- kvm-migration-Define-VMSTATE_INSTANCE_ID_ANY.patch [bz#1529231]
- kvm-migration-Change-SaveStateEntry.instance_id-into-uin.patch [bz#1529231]
- kvm-apic-Use-32bit-APIC-ID-for-migration-instance-ID.patch [bz#1529231]
- Resolves: bz#1529231
  ([q35] VM hangs after migration with 200 vCPUs)
- Resolves: bz#1647366
  (aarch64: Add support for the kvm-no-adjvtime ARM CPU feature)
- Resolves: bz#1776638
  (Guest failed to boot up after system_reset  20 times)
- Resolves: bz#1787395
  (qemu-trace-stap list : TypeError: startswith first arg must be bytes or a tuple of bytes, not str)
- Resolves: bz#1787444
  (Broken postcopy migration with vTPM device)
- Resolves: bz#1794503
  (CVE-2020-1711 qemu-kvm: QEMU: block: iscsi: OOB heap access via an unexpected response of iSCSI Server [rhel-av-8.2.0])- kvm-target-arm-arch_dump-Add-SVE-notes.patch [bz#1725084]
- kvm-vhost-Add-names-to-section-rounded-warning.patch [bz#1779041]
- kvm-vhost-Only-align-sections-for-vhost-user.patch [bz#1779041]
- kvm-vhost-coding-style-fix.patch [bz#1779041]
- kvm-virtio-fs-fix-MSI-X-nvectors-calculation.patch [bz#1694164]
- kvm-vhost-user-fs-remove-vhostfd-property.patch [bz#1694164]
- kvm-build-rename-CONFIG_LIBCAP-to-CONFIG_LIBCAP_NG.patch [bz#1694164]
- kvm-virtiofsd-Pull-in-upstream-headers.patch [bz#1694164]
- kvm-virtiofsd-Pull-in-kernel-s-fuse.h.patch [bz#1694164]
- kvm-virtiofsd-Add-auxiliary-.c-s.patch [bz#1694164]
- kvm-virtiofsd-Add-fuse_lowlevel.c.patch [bz#1694164]
- kvm-virtiofsd-Add-passthrough_ll.patch [bz#1694164]
- kvm-virtiofsd-Trim-down-imported-files.patch [bz#�x������������� @�������X:�l����������	8��$(����������������8�9�7��5f78554ee6e16445f9f62633fbc2c272175d81fde679c491810af16c4bed4b1e4e3d68598fc4b2a99ff2f10049aae810cad6827f9868c94e180324e0be234d5dc43e44f9289da9f0b30564cafd5f74fa1849ad651f14d56ec7458c20d0ca5f44e16ac3088cdfd0893e4ee7c8f9c8b7c1a34a72f1713afa7c2c345f36636851f93abd7ffd13d8eb0055954197c207b424b3dccd8988d3419cb1395f0512b8e116a7e30277d0fe3942bedad3eda040a80519425d32671eff7d5f9e09c1fbceff161259049882766e483aa7d13f7a7ed3178debfb6c0bb64d27ecfbb20af406376867399bc2d1b833ba433053f5593c335547bf115a7cefcb954d9350208a5e6f739406657d61d1feca156cf2723020b86128e50b45f0f0b49157f287b859155b4c0301b216b7ca015d03a5ecdf599a7581cececb6953bd46ca32f48b7cbe104afc837f0b875e41be6fb87675cdf5827166ede6b091c53d6403fe0de9e0e516748dc265f6e4645c01495ee2c679cb8361da6d8b4e08bed29558bb3c16be9d1f91e8f0fda0a3b6a77de8fc06916df36f95a4315a2d91787dccd8c21ed735613e08a37cac3f4c78b9836c945cf3523c35e79a0a4d6245c0d27b905cec79143efcce56f9e031a18c6d00208d0af5bc3b85577f9f7f9cee084b8439f6d236543421a170263abd0c6c5adfb9263cce6184252a5ad3a7bda56d6e934ccbb2a037f89037cb8a60f3eb87882934b3b3fd433f62a8ee10ab73fa1e9bd800fca7896959a5eb12bab808624446bf9fa1932a83da34edb69dc43aa96dba34851e4541f8fce0f02855117f6d460dd3e402fa98fbb7f134bc461dcf1004e963030f6d0748ff9bc34928a571e62bfec5ee664c101f68d11523dfc03e204aa02618c1158d8acd71e9f2dd037dff12127ec5eb27ac938b16a6f86ec95bff3705bd0febc9433ac3c4406bbc0d4012300a09c51916ad520c1fb0c26fd1d2b988c5b8ca28dd42ddc3b91f8dc628b69f9d2ab918d945bc24185ec8b4e9b66379683f343612186224e45f1d8963800916e58b3d5e7d17caee225d42d17a92ba86631eb75dff8d89920f68797aa1ae714405109f083e10d61b8daf1acace58e7b11daa80ac65039456b8898d7d1b20438d5c77db874bedde39c740bce167fbe071552eeed1754c0b97123d968c88d767c1e1087ef15fa819f08e1c39576f157bc98faaa1609ef491e6cb35b04f771b8ceffb01ce6af958b9fddaeea47e92bef6cc26259b669b8f9b7e22c54f0bb2eda60dd26a4ec1f724dd43315711e9f9cad6aa1ab34b144b46b468f278793a0a3979977f63f4951d9c9639910bfdb51df04af67a7d9c24a305a1277d1dd7da66dab9adaa2cb2dbeceef8b3e9b429a99cdd7dbc9b46f46faa93bf8ba2bc5517af45df16b805ca6965c7cd6fc1ad4e0a19d71490504044b3a4f54da64964ae3ba8068e84245a46f19b6605c2951069186b6866cf5d2bbf2035f6312f8035cf1bd2b747a53179a34152a2173b35d44b7534e2e7912bcb77efda3054de1e5fea96eca8cdd6c26f87e6306bb7f50a85e9f1b5ae7876809c38face6a235f444cd325fc68dc75284fa94a238a6b414734354c5ecef530598abac176c1f9149752e3df7f7aa4098082614e9d6f2237f0276f3634bc624c836bb95b192fdd125576967a47420ba4c53305ffe7b6bad4c39cef901736b610db6b0b568cd00ad25dd56b0147898d097bad2f9e0f39cebc649824915a6e585a5aee37ddf6c77ce9e6805dfb8769f629549da33d189d60f541b0c7362aed5ab6c4a7ea10d6a959538eba41a9db99eebc4925675a5f76cd38995165970fc51f200aa8bbd5aca605fa7919605db0dd47ad5ba9154ddf1ea9d07423e257a522208b437362f102bb1cb4cf4bc2a7a5400b83f40ec03c600e6a97021475600d74c3a37640f58601658ab514922b07f6ecd731af3fbb16ed61e2f5a1ee84e668e86f32fc1fb2aef8dde67a92fe69a7890c491b13dfa1adfad78d6b4fe39ef674c876c4bfba05e501fd65050a482fe9cda3045046e79d4a3b7e52625766b008649b3ef5c21253f41adc0aa5c8cfa295af7e7d51c98e814eb3e3f8d00faef2bf01cc552ca170bf213961ed611a01735c77a6f1193d5bf539ac58c582fcbeb9cf972a60d298bfaf41dc5adff2dd14208946edcb9bb56a281e843820678ab10402659106dc4c147c97b2a6e94b5c0695415e15a8f195ebc3547922../../../../usr/lib64/libSvtAv1Dec.so.0.8.7../../../../usr/lib64/libSvtAv1Enc.so.0.8.7libSvtAv1Dec.so.0.8.7libSvtAv1Enc.so.0.8.7�x��������������/�������X;,k���������x������I��$Y����������������I�J�RRMRRRR3RRMRRR3RRMR:RRRRRRERRFR2R3R9RRMRRRR,R2R3RRMRRR3RRMRRRRRRERRFR2R3RRMRRRR3RRMRRRRERRFR-R3RRMRRR3RRMRRR-R3RRMRRR2R3RRMRRR3RRMRRR2R3RRMRRR,R2R3RRMRRR3RRMRRR/R0R2R8R,R3R'R=RRMRRR/R-R?R$R3R'R=RRMRRRR2R3RRMRRRR-R3RRMRRRR2R8R3R'R=RRMRRR3RRMRRR3RRMRR2R3RRMRR:RRR3R9RRMRRR2R3RRMRRRR-R3RRMRRR8R3R'R=RRMRDRRRRCR!R3RRMRutf-89ea4beb36caae1225cf01a325e39b63fa3b0e5fd880067fd487cadac702a5094?����@�`t3�G�K���r>r�3a638478ad133648258bf80965b9ac01854cdac7d46e8eff0f21721aef68fa2ebd813919a1b469413b9d3a11b79258beb41d7c11i�����i���areWHENCE/usr/lib/firmware/intel/iwlwifi//usr/lib/firmware//usr/share/licenses//usr/share/licenses/iwl1000-firmware/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -march=z13 -mtune=z14 -fasynchronous-unwind-tables -fstack-clash-protectioncpioxz2noarch-redhat-linux-gnudirectoryASCII textUTF-8 Unicode textutf-8f9d4c2223d454a5d3cd98564a955222a7cebb2a97ab9e6183ce14471ddb1bb26?���0��3!�^���P,��*����%�iG�
	*����%����]\�U;>�-cF�XFm�T��d�X>&:Nq
������E�z-�Ý���*x��=�'�V��=��*�G���n�!��&i/3�J_�A0X7A��'���0+�X�Ǘ��hͦB`��٦F'�E-��'a�>"Y�_�PNH/9FQ��J�n(�:1��.N��nfV�(�����ss��޸W�r@duR�.�D�����l�
�a�)��
Pү��0S�HB�ȶ�	>�����-�|��Ň�Ru!E�8���W����ڽ�?��T`��Ȯ���b�����)]@�`��+���ѧ��R/Q��R��.����^Y�D���hw򭙰��`r�G�J����n�FHzׁ����Њ}ɍr�~� �73:x�Z�Z�2!�\Y_�2_�m��x,Wo�@�`a�T,ь��51�@B�z1�	I�:	�0�n���E�q@�0����z="-�����#�NôW�Qс��vV�5d�
\6Yyn�u�hdZ*ݩ����k� ��%)�y���‰��'D��3!�^���P,��*����%�iG�
	*����%�#p��PSC��_Cy�:5��}�(Uo�v`u&��N��sҍ�3lB]\���!����9�w���\V{��m��}�D0�W���1�ߥs�a$0�z�2�3����U���$U0M#�Iz��^�5���ٹ�LC,7`_V�1�+x��������(X�5���p}X1D�T���7GF�FQ
�!�~upi� �
�UM4n!�'��p��+�C.���(jƱ2~f�s�]��K�0�fA��9���uF�M�
:�f�f���/����t�����7C"=�) �%��@��<;�c&"*%8�h��pr'��:ru7bU�}��s���2��n���}�{�9�i
v̏몖N29,�/5�氆��@��]L��(©�O�X:hn�KK�������+PY����G#:�ͦɓ�|�T��Z�z+��wR)�y�]�>��sb��q�-��~�68�:�����XH����	���
з������ZC���3xk� řa����|d8bc84496cd264eab7771baca8df6069783902ab9b0513aadfc89170aa7dc007967f819bb2d43984cae440e2b079d2479bf2a68ei0�
�hi0�[;�/��`>[;�D�]>[;Y$ U[��볘dTW>[;�4V>[;B�`R>[;]��Q>[;�.4P>[;�9��M���i��L>[;�" �K������G>[;[ HF>[;~�yB>[;_�A>[;$.��@>[;j9|=����|{<>[;S!��;����t7>[;h!6>[;�}�>2>[;��71>[;�-��0>[;o8�w-���K��^,>[;� �+�����.'>[;�
3&>[;�r���">[;I�P!>[;�,|E >[;�7R����,�>[;i�����f�x1>[;x
�->[;�qx�>[;�p9>[;(+p>[;7p-
���ק��>[;t9������>[;
H3>[;�p<I>[;�3>[;�*ع�x������n
��������X.2l��������=
4�$$����������������435�at.com> 7.7-4Peter Hutterer <peter.hutterer@redhat.com> 7.7-2Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 7.7-2Peter Hutterer <peter.hutterer@redhat.com> 7.7-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 7.5-6Peter Hutterer <peter.hutterer@redhat.com> 7.5-5Peter Hutterer <peter.hutterer@redhat.com> 7.5-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 7.5-3Peter Hutterer <peter.hutterer@redhat.com> 7.5-2Peter Hutterer <peter.hutterer@redhat.com> 7.5-1Peter Hutterer <peter.hutterer@redhat.com> 7.4-9Adam Jackson <ajax@redhat.com> 7.4-8- Downgrade errors about unresolved keysyms to warnings (#1780463)- Suppress high-keycode warnings from xkbcomp- xkbcomp 1.4.2- Ignore maximum keycode range greater than 255 (#1587998)- Make -devel Require the base package, so the pc file will point to an
  xkbcomp that actually exists.- xkbcomp 1.4.1
- https URLs- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- xkbcomp 1.4.0 (#1463366)- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- s/define/global/- xkbcomp 1.3.1 (#1010592)- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- setxkbmap 1.3.1
- xkbevd 1.1.4
- xkbprint 1.0.4- Rebuilt for Fedora 23 Change
  https://fedoraproject.org/wiki/Changes/Harden_all_packages_with_position-independent_code- xkbcomp 1.3.0- Clean up SPEC file, build all components like other x11 packages.- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Apply the patch this time...- Add missing options to xkbcomp man page (#948842)- xkbutils 1.0.4- xkbcomp: Fix generation of XKB directory listing, missing reset on file
  handler caused parse errors and incomplete directory listings- Remove duplicate sources- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- X11R7.7 updates:
- xkbcomp 1.2.4
- setxkbmap 1.3.0
- xkbevd 1.1.3- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- xkbcomp 1.2.3- xkbcomp 1.2.1- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- xkbprint-1.0.3- setxkbmap 1.2.0
- xkbcomp 1.2.0
- xkbutils 1.0.3
- xkbevd 1.1.1- xkbcomp-hex-parsing.patch: fix up parsing of hex-code symbols (#638244)- xkbcomp-speed.patch: Backport performance changes from git master.	1.3.11.4.27.7-28.el87.7-28.el8setxkbmapxkbcomp.build-id086bfb065c2f01e8688a635b8a458b20021dacfc763f4be4f7a73e3a56ceb96bcb81cc774974ba76setxkbmap.1.gzxkbcomp.1.gz/usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/08//usr/lib/.build-id/76//usr/share/man/man1/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnuELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=763f4be4f7a73e3a56ceb96bcb81cc774974ba76, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=086bfb065c2f01e8688a635b8a458b20021dacfc, strippeddirectorytroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)�x�����8h������(�������X�l�������� -������~��$n����������������~�}�L�`i0�e GH Action (RHEL-1087)
- fstab-generator: allow overriding /etc/fstab with $SYSTEMD_FSTAB (RHEL-1087)
- fstab-generator: allow overriding path to /sysroot/etc/fstab too (RHEL-1087)
- test: backport TEST-81-GENERATORS (fstab-generator only) (RHEL-1087)
- resolved: actually check authenticated flag of SOA transaction (RHEL-6213)- login: add a missing error check for session_set_leader() (#2158167)
- logind: reset session leader if we know for a fact that it is gone (#2158167)
- test-login: skip consistency checks when logind is not active (#2223582)
- sd-event: remove dead code and use _cleanup_ (#2211358)
- sd-event: don't destroy inotify data structures from inotify event handler (#2211358)
- sd-event: add sd_event_add_inotify_fd() call (#2211358)
- test: add test case for self-destroy inotify handler (#2211358)
- doc: add downstream CONTRIBUTING document (#2179309)
- doc: use link with prefilled Jira issue (#2179309)
- docs: link downstream CONTRIBUTING in README (#2179309)
- unit drop-in: Fix ordering of special type.d drop-ins (#2156620)
- Add failing test to show service.d global drop-in does not get overridden by more specific dropins (#2156620)
- test: set indentation to 4 spaces (#2156620)
- test/TEST-15: remove all created unit files (#2156620)
- test: use quotes where necessary (#2156620)
- tree-wide: drop manually-crafted message for missing variables (#2156620)
- manager: reformat boolean expression in unit_is_pristine() (#2156620)
- manager: allow transient units to have drop-ins (#2156620)
- TEST-15: allow helper functions to accept other unit types (#2156620)
- TEST-15: also test hierarchical drop-ins for slices (#2156620)
- TEST-15: add test for transient units with drop-ins (#2156620)
- TEST-15: add one more test for drop-in precedence (#2156620)
- udev/net_id: introduce naming scheme for RHEL-8.9 (#2231846)
- meson: remove libdw dependency from pstore (#2211416)
- pstore: introduce tmpfiles.d/systemd-pstore.conf (#2211416)
- tmpfiles: don't �LAS9
Xeu )?�-����`!v�=	
+2t#�/usr/lib/.build-id/67/ L@��!(�&�+i����K[z�F��G���P` �<�06G	ip��/usr/lib/.build-id/66/��
�!'��%�
"guz����,����4���;�7/usr/lib/.build-id/65/ib/�L?a�`	��	9	�	RSX�!���
02�/usr/lib/.build-id/64/���!&Q�$Q�����
)G�  	)6G�		P�:0Z�i/usr/lib/.build-id/63//�r�!<���CX���Q�9�p�	/usr/lib/.build-id/62/�L>
2�Gu�)������`�R�/usr/lib/.build-id/61/����#>	�����
X�E����	��8<g"��
i/usr/lib/.build-id/60//�L=��!%R ��0X�+���K��	��70uv/usr/lib/.build-id/5f/�x���������������������X>�l��8Bc��$s����������������c�d�b��grade
- change UID/GID_MIN to #1000
- fix find_new_uid/gid for big UID/GID_MAX- useradd man page (-m option)
- create home directory on fs with noacl
- remove faillog app (pam_tally.so is no longer shipped)
  Resolves: #523265, #622320- do not use  gshadow functions from glibc, there is a bug
  in glibc sgetsgent(#674361)
  Resolves: #674234- fix gshadow functions from shadow utils
- make shadow utils use gshadow functions from glibc
  Resolves: #665780- fix pwck/grpck hang
  Resolves: #586322- fix integer underflow in faillog (#603683)
- use preferred GID for reserved static IDs- preserve ACL's on files in /etc/skel
  Resolves: #513055- newusers man page more informative
- userdel should not need to run semanage
  Resolves: #586330 #586408- fix man directories ownership (#569418)- max group name length set to 32 characters- apply patches{1,2,3}
- enable SHA512 in /etc/login.defs- upgrade- rebuilt with new audit- increase threshold for uid/gid reservations to 200 (#515667)- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- fix a list of owned directories (#510366)- reduce the reuse of system IDs- speed up sys users look up on LDAP boxes (#511813)- upgrade- upgrade- lastlog fix- upgrade- get "-n" option back
- fix selinux issues- upgrade- don not allow UID/GID = 4294967295 (#484040)- fix license tag (#226416)
- get rid of tabs in spec file (#226416)
- convert HOWTO to UTF8 (#226416)- Add policycoreutils as Requires, because of restorecon (#478494)- Add setup as a Requires. Perhaps this should be a files requires. (#477529)- groupmems: check username for valid character (#455603)
- groupmems: don't segfault on nonexistent group (#456088)- fix usermod SELinux user mappings change (#458766)- audit improvements, thnx. to sgrubb@redhat.com- fix groupmems issues (#459825)- fix configure options (#456748)- recreate selinux patch- provide getspnam by man-pages- upgrade- fix salt size problem (#447136)- upgrade- improve newgrp audit patch- fix selinux labeling  (#433757)- fix groupmems segmentation fault (#430813)- fix newgrp audit event- new upgrade release from new upstream
- provide vipw and vigr- do not create mail spool entries for system accounts (#402351)- fix timestamps when moving home dirs to another file system (#278571)- mark localized man pages with %lang- rebuild- fix "CAVEATS" section of groupadd man page (#245590)- fix infinitive loop if there are duplicate entries
  in /etc/group (#240915)- do not run find_new_uid() twice and use getpwuid() to check
  UID uniqueness (#236871)- fix useradd dump core when build without WITH_SELINUX (#235641)- create user's mailbox file by default (#231311)- assign system dynamic UID/GID from the top of available UID/GID (#190523)- spec file fixes to meet fedora standarts.
- fix useless call of restorecon(). (#222159)- fix append option in usermod (#222540).- Fix execution and creation of Home Directories under SELinux
- Resolves: rhbz#217441- fix rpmlint issues- use MD5 encryption by default (#218629).- Fix SELinux context on home directories created with useradd (#217441)- fix chpasswd and chgpasswd stack overflow (#213052)- fix "-g" and "-G" option.- improve audit logging (#211659)
- improve "-l" option. Do not reset faillog if it's used (#213450).- upgrade- add dist-tag- fix regression. Permissions on user* group* binaries
  should be 0750, because of CAPP/LSPP certification
- fix groupdel man page- fix bug introduced with UIG_GID.patch (#201991)- fix userdel, it didn't delete user's group (#201379)- fix UID/GID overflow in user* group* (#198920)- do not inherit file desc. in execve(nscd)- upgrade- rebuild- call "nscd -i" to flush nscd cache (#191464)- "useradd -r" must create a system group (#194728)- upgrade
- do not replace login.defs file (#190014)- fix typo in shadow-4.0.15-login.defs (#188263)- properly notify nscd to flush its cache(#186803)- upgrade- fix lrename() function to handle relative symlinks too- set default umask to 077 in login.defs- use lre�x�������������x������X?�l��������Xs���������$;�����������������������a@cpanel.net> - 8.1.28-2Cory McIntire <cory@cpanel.net> - 8.1.28-1Brian Mendoza <brian.mendoza@cpanel.net> - 8.1.27-2Travis Holloway <t.holloway@cpanel.net> - 8.1.27-1Sergey Fokin <sfokin@cloiudlinux.com> - 1:8.1.26-3.cloudlinux.1Travis Holloway <t.holloway@cpanel.net> - 8.1.26-4Tim Mullin <tim@cpanel.net> - 8.1.26-3Julian Brown <julian.brown@cpanel.net> - 8.1.26-2Cory McIntire <cory@cpanel.net> - 8.1.26-1Cory McIntire <cory@cpanel.net> - 8.1.25-1Cory McIntire <cory@cpanel.net> - 8.1.24-1Cory McIntire <cory@cpanel.net> - 8.1.23-1Cory McIntire <cory@cpanel.net> - 8.1.22-1Cory McIntire <cory@cpanel.net> - 8.1.21-1Cory McIntire <cory@cpanel.net> - 8.1.20-1Travis Holloway <t.holloway@cpanel.net> - 8.1.19-5Julian Brown <julian.brown@cpanel.net> - 8.1.19-4Julian Brown <julian.brown@cpanel.net> - 8.1.19-3Brian Mendoza <brian.mendoza@cpanel.net> - 8.1.19-2Cory McIntire <cory@cpanel.net> - 8.1.19-1Julian Brown <julian.brown@cpanel.net> - 8.1.18-2Cory McIntire <cory@cpanel.net> - 8.1.18-1Cory McIntire <cory@cpanel.net> - 8.1.17-1Cory McIntire <cory@cpanel.net> - 8.1.16-1Cory McIntire <cory@cpanel.net> - 8.1.15-1Tim Mullin <tim@cpanel.net> - 8.1.14-2Cory McIntire <cory@cpanel.net> - 8.1.14-1Cory McIntire <cory@cpanel.net> - 8.1.13-1Travis Holloway <t.holloway@cpanel.net> - 8.1.12-2Cory McIntire <cory@cpanel.net> - 8.1.12-1Cory McIntire <cory@cpanel.net> - 8.1.11-1Julian Brown <julian.brown@cpanel.net> - 8.1.10-3Dan Muey <dan@cpanel.net> - 8.1.10-2Cory McIntire <cory@cpanel.net> - 8.1.10-1Cory McIntire <cory@cpanel.net> - 8.1.9-1Cory McIntire <cory@cpanel.net> - 8.1.8-1Cory McIntire <cory@cpanel.net> - 8.1.7-1Cory McIntire <cory@cpanel.net> - 8.1.6-1Cory McIntire <cory@cpanel.net> - 8.1.5-1Cory McIntire <cory@cpanel.net> - 8.1.4-1Travis Holloway <t.holloway@cpanel.net> - 8.1.3-2Cory McIntire <cory@cpanel.net> - 8.1.3-1Tim Mullin <tim@cpanel.net> - 8.1.2-1Julian Brown <julian.brown@cpanel.net> - 8.1.1-4Dan Muey <dan@cpanel.net> - 8.1.1-3Julian Brown <julian.brown@cpanel.net> - 8.1.1-2Cory McIntire <cory@cpanel.net> - 8.1.1-1Julian Brown <julian.brown@webpros.com> - 8.1.0-1Julian Brown <julian.brown@webpros.com> - 8.1.0rc6-1Cory McIntire <julian.brown@webpros.com> - 8.1.0beta3-1- EA4D-797: revert to use system libxml2 lib for all platforms- Update php-fpm patch to v4 for per-domain resource isolation support- EA4D-789: Update ea-php81 from v8.1.33 to v8.1.34
- Fixed CVE-2025-14177
- Fixed CVE-2025-14178: integer overflow in array_merge
- Fixed CVE-2025-14180
- EA4D-793: Update php-fpm LVE patch- EA4D-773: Rebuild ea-php81 on rhel>=9 with system libxml2 as cPanel- EA4D-746: Update php-fpm lve patch to extract doc_root from php_admin_values
  for CageFS per-domain isolation- EA4D-731: Fix for ea-libxml2 2.15+- rebuild with new ea-libicu and ea-libxml2- EA4-122: map u24 libodbc for PHP extension- rebuild with ea-libtidy 5.8- EA-13001: Update ea-php81 from v8.1.32 to v8.1.33
	- Fixed GHSA-hrwm-9436-5mv3 (pgsql extension does not check for errors during escaping). (CVE-2025-1735)
	- Fixed GHSA-453j-q27h-5p8x (NULL Pointer Dereference in PHP SOAP Extension via Large XML Namespace Prefix). (CVE-2025-6491)
	- Fixed GHSA-3cr5-j632-f35r (Null byte termination in hostnames). (CVE-2025-1220)- Security fixes
- CVE-2024-11235: use-after-free for ??= due to incorrect live-range
  calculation- EA-12766: Update ea-php81 from v8.1.31 to v8.1.32
    - Fixed GHSA-hgf54-96fm-v528 (Stream HTTP wrapper header check might omit basic auth header). (CVE-2025-1736)
    - Fixed GHSA-52jp-hrpf-2jff (Stream HTTP wrapper truncate redirect location to 1024 bytes). (CVE-2025-1861)
    - Fixed GHSA-pcmh-g36c-qc44 (Streams HTTP wrapper does not fail for headers without colon). (CVE-2025-1734)
    - Fixed GHSA-v8xr-gpvj-cx9g (Header parser of `http` stream wrapper does not handle folded headers). (CVE-2025-1217)
    - Fixed GHSA-p3x9-6h7p-cgfc (libxml streams use wrong `content-type` header when requesting a redirected resource). (CVE-2025-1219)
    - Fixed GHSA-rwp7-7vc6-8477 (Refere�x���������������������X@km���������������*�$�����������������*�*�qRwwt4ZevV2/4a2nnTAT/DvT28+vdLCwn/8NgjQM7o3or
2jKNuirXAA2xihL3drS4MQ8K7JTcWIzLAAY+SLthoflrmhnx4X+2ztggyfR6y9qp
zNlG7j8Nb8o3AxKcIVe/7B37HPznX0YF0LXziMchkGT3oiydvXqfbSOTWjGLpu3A
1Jf3S71vID/9x4oYTFHNejVveDVyXW+0muzlgle7xBG+zHQbjSPuyarcxQARAQAB
tC5jUGFuZWwgUHVibGljIFJQTSBLZXkgPGRldmVsb3BtZW50QGNwYW5lbC5uZXQ+
iQJPBBMBAgA5AhsDBgsJCAcDAgYVCAIJCgsEFgIDAQIeAQIXgBYhBH+2mgYvM08l
EMzf/iN4tZV+kxx8BQJdSDlEAAoJECN4tZV+kxx8q8UQALrlSuVwukXCg4MYAjHA
TrYCZYnzGc79+3WNCQi3uqUo3IX9OFqNn3il83sVbcC6EDkiFx/CP4FIYuxGdBvk
z7dC5VrKyBkwFrwj4JpavDVVF9Z2ydznj5YDZUxTMHGm1WHLZ83m/vqGsuO8kL9q
nnie7S2HO+w4xtW+i/s5omQxQyHOpE5I2818W/7Op79nU06UJ4glibzGI51sIDT8
E/yDsFxBF2cQVNhomp/JB1SdBIYfBZ/Vl5EVquvQXr7ZVDCTetsavrpLdcFApmAE
k2TPEVHJWYAYa4nRpfpaAFWp5VCwo6+AbARY/upZ40ig24nifrFAqfjSBMzRBQq0
6TQbEke2uU7bk0Elt5DTF2GyAmsQfDUt9n7PlYYjZGDInAUz39YT6l9futAJrtyG
RnO4fps5Ia9Sd+nYT5jRWTaJWryr0HYkgrzLCZK2VgViu7k4iRp4HRjRmhZYYStK
v9hSDlamP+JwbeSRMrhtK4Ru704Tjq5cX8LWx/q4VZwi+XcMhqoV1ayQ6Dt2Dd2q
HjXjVNMOXlk8pS0sdJaWhyoZm4SLIY9cQEI2ocbsvqW1T/T4MVdghUd+pPJ7ZGKD
2ZNxJYw5FnCiOEJdpWFu9YK59EtsWP2st59PrMJyEqC3AhWB+Qcumc4wcSGdzycG
5d7Nny9H8fddEUzncvqJjBruiQIcBBABAgAGBQJVw8SOAAoJEEzyecXAQkkH7LIP
/iZ9hDpH2VKbVHgNk0p4kPfHHxtmq1fLMIY7mgPo2y6rL9lCOLBjzxWqgynxqvLM
KzFboY0ARuf8FcPcdA9zARVuSxa3T1AAlxqLc5yYKYucLGbaHGRC8ezDgfVvBkJi
OeSA5pklGWtICkA6WcmesyU/8pIBj2r2Bky6md7oYd2H8mH32vK4JyxAR2xtstXX
St9mNr6eTTTxYwKf0T85fW8DmNv1IoNYEJ4J7dN5XmwQrpspE5Meq1Ir5MZyNkGk
I93Yv8vsreH/B4cCUo6pGhH5Lmthy8eugkyPDYxJ7+lJCFV+yf95DE+WEiDkVwh7
JQSYiJK+kx9rhgkiI1P8tasJBY1A5IE/07HkvJTZgJLm9m/+0NbM9dw575dqMJZv
T2lc/mEboN8aWaWJcfw7lVaoQyR2o+E6mlDeFE+l8dT1dAjEC+ZM8kEZvCbeY0uY
mwU+8AIMXiO8tDtzSAxfgrseXbmM1JxQilk3jrPXN8tpXmQNgypm7gRmcgterOjd
VI4aV2l5H9IxUiit28lqVItHEPGovuTPnqOK/JxBId0aN4a2cprBBLJmvZCD8VkC
c/gTRbeYWH8ybDfeOiyZI27y1BH18DXYJza3XjA7zh2owXVPc686EFH/xdG9bfbT
PrYABn/dmzCX3F3toynZgWrYcmk5Xe9hlPy84C2llXxYiQI+BBMBAgAoBQJVw8Ik
AhsDBQkFo5qABgsJCAcDAgYVCAIJCgsEFgIDAQIeAQIXgAAKCRAjeLWVfpMcfOZq
D/9hVsWVvrildxv59E8uOWfDUMNgjiv8nrJwhm8kvii1G4fJDRyv6MiZ4pgl5F5p
eqA94sBzaPPi53/MSeYcDykK3ya83gfHyY/UK8lkMmNGYiYpog+TeXZqUlmUb8zl
AR7bFj+3bHboBzL3zUL4D44WyPoKAsqpyaotII1pW3/lPdDLuuYmSJ0AMtUL4vRJ
8rWk2gO2JVHMKrozEyIFbuaQSxvnTI1iT9ujHWLu+jqmszqgRJq6rM01mjavlPs8
Loe234nGpZ8rgTkM5Nfe82ZPDKE5a34b2DroxOnDnaxehTV26bikrdrLWSi+Uvmu
GqaogvkgkEItl/ohNQr7WXbGgMupS7OtH3CUnP0PaHXdefVlNFIpUF5L+tG3cj/m
ygzGS7BbIH4UU75BLPu2u8tE2NEz+Cj3uLjYQJPfxJX4lyLyCiOFvw7ln6+79lG4
c1bYPVtEueGi9ABFC0fEwcE9x6WQYAVja36rLLb4ZRrq9X/CbR7lqhAntJZlQW46
iK+pGtMQmgS1gmW8AHDj+jrdSulcui07/X6HAWuzI87ujtUTxLuEoUVruYGwxOfn
Wjicd/vlfQ+1Cmzak8pYbP248bZmjc5QboK09KNvCqcvTt4R8pp5ZvwWUq80cSgj
Zpel2trCOJK6UcKtpsG9/4ucTORCOXlKEV3WU/+ZACZ5YQ==
=/Rkf
-----END PGP PUBLIC KEY BLOCK-----
]H9DlocalhostpubkeycPanel Public RPM Key <development@cpanel.net>Public Keys(none)gpg(cPanel Public RPM Key <development@cpanel.net>)gpg(7e931c7c)4.14.34:2378b5957e931c7c-5d4839444:2378b5957e931c7c-5d483944?����ea9f9bf6a2eb1a4235455ef6fdc31a354d6d5ad1i0C/i0C/kc@redhat.com> 2.29-10Nick Clifton  <nickc@redhat.com> 2.29-8Nick Clifton  <nickc@redhat.com> - 2.29-7Fedora Release Engineering <releng@fedoraproject.org> - 2.29-6Nick Clifton  <nickc@redhat.com> 2.29-5Florian Weimer <fweimer@redhat.com> - 2.29-4Nick Clifton  <nickc@redhat.com> 2.29-3Fedora Release Engineering <releng@fedoraproject.org> - 2.29-2Nick Clifton  <nickc@redhat.com> 2.29-1Nick Clifton  <nickc@redhat.com> 2.28-14Nick Clifton  <nickc@redhat.com> 2.28-13Nick Clifton  <nickc@redhat.com> 2.28-12Nick Clifton  <nickc@redhat.com> 2.28-11Nick Clifton  <nickc@redhat.com> 2.28-10Nick Clifton  <nickc@redhat.com> 2.28-9Nick Clifton  <nickc@redhat.com> 2.28-8Nick Clifton  <nickc@redhat.com> 2.28-7Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.28-6Nick Clifton  <nickc@redhat.com> 2.28-5Nick Clifton  <nickc@redhat.com> 2.28-4Mark Wielaard  <mjw@redhat.com> 2.28-3Nick Clifton  <nickc@redhat.com> 2.28-2Nick Clifton  <nickc@redhat.com> 2.28-1Nick Clifton  <nickc@redhat.com> 2.27-19Nick Clifton  <nickc@redhat.com> 2.27-18Fedora Release Engineeri�x������L	�������XO�k �0��$�����������������?�?d����	(�	h���������	�����(	2
<P�
����$��y(�8�	9�	:p	G�H�I�X�Y�\]0^mb	d
be
gf
jl
lt
�u
�v
��
��
��
��(,
<e����g�h�Ccpanel-perl-542-json4.101.cp130~el8CPAN module - JSON (JavaScript Object Notation) encoder/decoderCpanel build perl module 'JSON'JSON (JavaScript Object Notation) encoder/decoderh˔bh-centos-8.dev.cpanel.net�8perlcpanel/perlhttps://metacpan.orglinuxnoarch�6���
���$�$�$�$�$cB6cB
�cB`��`��86f851a65df164dea8e2f70e75debb874fcdc173e4554c320ada633e15a37eac96c6c352fc718655cd8703b2b9741542d197a12c66f4ace6b0d9ddf0f1fef90d30fc45ae8ded5a92ec29a55060a7f1a563d0e646e162c9426f25e5008be6ca5aa10bd121547b115e89abe41fa1aedf7c7c2158defe6fd1c9be4c7ed2e2db756ecd14837d0806cd92957387503a0ba08cc6585b2c3cf7f4cde3fa70eb4e08202drootrootrootrootrootrootrootrootrootrootcpanel-perl-542-json-4.10-1.cp130~el8.src.rpm��������������������cpanel-perl(JSON)cpanel-perl(JSON::Backend::PP)cpanel-perl-542-jsoncpanel-perl-542-json-backend-ppcpanel-perl-jsoncpanel-perl-json-backend-pp




cpanel-perl-542cpanel-perl-542-test-morerpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h�@b��@b�@`-@]��@[�-�Y��S>��Q+R@Todd Rinaldo <toddr@cpan.org> - 4.10-1.cp130Todd Rinaldo <toddr@cpan.org> - 4.07-1.cp108Busy Camels <bc@cpanel.net> - 4.02-1.cp108Busy Camels <bc@cpanel.net> - 4.02-1.cp1198Todd Rinaldo <toddr@cpanel.net> - 4.02-1.cp1186Todd Rinaldo <toddr@cpanel.net> - 2.97001-1.cp1178Todd Rinaldo <toddr@cpanel.net> - 2.94-1.cp1170Todd Rinaldo <toddr@cpanel.net> - 2.90-1.cp1146Todd Rinaldo <toddr@cpanel.net> - 2.53-1.cp1136- Update from upstream: JSON 4.10- Update from upstream: JSON 4.07- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: JSON 4.02- Update from upstream: JSON 2.97001- Update from upstream: JSON 2.94- Update from upstream: JSON 2.90- Update from upstream: JSON 2.534.104.104.10-1.cp130~el84.104.104.10JSON.pmbackportPP.pmBoolean.pmCompat5005.pmCompat5006.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/JSON//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/JSON/backportPP/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-807f6ae016a996db691a75c44c196604e046a0344c047e1fc7babdbd1250a412a?�����t]�3�2s����	���e294360f8f94ded7d4ac741fe4d43f24faf85580b4c09de2225ed07115afb69195e6e3bfbfe207fd9bcb2974a342dc76c98a112di?�s�Li?�sF 'page ready' event delivery (Vitaly Kuznetso�x��������������������XBm�������4c��$s����������������c�b�d����S�
@S��@S��S��S���SwO@Sn�Sh�Sg}@Sg}@Sg}@S`�SRe@SRe@SM@S2�@S,)�S)��S L@S�S�S��S�@R�@R�y@R��@R�3@R�3@R۾@Koichiro Iwao <meta@almalinux.org> - 23.1.4-4.alma.1Dave Airlie <airlied@redhat.com> - 23.1.4-4José Expósito <jexposit@redhat.com> - 23.1.4-3José Expósito <jexposit@redhat.com> - 23.1.4-2Dave Airlie <airlied@redhat.com> - 23.1.4-1Dave Airlie <airlied@redhat.com> - 23.1.0-1Dave Airlie <airlied@redhat.com> - 22.3.0-2Dave Airlie <airlied@redhat.com> - 22.3.0-1Dave Airlie <airlied@redhat.com> - 22.3.0-0.4Dave Airlie <airlied@redhat.com> - 22.3.0-0.3Dave Airlie <airlied@redhat.com> - 22.3.0-0.2Dave Airlie <airlied@redhat.com> - 22.3.0-0.1Dave Airlie <airlied@redhat.com> - 22.1.5-1Dave Airlie <airlied@redhat.com> - 22.1.1-1Dave Airlie <airlied@redhat.com> - 21.3.4-1Dave Airlie <airlied@redhat.com> - 21.3.0-1Dave Airlie <airlied@redhat.com> - 21.1.5-1Dave Airlie <airlied@redhat.com> - 21.1.3-1Dave Airlie <airlied@redhat.com> - 21.1.1-2Dave Airlie <airlied@redhat.com> - 21.1.1-1Dave Airlie <airlied@redhat.com> - 20.3.3-1Dave Airlie <airlied@redhat.com> - 20.3.2-1Dave Airlie <airlied@redhat.com> - 20.3.1-1Dave Airlie <airlied@redhat.com> - 20.3.0-2Dave Airlie <airlied@redhat.com> - 20.3.0-1Dave Airlie <airlied@redhat.com> - 20.3.0-0.1.rc2Dave Airlie <airlied@redhat.com> - 20.1.4-1Dave Airlie <airlied@redhat.com> - 20.1.2-3Dave Airlie <airlied@redhat.com> - 20.1.2-2Dave Airlie <airlied@redhat.com> - 20.1.2-1Dave Airlie <airlied@redhat.com> - 20.1.1-1Dave Airlie <airlied@redhat.com> - 20.1.0-1Dave Airlie <airlied@redhat.com> - 20.1.0-0.1.rc4Dave Airlie <airlied@redhat.com> - 19.3.4-2Dave Airlie <airlied@redhat.com> - 19.3.4-1Dave Airlie <airlied@redhat.com> - 19.3.3-1Dave Airlie <airlied@redhat.com> - 19.3.0-3Dave Airlie <airlied@redhat.com> - 19.3.0-2Dave Airlie <airlied@redhat.com> - 19.3.0-1Dave Airlie <airlied@redhat.com> - 19.1.4-2Dave Airlie <airlied@redhat.com> - 19.1.4-1Dave Airlie <airlied@redhat.com> - 19.1.0-0.5Dave Airlie <airlied@redhat.com> - 19.1.0-0.4Dave Airlie <airlied@redhat.com> - 19.1.0-0.3Dave Airlie <airlied@redhat.com> - 19.1.0-0.2Dave Airlie <airlied@redhat.com> - 19.1.0-0.1Dave Airlie <airlied@redhat.com> - 18.3.1-5Dave Airlie <airlied@redhat.com> - 18.3.1-4Dave Airlie <airlied@redhat.com> - 18.3.1-3Dave Airlie <airlied@redhat.com> - 18.3.1-2Dave Airlie <airlied@redhat.com> - 18.3.1-1Tom Stellard <tstellar@redhat.com>Adam Jackson <ajax@redhat.com> - 18.3.0-0.2Adam Jackson <ajax@redhat.com> - 18.2.2-1Adam Jackson <ajax@redhat.com> - 18.2.1-1Adam Jackson <ajax@redhat.com> - 18.2.0-2Dave Airlie <airlied@redhat.com> - 18.2.0-1Ray Strode <rstrode@redhat.com> - 18.1.3-4Tom Stellard <tstellar@redhat.com> - 18.1.3-3Dave Airlie <airlied@redhat.com> - 18.1.3-2Adam Jackson <ajax@redhat.com> - 18.1.3-1Adam Jackson <ajax@redhat.com> - 18.1.2-2Adam Jackson <ajax@redhat.com> - 18.1.2-1Adam Jackson <ajax@redhat.com> - 18.0.5-1Adam Jackson <ajax@redhat.com> - 18.0.3-1Dave Airlie <airlied@redhat.com> - 18.0.2-2Adam Jackson <ajax@redhat.com> - 18.0.2-1Tom Stellard <tstellar@redhat.com> - 17.3.6-2Adam Jackson <ajax@redhat.com> - 17.3.6-1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 17.3.5-2Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 17.3.5-1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 17.3.4-1Peter Robinson <pbrobinson@fedoraproject.org> 17.3.3-1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 17.3.1-1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 17.3.0-0.4.rc3Peter Robinson <pbrobinson@fedoraproject.org> 17.3.0-0.3.rc3Peter Robinson <pbrobinson@fedoraproject.org> 17.3.0-0.1.rc2Peter Robinson <pbrobinson@fedoraproject.org> 17.2.4-1Tom Stellard <tstellar@redhat.com> - 17.2.3-2Gwyn Ciesla <limburgher@gmail.com> - 17.2.3-1Peter Robinson <pbrobinson@fedoraproject.org> - 17.2.2-4Dave Airlie <airlied@redhat.com> - 17.2.2-3Adam Jackson <ajax@redhat.com> - 17.2.2-2Peter Robinson <pbrobinson@fedoraproject.org> 17.2.2-1Peter Robinson <pbrobinson@fedoraproject.org> 17.2.1-1Peter Robi�x�������������X��������XC�l��������8�
���$<���������������������E6X?4�d����0�	4�	r���������������	����",4	8
<D�
����d�\(�8�F9�F:[FG1�H1�I1�X1�Y1�\2]2 ^24b2�d3�e3�f3�l3�t3�u4v4�4��4��4��4�555_5{_
5�6�6D6H6Lg6Ph6TCea-php81-php-snmp8.1.341.el8.cloudlinux.2A module for PHP applications that query SNMP-managed devicesThe ea-php81-php-snmp package contains a dynamic shared object that will add
support for querying SNMP devices to PHP.  PHP is an HTML-embeddable
scripting language. If you need SNMP support for PHP applications, you
will need to install this package and the php package.iɀCbuild.cloudlinux.comU	CloudLinuxCloudLinuxPHPCloudLinux Packaging Team <packager@cloudlinux.com>Development/Languageshttp://www.php.net/linuxx86_641T؁���iɀ-iɀ1d2dbdf6a2ebecd2e3ef204d62bab8b7072105a40cdb75081ceb1a3ce59b844dbcb3ceb91b7e62d0a66fd35e57e3614bb8d4afc213670e3eb040ce511d7c38f6frootrootrootrootea-php81-php-8.1.34-1.el8.cloudlinux.2.src.rpm��������config(ea-php81-php-snmp)ea-php81-php-snmpea-php81-php-snmp(x86-64)@@@@@@@@@



@config(ea-php81-php-snmp)ea-php81-php-cli(x86-64)ea-php81-php-common(x86-64)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcrypto.so.1.1()(64bit)libm.so.6()(64bit)libnetsnmp.so.35()(64bit)libssl.so.1.1()(64bit)net-snmprpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)1:8.1.34-1.el8.cloudlinux.21:8.1.34-1.el8.cloudlinux.21:8.1.34-1.el8.cloudlinux.23.0.4-14.6.0-14.0-15.2-14.14.3i�q@i���i�5�i���iy�@iM'@i_�h�h@h��hfp�h4W�g��g}@g? �g�@f�L�f�X@f�o@f�K�fa��f�f"@e�	@e���e��e�4@ehy@ee�@e`�@e;�@e��d��d˖�d��@d��du�@df@dd��dcp@d^*@d>�@d9@@d�c��@c�@c��@c���c\�cr-�c[�@c5��c5��c1�@c��b�b��b��b|��bX�b3"�b\@b�@a�@aՈ@a�@a���a�{�a��a��a��@Sergey Fokin <sfokin@cloudlinux.com> - 8.1.34-1.cloudlinux.2Razmik Manvelyan <rmanvelyan@cloudlinux.com> - 1:8.1.34-1.cloudlinux.1Levon Matshkalyan <lmatshkalyan@cloudlinux.com> - 1:8.1.34-1.cloudlinuxRazmik Manvelyan <rmanvelyan@cloudlinux.com> - 1:8.1.33-2.cloudlinux.4Arseniy Zolotarev <azolotarev@cloudlinux.com> - 1:8.1.33-2.cloudlinux.3Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 1:8.1.33-2.cloudlinux.2Sergey Fokin <sfokin@cloiudlinux.com> - 1:8.1.33-2.cloudlinux.1Dan Muey <daniel.muey@webpros.com> - 8.1.33-2Sergey Fokin <sfokin@cloiudlinux.com> - 1:8.1.33-1.cloudlinux.2Cory McIntire <cory.mcintire@webpros.com> - 8.1.33-1Dmitrii Samoilov <dsamoilov@cloudlinux.com> - 8.1.32-1.cloudlinux.1Cory McIntire <cory.mcintire@webpros.com> - 8.1.32-1Dan Muey <daniel.muey@webpros.com> - 8.1.31-2Cory McIntire <cory@cpanel.net> - 8.1.31-1Julian Brown <julian.brown@cpanel.net> - 8.1.30-2Cory McIntire <cory@cpanel.net> - 8.1.30-1Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 8.1.29-3.cloudlinux.1Dan Muey <dan@cpanel.net> - 8.1.29-3Julian Brown <julian.brown@cpanel.net> - 8.1.29-2Cory McIntire <cory@cpanel.net> - 8.1.29-1Brian Mendoza <brian.mendoz�x�����x�
p��������X=�l(9�������c�4�$z�����������������4�4�4�ebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- when "prepend_user_name" is used, the user name is now added to the helper's
  command line after arguments that were specified in the helper "exec"
  attribute
- resync with Fedora packaging- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- tweak initialization so that we set up for providing our D-Bus APIs before we
  register our names with the bus, so that we can handle any requests that
  arrive before the acknowledgement of that registration, which should make
  system activation a viable option- fix a crasher in pam_oddjob_mkhomedir.so: remove an initialization step that
  should have been removed when the module was modified to accept larger
  replies (#1236970)- build fixes- open a connection to the bus for every service we're serving, instead of
  using just one for the lot of them, so that we can tell which service a
  client was attempting to contact if it sends a message to our unique
  connection address instead of a well-known name, like dbus-python does
- tweak the logic for guessing which interface name is right when a request
  doesn't include one, so that it has a better chance of finding the right one
- increase the initial size of the buffer that we pass to getpwnam_r in the
  pam_oddjob_mkhomedir module (#1198812)- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- make that last change dependent on which release we're building for- Update dbus-send dependency for new dbus (#1170584)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- catch calls to the method invocation helper function that mistakenly
  didn't include the newly-required timeout value (#1089655,#1089656)- stop overriding the system-wide UMASK default in our default
  oddjobd-mkhomedir.conf file (#995097)- add a -t flag to oddjob_request to allow its timeout to be
  customized (#1085491)- explicitly require "dbus" at the package level (#1085450)- add man(5) pages for the configuration files that we include which get
  included by others, just to be tidy (#884552)- add an [Install] section containing WantedBy=sysinit.target to the systemd
  unit file (#963722), allowing it to actually be "enabled"- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- use %systemd_postun_with_restart instead of plain old %systemd_postun,
  because we can be restarted in the %postun- use newer systemd macros (#857375)- add that dependency to the right subpackage- add missing requires(post) on killall, which we use to poke the message
  bus daemon to get it to reload its configuration, spotted by rcritten- refer to $local_fs instead of $localfs in the init script (#802719)
- install a systemd unit file instead of an init script on still-in-development
  releases (#820137,818963)
- build binaries position-independent and marked for earliest-possible symbol
  resolution (#852800)
- don't worry about moving things from /usr to / when they're the same (#852800)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- also tell the system message bus to reload its configuration when we install
  a subpackage with a new service in it- make the init script exit with status 2 when given an unknown command, rather
  than with status 1 (#674534)- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- require dbus-x11 so that the tests can use dbus-launch
- try to read the default umask from /etc/login.defs (more of #666418)- when the mkhomedir helper has to create intermediate directories, don't
  apply a umask that might have been supplied on its command line (#666418)- rebuild with new libxml2- Rebuilt for gcc bug 634757- try to SIGHUP the messagebus daemon at first install so that it'll
  let us claim our service name if it isn't restarted be�x�����(}�������X7�k��������ؿA��$Q����������������A�@�B��e)
- Add function for getting information about disk(s) (vpodzime)
- Do not set nonsense partition paths (vpodzime)
- Add function for getting partition by position (vpodzime)
- Indicate if there was error from parted or not in set_parted_error() (vpodzime)
- Minor fixes for the bd_part_get_part_spec() function (vpodzime)
- Add support for extra GPT flags (vpodzime)
- Add functionality for partition types (GUIDs) (vpodzime)
- Add functionality for partition names (vpodzime)
- Do not destroy disk objects we didn't get (vpodzime)
- Add a function for setting multiple partition flags at once (vpodzime)
- Remove the unused definition USE_PYTHON3 from configure.ac (vpodzime)
- Use different BTRFS_MIN_MEMBER_SIZE on aarch64 (vpodzime)
- Better release memory from parted objects on failures (vpodzime)
- Rework how we do optimal alignment (vpodzime)
- Do not try to destroy object we didn't get (vpodzime)
- Don't pass sizes in bytes to LVM (#1317373) (vpodzime)
- Add the libbytesize-devel build requires (vpodzime)
- Search for the LVM DBus service in both active and activatable names (vpodzime)
- Adapt to another stupid change in btrfs-progs (vpodzime)
- Add the XFS-related functions to the documentation (vpodzime)
- Add tests for the XFS-related functions (vpodzime)
- Add support for the XFS file system to the FS plugin (vpodzime)
- Add chunk_size to BDMDExamineData (vtrefny)
- Add the subpackage for the FS plugin (vpodzime)
- Add the FS plugin to the docs (vpodzime)
- Add tests for the ext4 functionality in the fs plugin (vpodzime)
- Add the FS plugin and the ext4 support (vpodzime)
- Add a function for running utility reporting error and exit code (vpodzime)
- Add the subpackage for the part plugin (vpodzime)
- Add a missing BuildRequires for parted-devel (vpodzime)
- Tag as both libblockdev-$version and just $version (vpodzime)
- Add the 'part' plugin to documentation (vpodzime)
- Add tests for the newly added part plugin (vpodzime)
- Add the part plugin with storaged-required functionality (vpodzime)- Merge pull request #72 from vpodzime/master-faster_tests (vpodzime)
- Ignore all .bak files (vpodzime)
- Use python3-pylint and skip Python 2 tests (vpodzime)
- Try a bit harder when deactivating MD arrays in tests (vpodzime)
- Recompile only the LVM plugin in tests (vpodzime)
- Merge pull request #65 from vpodzime/master-loc_indep_error (vpodzime)
- Merge pull request #70 from vojtechtrefny/master-chunk_size (vpodzime)
- Add bd_md_create_with_chunk_size() function (vtrefny)
- Merge pull request #68 from vpodzime/master-no_intro_data (vpodzime)
- Merge pull request #71 from vpodzime/master-ipython3 (vpodzime)
- Run coverage with the right config directories (vpodzime)
- Merge pull request #67 from phatina/master (vpodzime)
- Merge pull request #69 from vpodzime/master-lvm_dbus_autostart (vpodzime)
- Use ipython3 for debugging and testing sessions (vpodzime)
- Don't expect to always get introspection data from DBus (vpodzime)
- Make invocation of tests configurable (phatina)
- Make error messages locale agnostic (vpodzime)- Search for the LVM DBus service in activatable names (vpodzime)
- Better check for the LVM DBus API (vpodzime)- Do not try to get object path of NULL in vgreduce (vpodzime)- Depend on python3-gobject-base not python3-gobject so as to not pull in X components- Add/fix the requirement for the LVM DBus daemon- Merge pull request #62 from vpodzime/master-clean_up (vpodzime)
- Use addCleanup() instead of tearDown() in tests (vpodzime)
- Merge pull request #58 from vpodzime/master-lvm_dbus_pr (vpodzime)
- Add the VG renaming functionality (vpodzime)
- Packaging of the lvm-dbus plugin (vpodzime)
- The LVM DBus plugin (vpodzime)
- Add more generic functions for logging (vpodzime)
- Use MAX(a, b) instead of CLAMP(b, a, b) (vpodzime)
- Merge pull request #59 from vpodzime/master-vgrename (vpodzime)
- Add a function for renaming VGs (vpodzime)
- Merge pull request #57 from clumens/master (vpodzime)
- Fix error reporting when running "make test". (clumens)
- Merge pull request #54 from voj�x��������������y�������XFm �
ؿe��$u����������������e�d�f��ject.org> 11.2.0-0.devel.6.5e3edd4Igor Gnatenko <i.gnatenko.brain@gmail.com> - 11.2.0-0.devel.5.5e3edd4Adam Jackson <ajax@redhat.com>Igor Gnatenko <i.gnatenko.brain@gmail.com> - 11.2.0-0.devel.3.70d8dbcIgor Gnatenko <i.gnatenko.brain@gmail.com> - 11.2.0-0.devel.2.56aff6bIgor Gnatenko <i.gnatenko.brain@gmail.com> - 11.2.0-0.devel.1.86fc97dIgor Gnatenko <i.gnatenko.brain@gmail.com> - 11.1.0-0.devel.13.5ae37aeAdam Jackson <ajax@redhat.com> 11.1.0-0.devel.12.3994ef5Igor Gnatenko <i.gnatenko.brain@gmail.com> - 11.1.0-0.devel.11.3994ef5Igor Gnatenko <i.gnatenko.brain@gmail.com> - 11.1.0-0.devel.10.7182498Igor Gnatenko <i.gnatenko.brain@gmail.com> - 11.1.0-0.devel.9.4a168adIgor Gnatenko <i.gnatenko.brain@gmail.com> - 11.1.0-0.devel.8.4a168adIgor Gnatenko <i.gnatenko.brain@gmail.com> - 11.1.0-0.devel.7.47d1199Igor Gnatenko <i.gnatenko.brain@gmail.com> - 11.1.0-0.devel.6.9932142Igor Gnatenko <i.gnatenko.brain@gmail.com> - 11.1.0-0.devel.5.47e18a5Igor Gnatenko <i.gnatenko.brain@gmail.com> - 11.1.0-0.devel.4.d6fbcf6Rex Dieter <rdieter@fedoraproject.org> - 11.1.0-0.devel.3.60aea30Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 11.1.0-0.devel.2.60aea30Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 11.1.0-0.devel.1.4e5752eIgor Gnatenko <ignatenkobrain@fedoraproject.org> - 11.0.0-0.devel.2.21ccdbdIgor Gnatenko <ignatenkobrain@fedoraproject.org> - 11.0.0-0.devel.1.6f2d889Peter Robinson <pbrobinson@fedoraproject.org> 10.7.0-0.devel.4.ea633dbIgor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.7.0-0.devel.3.ea633dbIgor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.7.0-0.devel.2.8787141Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.7.0-0.devel.1.8787141Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 10.6.0-0.devel.7.5a55f68.1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.6.0-0.devel.7.5a55f68Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.6.0-0.devel.6.5a55f68Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.6.0-0.devel.5.51e3453Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.6.0-0.devel.4.c1485f4Adam Jackson <ajax@redhat.com> 10.6.0-0.devel.3Rob Clark <rclark@redhat.com - 10.6.0-0.devel.2.f80af89Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.6.0-0.devel.1.f80af89Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.5.0-1.20150218Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.5.0-0.devel.32.6171131Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.5.0-0.devel.31.c3260f8Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.5.0-0.devel.30.290553bIgor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.5.0-0.devel.28.b77eaafIgor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.5.0-0.devel.26.c633528Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.5.0-0.devel.25.a6f6d61Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.5.0-0.devel.23.be0311cIgor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.5.0-0.devel.21.609c3e5Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.5.0-0.devel.19.3ba57baIgor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.5.0-0.devel.17.64dcb2bIgor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.5.0-0.devel.15.6c18279Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.5.0-0.devel.13.0c7f895Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 10.5.0-0.devel.11.cb5a372Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.5.0-0.devel.10.git0d7f4c8Dan Horák <dan[at]danny.cz> 10.5.0-0.devel.9Adam Jackson <ajax@redhat.com> 10.5.0-0.devel.8Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.5.0-0.devel.7.git0d7f4c8Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.5.0-0.devel.6.git0d7f4c8Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.5.0-0.devel.5.git29c7cf2Adam Jackson <ajax@redhat.com> 10.5.0-0.devel.4Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.5.0-0.devel.3.git29c7cf2Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.5.0-0.devel.2.git3d9c1a9Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.5.0-0.devel.1.git9460cd3Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.4-0.devel.8.gitf3b709c10�x�������������8i�������XGm����������D�$�����������������D�D�m�������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������cpanel-geoipfree-data




/bin/shcpanel-perl-cpanel-core-dependenciesrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3i�|�i9`�h¹�h}@h>�g��g\!�g\!�f�)@fl0�fl0�e�8@es@d��d�@d�c�c��c*�b��b��b+9�a�A@aU��`�P@`F�`��_�@_~�@_C��_X@^��@]�@]�@]rJ@]]2@\�Q�\�Y@\
`�[�@Z�2@Travis Holloway <travis.holloway@webpros.com> - 130.4-1.cp130~el8Travis Holloway <travis.holloway@webpros.com> - 130.3-1.cp130Travis Holloway <travis.holloway@webpros.com> - 130.2-1.cp130David Lanning <david.lanning@webpros.com> - 130.1-1.cp130Michael Salinas <michael.salinas@webpros.com> - 130.0-1.cp130Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 128.1-1.cp128Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 128.0-1.cp128Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 126.0-2.cp126Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 126.0-1.cp126Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 124.0-1.cp124Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 122.0-2.cp122Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 122.0-1.cp122Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 120.0-1.cp120Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 118.0-1.cp118Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 116.0-1.cp116Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 114.0-1.cp114Stephen Bee <stephen.bee@webpros.com> - 112.0-2.cp112Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 112.0-1.cp112Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 110.0-1.cp110Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 108.0-1.cp108Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 106.0-2.cp11106Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 106.0-1.cp11106Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 104.0-1.cp11104Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 102.0-1.cp11102Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 100.0-1.cp11100Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 98.0-1.cp1198Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 96.0-2.cp1196Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 96.0-1.cp1196Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 94.0-1.cp1194Tim Mullin <tim@cpanel.net> - 92.0-2.cp1192Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 92.0-1.cp1192Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 90.0-1.cp1190Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 88.0-1.cp1188Todd Rinaldo <toddr@cpanel.net> - 86.0-2.cp1186Todd Rinaldo <toddr@cpanel.net> - 86.0-1.cp1186J. Nick Koston <nick@cpanel.net> - 84.0-2.cp1184Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 84.0-1.cp1184Nicolas Rochelemag�x�������������PX�������X(�kh�h�$U�����������������h�h�h�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootpytz-2017.2-11.el8.src.rpm����������������������������������������������������������������������������������������������������������������������������python3-pytzpython3.6dist(pytz)python3dist(pytz)@




python(abi)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PartialHardlinkSets)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)tzdata3.63.0.4-14.6.0-14.0.4-14.0-15.2-14.14.3d��@d��@[,�[W�Z�@Z�@Z}�@Y˒�Y�(@Yy�Yl��X���XO�XJ��XF�@X!�@W��@W�@W9�@Wc�V�=@V8��V.�U��@U���S�P@SsZ�Q�B@Q�P�r�PS@P6@P
��On@MR��LH2�L(��K��Kf�@JlE@I��@I1.�I"�@I�Is�G~�E}H@EyS�E	�C�t�C�g@C��@B��B�v@Lumír Balhar <lbalhar@redhat.com> - 2017.2-11Lumír Balhar <lbalhar@redhat.com> - 2017.2-10Charalampos Stratakis <cstratak@redhat.com> - 2017.2-9Miro Hrončok <mhroncok@redhat.com> - 2017.2-8Matěj Cepl <mcepl@redhat.com> - 2017.2-7Matěj Cepl <mcepl@redhat.com> - 2017.2-6Fedora Release Engineering <releng@fedoraproject.org> - 2017.2-5Troy Dawson <tdawson@redhat.com> - 2017.2-4Zbigniew Jędrzejewski-Szmek <zbyszek@in.waw.pl> - 2017.2-3Fedora Release Engineering <releng@fedoraproject.org> - 2017.2-2Petr Šabata <contyk@redhat.com> - 2017.2-1Fedora Release Engineering <releng@fedoraproject.org> - 2016.10-4Charalampos Stratakis <cstratak@redhat.com> - 2016.10-3Charalampos Stratakis <cstratak@redhat.com> - 2016.10-2Orion Poplawski <orion@cora.nwra.com> - 2016.10-1Orion Poplawski <orion@cora.nwra.com> - 2016.7-1Matěj Cepl <mcepl@redhat.com> - 2016.6.1-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2016.4-3Orion Poplawski <orion@cora.nwra.com> 2016.4-1Matěj Cepl <mcepl@redhat.com> 2016.4-1Fedora Release Engineering <releng@fedoraproject.org> - 2015.7-3Robert Kuska <rkuska@redhat.com> - 2015.7-2Orion Poplawski <orion@cora.nwra.com> - 2015.7-1Orion Poplawski <orion@cora.nwra.com> - 2015.4-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2012d-8Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2012d-7Bohuslav Kabrda <bkabrda@redhat.com> - 2012d-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2012d-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2012d-4David Malcolm <dmalcolm@redhat.com> - 2012d-3Jon Ciesla <limburgher@gmail.com> - 2012d-2Jon Ciesla <limburgher@gmail.com> - 2012d-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2010h-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2010h-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2010h-4David Malcolm <dmalcolm@redhat.com> - 2010h-3Toshio Kuratomi <toshio@fedoraproject.org> - 2010h-2Jon Ciesla <limb@jcomserv.net> - 2010h-1Jon Ciesla <limb@jcomserv.net> - 2009i-7Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2008i-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2008i-5Ignacio Vazquez-Abrams <ivazqueznet+rpm@gmail.com> - 2008i-4Jef Spaleta <jspaleta at fedoraproject dot org> 2008i-3Jef Spaleta <jspaleta at fedoraproject dot org> 2008i-2Jef Spaleta <jspaleta at fedoraproject dot org> 2008i-1Jef Spaleta <jspaleta@gmail.com> 2006p-3Jef Spaleta <jspaleta@gmail.com> 2006p-2Orion Poplawski <orion@cora.nwra.com> 2006p-1Orion Poplawski <orion@cora.nwra.com> 2006g-1Orion Poplawski <orion@cora.nwra.com> 2005r-2Orion Poplawski <orion@cora.nwra.com> 2005r-1Orion Poplawski <orion@cora.nwra.com> 2005m-1Orion Poplawski <orion@cora.nwra.com> 2005i-2Orion Poplawski <orion@cora.nwra.com> 2005i-1- Bump to add gating
Related: RHEL-677- Fix FTBFS with newest tzdata
Resolves: RHEL-677- Conditionalize the python2 subpackage- Fix ambiguous shebangs- Switch __python for __python2 macro.- remove test_tzinfo.PicklingTest.testRoundtrip which fails with our
  system-wide timezone database (#1497572)- Rebuilt for https:�x������9�������G�������XE�l��������������a��$q����������������a�`�b��install/downgrade/upgrade
- Resolves: rhbz#1612752 - platform-python should be used in completion_helper
- Resolves: rhbz#1618421 - dnf module install fails to find non-modular dependencies
- Bug 1629655 - not helpful/complete error message when specifying wrong stream or profile
- Bug 1629709 - disabled modules should be identified in the module listing
- Bug 1630761 - [usability] unable to determine if a stream with [d] is enabled or not
- Bug 1625270 - there is ???% [=== when baseurl is wrong
- Resolves: rhbz#1624056 - quoted baseurl is error out- [module] Fixed list and info subcommands (RhBug:1623388) (RhBug:1623535)- New implementation of modularity
- dnf makecache should not fail in red color if no enabled repos (RhBug:1622090)
- [modularity] dnf module profile command doesn't work (RhBug:1622580)
- [modularity] incorrect output in dnf module list (RhBug:1623398)
- [modularity] dnf could be smarter when installing what's already installed (RhBug:1622599)
- [modularity] dnf module install circular error on missing dependency (RhBug:1620233)
- not descriptive output in dnf verbose (RhBug:1612718)
- RFE: provide way to query all packages from module (RhBug:1569068)- [history] Fix 'attempt to write a readonly database' error in addConsoleOutputLine().
- [spec] Improve YUM v3 compat layer.
- [doc] document missing link from yum-rhn-plugin to dnf-plugin-spacewalk (RhBug:1580356)
- [doc] document difference between yum and dnf when listing packages (RhBug:1615834)
- [doc] document missing download functionality after transaction table is displayed (RhBug:1585140)
- [systemd] dnf-makecache.timer: move the ordering after network to .service
- [translations] Update translations from zanata.
- [cli] Fix 'already installed' message output.
- [module] change 'module_nsvp' to 'module_spec'
- [module] show module profiles without ', ...'
- [module] unify usability of RepoModuleDict.get_info*(); fix traceback
- [security] fix update count (RhBug:1585138)
- [cli] enable reposync to use --destdir (RhBug:1582152)
- [repo] Replace dnf.repo.Repo with libdnf implementation.
- [dnf] Limit DeprecationWarning to dnf.* modules only.- [misc] Fallback to os.getuid() if /proc/self/loginuid can't be read (RhBug:1597005)
- [translations] Update translations from zanata.
- [doc] Update module documentation.
- [module] Fix `module provides` output.
- [module] Add `module reset` command.
- [module] Fix module disable command
- [repo] Improve error message on broken repo (RhBug:1595796)
- [doc] Enhance a command documentation (RhBug:1361617)
- [module] Automatically save module persistor in do_transaction().
- [drpm] Fixed setting deltarpm_percentage=0 to switch drpm off
- [repo] Split base.download_packages into two functions
- [output] Use libdnf wrapper for smartcols
- [conf] Do not traceback on empty option (RhBug:1613577)- [sack] Use module_platform_id option.
- [module] Switch module persistor to libdnf implementation.
- [module] Auto-enable module streams based on installed RPMs.
- [transaction] Fix: show packages from the current transaction.
- [conf] Convert any VectorString type to list.
- [module] Replace 'enabled' config option with 'state'.
- [install_specs] Do not exclude groups' packages
- [module] Use module sack filtering from libdnf
- [module] Many UX fixes.- [module] Move 'hotfixes' conf option to libdnf and rename it to 'module_hotfixes'.
- [goal] Exclude @System repo packages from distro_sync.
- [conf] Setup configuration values using C++ bindings.
- [module] Drop module lock command.
- [crypto] Use handle from repo in dnf.crypto.retrieve().
- [module] Assume a 'default' profile exists for all modules (RhBug:1568165)
- [base] Introduce easy installation of package, group and module specs.- [transaction] Fix 'TransactionItem not found for key' error.
- [module] Allow removing module profile without specifying a stream.
- [module] Fix 'BaseCli' object has no attribute '_yumdb' error.
- [callback] Fix TransactionDisplay.PKG_ERASE redirect to a non-existing constant.
- [spec] Change yum compat packa�x�������������@7�������X	8�k���������L������ҧ�����$B����������������ҧѧӧ� Novy <jnovy@redhat.com> - 1.13.3-4Jindrich Novy <jnovy@redhat.com> - 1.13.3-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.13.3-2Tomas Bzatek <tbzatek@redhat.com> - 1.13.3-1Nils Philippsen <nils@redhat.com> - 1.13.2-2Tomas Bzatek <tbzatek@redhat.com> - 1.13.2-1Tomas Bzatek <tbzatek@redhat.com> - 1.13.1-1Tomas Bzatek <tbzatek@redhat.com> - 1.13.0-1Tomas Bzatek <tbzatek@redhat.com> - 1.12.2-1Kalev Lember <kalevlember@gmail.com> - 1.12.1-3Kalev Lember <kalevlember@gmail.com> - 1.12.1-2Tomas Bzatek <tbzatek@redhat.com> - 1.12.1-1Peter Robinson <pbrobinson@fedoraproject.org> - 1.12.0-2Tomas Bzatek <tbzatek@redhat.com> - 1.12.0-1Tomas Bzatek <tbzatek@redhat.com> - 1.11.5-1Tomas Bzatek <tbzatek@redhat.com> - 1.11.4-1Tomas Bzatek <tbzatek@redhat.com> - 1.11.3-1Tomas Bzatek <tbzatek@redhat.com> - 1.11.3-0.4.20120120Tomas Bzatek <tbzatek@redhat.com> - 1.11.3-0.3.20120120Tomas Bzatek <tbzatek@redhat.com> - 1.11.3-0.2.20120120Matthias Clasen <mclasen@redhat.com> - 1.11.3-0.1.20120120-1Tomas Bzatek <tbzatek@redhat.com> - 1.11.2-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.11.1-2Matthias Clasen <mclasen@redhat.com> - 1.11.1-1Tomas Bzatek <tbzatek@redhat.com> - 1.11.0-5Adrian Reber <adrian@lisas.de> - 1.11.0-4Adam Jackson <ajax@redhat.com> 1.11.0-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.11.0-2Tomas Bzatek <tbzatek@redhat.com> - 1.11.0-1Tomas Bzatek <tbzatek@redhat.com> - 1.10.1-1Ray <rstrode@redhat.com> - 1.10.0-1Matthias Clasen <mclasen@redhat.com> - 1.9.5-1Tomas Bzatek <tbzatek@redhat.com> - 1.9.4-1Matthias Clasen <mclasen@redhat.com> - 1.9.3-1Tomas Bzatek <tbzatek@redhat.com> - 1.9.2-1Tomas Bzatek <tbzatek@redhat.com> - 1.9.1-1Tomas Bzatek <tbzatek@redhat.com> - 1.9.0-1Christopher Aillon <caillon@redhat.com> - 1.8.1-2Tomas Bzatek <tbzatek@redhat.com> - 1.8.1-1Tomas Bzatek <tbzatek@redhat.com> - 1.8.0-3Tomas Bzatek <tbzatek@redhat.com> - 1.8.0-2Matthias Clasen <mclasen@redhat.com> - 1.8.0-1Matthias Clasen <mclasen@redhat.com> - 1.7.3-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.7.2-2Tomas Bzatek <tbzatek@redhat.com> - 1.7.2-1Bastien Nocera <bnocera@redhat.com> 1.7.1-1Tomas Bzatek <tbzatek@redhat.com> - 1.7.0-1Matthias Clasen <mclasen@redhat.com> - 1.6.5-1Tomas Bzatek <tbzatek@redhat.com> - 1.6.4-4Tomas Bzatek <tbzatek@redhat.com> - 1.6.4-3Tomas Bzatek <tbzatek@redhat.com> - 1.6.4-2Matthias Clasen <mclasen@redhat.com> - 1.6.4-1Tomas Bzatek <tbzatek@redhat.com> - 1.6.3-3Dan Horák <dan[at]danny.cz> - 1.6.3-2Matthias Clasen <mclasen@redhat.com> - 1.6.3-1Tomas Bzatek <tbzatek@redhat.com> - 1.6.2-1Tomas Bzatek <tbzatek@redhat.com> - 1.6.1-3Tomas Bzatek <tbzatek@redhat.com> - 1.6.1-2Tomas Bzatek <tbzatek@redhat.com> - 1.6.1-1Matthias Clasen <mclasen@redhat.com> - 1.6.0-2Tomas Bzatek <tbzatek@redhat.com> - 1.6.0-1Bastien Nocera <bnocera@redhat.com> 1.5.5-3Peter Robinson <pbrobinson@gmail.com> 1.5.5-2Tomas Bzatek <tbzatek@redhat.com> - 1.5.5-1Matthias Clasen <mclasen@redhat.com> - 1.5.4-2Matthias Clasen <mclasen@redhat.com> - 1.5.4-1Tomas Bzatek <tbzatek@redhat.com> - 1.5.3-2Tomas Bzatek <tbzatek@redhat.com> - 1.5.3-1Tomas Bzatek <tbzatek@redhat.com> - 1.5.2-5Tomas Bzatek <tbzatek@redhat.com> - 1.5.2-4Tomas Bzatek <tbzatek@redhat.com> - 1.5.2-3Matthias Clasen <mclasen@redhat.com> - 1.5.2-2Tomas Bzatek <tbzatek@redhat.com> - 1.5.2-1Adrian Reber <adrian@lisas.de> - 1.5.1-6Tomas Bzatek <tbzatek@redhat.com> - 1.5.1-5Tomas Bzatek <tbzatek@redhat.com> - 1.5.1-4Tomas Bzatek <tbzatek@redhat.com> - 1.5.1-3Tomas Bzatek <tbzatek@redhat.com> - 1.5.1-2Tomas Bzatek <tbzatek@redhat.com> - 1.5.1-1Matthias Clasen <mclasen@redhat.com> 1.4.1-6Bastien Nocera <bnocera@redhat.com> 1.4.1-5Tomas Bzatek <tbzatek@redhat.com> - 1.4.1-4Tomas Bzatek <tbzatek@redhat.com> - 1.4.1-3Tomas Bzatek <tbzatek@redhat.com> - 1.4.1-2Tomas Bzatek <tbzatek@redhat.com> - 1.4.1-1Tomas Bzatek <tbzatek@redhat.com> - 1.4.0-7Bastien Nocera <bnocera@redhat.com> 1.4.0-6Tomas Bzatek <tbzatek@redh�x�������������'�������XK�l���������d��$t����������������d�e�c�� processing defaults properly (#1369979)- new upstream release fixing low impact security issue- guard for localtime() and gmtime() failure- chpasswd, chgpasswd: open audit when starting- chgpasswd: do not remove it
- chpasswd, chgpasswd: add selinux_check_access call (#1336902)- userdel: fix userdel -f with /etc/subuid present (#1316168)- usermod: properly return error during password manipulation- add possibility to clear or set lastlog record for user via lastlog- do not use obscure permissions for binaries
- remove unused commands from login.defs(5) cross-reference- document that groupmems is not setuid root
- document that expiration of the password after inactivity period
  locks the user account completely- unlock also passwords locked with passwd -l
- prevent breaking user entry by entering a password containing colon
- fix possible DoS when locking the database files for update
- properly use login.defs from the chroot in useradd- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- new upstream release with support for subordinate uids and gids- small adjustments to the audit patch- update auditing to cover more events and fix some incorrect audit
  records - patch by Steve Grubb (#1151580)
- apply the same new allocation algorithm to uids as for gids- discard obsolete matchpathcon cache after semanage_commit()- disallow all-numeric user and group names (#1139318)- label the newly created home dir correctly (#1077809)
- mention that chage -d 0 forces password change (#1135010)
- improve date parsing and error detecting in chage
- avoid full group database scanning in newgrp in most common case
- report error if usermod asked for moving homedir and it does not exist- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- fix license handling- revert the last change as it is not really needed- put system users and groups into /usr/lib/{passwd,group} if
  the files exist and SHADOW_USE_USRLIB environment variable is set
  Patch by Colin Walters- ignore getgrgid() errors for now- improve group allocation algorithm - patch by Stephen Gallager (#1089738)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- clean up login.defs manpage
- properly document userdel -f behavior- document that the directory where user's home is created must exist- slightly more meaningful error messages if crypt() returns NULL (#988184)
- explicit suid permissions- fix useradd man page bugs- report error to stdout when SELinux context for home directory
  cannot be determined (#973647)
- audit the changing home directory owner (#885797)
- do not set the default SELinux MLS range (#852676)- improve the failure syslog message in useradd (#830617)- keep the original context if matchpathcon() fails (#912399)- fix bugs in merge_group_entries()- /etc/default is owned by glibc-common now (#894194)- new upstream version
- use the original file permissions when creating backup (#853102)- make /etc/default/useradd world-readable (#835137)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- pwconv/grpconv skipped 2nd of consecutive failures (#832995)- fix selinux context handling
- reset selinux context on files copied from skel- upgrade- compile with PIE and RELRO flags (#784349)- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- fix leaks in .IDs patch (#734340)- free memory associated with SELinux security contexts- replace semanage call by library call
- useradd man page (#739147)- man page adjustment (userdel -Z)- fixing semanage issue (#701355)- Make sure /etc/login.defs is not changed on upgrades from Fedora 1[345].- man page fixes (#696213 #674878)- userdel option to remove Linux login <-> SELinux login mapping (#639900)
- useradd special exit value if SELinux user mapping is invalid (#639975)
- usermod special exit value if SELinux user mapping is invalid (#639976)- refer to PAM in /etc/login.defs (#629277)- fix shadow-4.1.4.2-underflow.patch- fix integer underflow in laslog (#706321)- up�x���������������������XL�l�������:(n�$8����������������(n�-'n�431ad7355e4f129cad81f63db9527ba0d16ddfb5847ab1c2c6cb3e08b0293e92830d6698baa6cc35f7af47078456eab2a9ac5808ee72f367f837e14efb38e628f127fe62a2e2cbacfe477b90bfc162e3918d386b04129e736ac7cc2921254128ee3df1519278de173ca3d931b68968ac7e484914f1d758ca38a90f063fdedf86ce10dcd6da5fc6e248891c4b206133b5b5882ac643fa5c2e3ad52ddd496684e7c55a2aedab27a78119312ddafc3491685c59f99ab0c67c9decc1739a404a8a94c48c4a112d772b8060604fa461ae3bbef0ba1e533e07411f40d383efc0ed0b0b11f194073ae4eb9c46aa0e035f244da352dca451229d67ea73c24b7917b1fa0d536a207cfda60c07f5ed0b885e606fd031875932ea7c40e106126d81b17435a4b3d433368b823ffbecb813fdd4e164eb87ecabd61e073a1be4f6c5c59c3a003c76193a31616ca463c42cd319fde6d1f6850259b2bf856866c9a1e77ed990930640d410ced457006fc53351827936ec06375849e116b52a8347eb8540c6458ac028d6fe8b23403a5a629ff76d1d8cdbd17425560825790ee436908b61d51d998ab326592c90903772f055eb977fbaa48921266e9817c4985b4376e73621c699ae935f89a7a55b4a28b6245f2961330ecee3e2e231a5570cb43cbc833460d455c5011a49bdd9431626de3b0a9e1753186d68e9d8fccd0a3a8f023e99228f009536c61c8562e14321d0ba58c947541c538e7a2d179010312d0535dbdc53a9a1367ca006f0122e5680a607412c6e7543bed2d88b4da39f5f6f8b10b9cbd625ecf9c13baf0726c815c02e584034c8dce6a23c179539893da6fef334364362d2cbfd569bb6a4f9695e88b73a210590785105ec1d2b670f1bca5f5a6b236afdaaeee2ec4775cabdf44f5795af8971833a20da79ee70f96714d7d2e5bbe9aca6cb9bb60d400cedd1301009ad4e6d60b4ab2cea9bbd1aa15d9e81aff52ad5997cca6dc6a6e5d435769556eb9778882ebe8acb2a12b0c868d147e831dce5de18a58ee19312c009ec08a90c7568a14404a7a80a088a99d1e28df292734e7ef7d1af075a66996c61f0e9ea9db5875c6ea4b5ab0f78fbacebf83dee817f2496b52400c371cf9754cea50b75c3ae5a3df7ef4a4e59f734b4760f1a1ed46eefdfc4ce43e403f997adc7016df07c7c973f12788a761bc629e5bf1dc1d17020cda3951aa7c367fb27df75812b1061a2730e9ff54d3052be571347984140c26b2bf42e96a7cad8c9c89e0702c8f912cede2536caf8b686a9334e354cdb24ea352bffd99ab05cb1d4448364f260cc43ffb7f723350dfeb48c64c83ef5d18b2c827646304f369a521272841cae392b5cfb70d7a8ebfbde19ba916ec005a38cadacb144d62af7500d99803ea387c9287f2c547c66e3396256b5efdac5574c10c1b730b99a45c9677c25df39b1cbbf43e42b61b764f6be23b8e875064ed5d9bff831c123c5b20ce129a8f45d015fb243cee92741d8b54aa2aee8c0b091af181ce98d414e2aa071787e224c7db04d21ae192b169facd6511b422b8c5a8f3776b6795cce77292eef20f04ca3c8a536692b5f0960bd7b8ba09db971d4770cf3cc54477cb4be629dc19005107fb754c9214098acd9af4b6fd894709f533bb60d853d4f1399082fd9e88de94b982d1ff6848c50b4aa35bc5cca1f63c6e73a09ad7e88183f231256dc215a775356f0d9e6577192d2a7090e51a746dad6016450fd713e16f3796ab2e0971e61c8098ee192ae2e822b652d3e31724c669e95cbef68f4c7677e0cffe16dfb7850ba3e181a987ca122312f3301663f52cb596774732608fa6497fea3599be4a9eaeae1aabf4cfbe92a9c6b4774509b929ae51cfba3326635207c29aa387f4f7cae6f55d478fe883000c5e2a39e49fc205b72b2e6a73f6d31aeaeb82e572f30a2bc1a5846e22a584387167342bdf4216f2d0775f2c396a9db49471c5f43872bec1f3ad6b63a4ecebb2d30ac8cac7b64f735757e72824f273d377778b3ada956831aa6ac62a9dbc405939c9ad0a12d1ad0e037e6330528f86516d7f388bc39fbe1d1b9853f2f2c4cfdf6f30db1cab1a057cf70bbb0df78e3f907ceb1464b7efc172dda34fe55ea91ef8cbf071e84fde0c19d330fb3ab4dd86df5cc1d41d82ae264d9b41660880ba479d540868ec954adf87da92dd519e7c68d43b51e3eb8a0fe5f76ee237c62cbea34c49f889ce1bfb61b21ac59aa4560542b76724e4f3b198364dd1419c8b7678732d9439a16d18c5cf5235cb3875a9e2891a6f8b334276a4a3736c28a847b716d47d5cdabb938bc6a7c93e29be65304719563fb8debacc2a927451c948af559ced65f72d4a4e756189ffd6c67cff8a2924e9b6e709b94c56664271cc19bfae388d6f8d9728b913812d059e63ccb49321014231763e851e5af5dfafdf8367bef640add8bbee3c849741c6854a0937acf8c5a56b26f5d84e3e0966358d7ef667d8fed87bd7fc8b8ddf09b814d8886fae31c9e41b8be0f89dfa46495b9247aaf28418da059b1ce8e88abd012788870bebad872552e12a783233987c886bf4cb503cc9d2c02b9e91291915601df56fd6dc3362432c0fe3669897e0df848c48d4ead836bc11540967aadaa969aba829dfb4352b29935a11261dbabefcf16dea9eb9420b32d59c6cc572437e9284f3441bdf5ef94e9c3c11ae5334f8ebe4800400953ad5945ac1cd488fff6c13e1ce91f9e477cc03e87372c99a8cbb1fe6b264bf3c625be24702ce3e41c67a16d8386a54ad8bd18aa3301bc384f13c3de8f345b8f1853e7f80b0cc6b860c0957bcd6fef2b219�x��������������������XM�l��������P#������x��$h����������������x�w�y�� fixed not including .mo files (Jan Silhan)
- comps: _by_pattern() no longer does the comma splitting. (Ales Kozumplik)
- including .mo files correctly (Jan Silhan)
- tests: fix locale independence. (Radek Holy)
- remove: unused trashy methods in dnf.yum.misc. (Ales Kozumplik)
- persistor: do not save Groups if it didn't change (RhBug:1077173) (Ales Kozumplik)
- tests: simplify the traceback logging. (Ales Kozumplik)
- main: log IO errors etc. thrown even during Base.__exit__. (Ales Kozumplik)
- logging: do not log IOError tracebacks in verbose mode. (Ales Kozumplik)
- refactor: move out main._main()'s inner error handlers. (Ales Kozumplik)
- added gettext as a build dependency  for translation files (Jan Silhan)
- translation: updated .pot file and fetched fresh .po files from transifex (Jan Silhan)
- removed redundant word from persistor translation (Jan Silhan)
- translation: show relative path in generated pot file (Jan Silhan)
- refactor: replaced type comparisons with isinstance (Jan Silhan)
- translation: added mo files generation and including them in rpm package (Jan Silhan)
- removed unused imports in base.py (Jan Silhan)
- doc: typo in Base.group_install(). (Ales Kozumplik)- api: drop items deprecated since 0.4.9 or earlier. (Ales Kozumplik)
- api: deprecate Base.select_group() (Ales Kozumplik)
- doc: document the group marking operations. (Ales Kozumplik)
- api: add Base.group_install() with exclude capability. (Ales Kozumplik)
- groups: recognize 'mark install' instead of 'mark-install'. (Ales Kozumplik)
- Allow installing optional packages from a group. (RhBug:1067136) (Ales Kozumplik)
- groups: add installing groups the object marking style. (Ales Kozumplik)
- groups: add Base.group_remove(). (Ales Kozumplik)
- groups: add support for marking/unmarking groups. (Ales Kozumplik)
- groups: add dnf.persistor.GroupPersistor(), to store the installed groups. (Ales Kozumplik)
- logging: log plugin import tracebacks on the subdebug level. (Ales Kozumplik)
- rename: dnf.persistor.Persistor -> RepoPersistor. (Ales Kozumplik)
- doc: update README and FAQ with the unabbreviated name. (Ales Kozumplik)
- groups: fix grouplist crashes with new libcomps. (Ales Kozumplik)
- Do not terminate for unreadable repository config. (RhBug:1071212) (Ales Kozumplik)
- cli: get rid of ridiculous slashes and the file:// scheme on config read fails. (Ales Kozumplik)
- repo: log more than nothing about a remote repo MD download. (Ales Kozumplik)
- drpm: fallback to .rpm download on drpm rebuild error. (RhBug:1071501) (Ales Kozumplik)
- remove: Base.download_packages()' inner function mediasort(). (Ales Kozumplik)
- tests: tidy up the imports, in particular import mock from support. (Ales Kozumplik)
- changed documentation of distro-sync command (Jan Silhan)
- added distro-sync explicit packages support (RhBug:963710) (Jan Silhan)
- renamed testcase to distro_sync_all (Jan Silhan)
- Minor spelling (Arjun Temurnikar)
- i18n: translate repo sync error message. (Ales Kozumplik)
- add support for ppc64le (Dennis Gilmore)
- there is no arch called arm64 it is aarch64 (Dennis Gilmore)- doc: in the faq, warn users who might install rawhide packages on stable. (RhBug:1071677) (Ales Kozumplik)
- cli: better format the download errors report. (Ales Kozumplik)
- drpm: properly report applydeltarpm errors. (RhBug:1071501) (Ales Kozumplik)
- fixed Japanese translatated message (RhBug:1071455) (Jan Silhan)
- generated and synchronized translations with transifex (Jan Silhan)
- added transifex support to cmake (gettext-export, gettext-update) (Jan Silhan)
- api: expose RepoDict.get_matching() and RepoDict.all() (RhBug:1071323) (Ales Kozumplik)
- api: add Repo.set_progress_bar() to the API. (Ales Kozumplik)
- tests: test_cli_progress uses StringIO to check the output. (Ales Kozumplik)
- downloads: fix counting past 100% on mirror failures (RhBug:1070598) (Ales Kozumplik)
- repo: log callback calls to librepo. (Ales Kozumplik)
- Add repository-packages remove-or-reinstall command. (Radek Holy)
- Support negative filtering by n�x�������
 ��������XDlX��#
 ��$0���������������� �!���lves: bz#1930092
  (CVE-2021-20257 virt:rhel/qemu-kvm: QEMU: net: e1000: infinite loop while processing transmit descriptors [rhel-8.5.0])
- Resolves: bz#2020720
  (CVE-2021-3930 virt:rhel/qemu-kvm: QEMU: off-by-one error in mode_sense_page() in hw/scsi/scsi-disk.c [rhel-8])- kvm-spec-Remove-qemu-kiwi-build.patch [bz#2002694]
- kvm-hw-arm-virt-Add-hw_compat_rhel_8_5-to-8.5-machine-ty.patch [bz#1998947]
- Resolves: bz#2002694
  (remove qemu-kiwi rpm from qemu-kvm sources in rhel-8.6)
- Resolves: bz#1998947
  (Add machine type compatibility update for 6.1 rebase [aarch64])- kvm-virtio-net-fix-use-after-unmap-free-for-sg.patch [bz#1999221]
- Resolves: bz#1999221
  (CVE-2021-3748 virt:rhel/qemu-kvm: QEMU: virtio-net: heap use-after-free in virtio_net_receive_rcu [rhel-8])- kvm-qxl-fix-pre-save-logic.patch [bz#2002907]
- kvm-redhat-Define-hw_compat_rhel_8_5.patch [bz#1998949]
- kvm-redhat-Update-pseries-rhel8.5.0.patch [bz#1998949]
- kvm-redhat-Add-s390x-machine-type-compatibility-update-f.patch [bz#1998950]
- Resolves: bz#2002907
  (Unexpectedly failed when managedsave the guest which has qxl video device)
- Resolves: bz#1998949
  (Add machine type compatibility update for 6.1 rebase [ppc64le])
- Resolves: bz#1998950
  (Add machine type compatibility update for 6.1 rebase [s390x])- kvm-file-posix-Cap-max_iov-at-IOV_MAX.patch [bz#1994494]
- kvm-migration-Move-yank-outside-qemu_start_incoming_migr.patch [bz#1974366]
- Resolves: bz#1994494
  (VM remains in paused state when trying to write on a resized disk resides on iscsi)
- Resolves: bz#1974366
  (Fail to set migrate incoming for 2nd time after the first time failed)- kvm-iotests-Improve-and-rename-test-291-to-qemu-img-bitm.patch [bz#1946084]
- kvm-qemu-img-Fail-fast-on-convert-bitmaps-with-inconsist.patch [bz#1946084]
- kvm-qemu-img-Add-skip-broken-bitmaps-for-convert-bitmaps.patch [bz#1946084]
- kvm-audio-Never-send-migration-section.patch [bz#1991671]
- Resolves: bz#1946084
  (qemu-img convert --bitmaps fail if a bitmap is inconsistent)
- Resolves: bz#1991671
  (vmstate differs between -audiodev and QEMU_AUDIO_DRV when no sound frontends devs present.)- kvm-migration-move-wait-unplug-loop-to-its-own-function.patch [bz#1976852]
- kvm-migration-failover-continue-to-wait-card-unplug-on-e.patch [bz#1976852]
- kvm-aarch64-Add-USB-storage-devices.patch [bz#1974579]
- Resolves: bz#1976852
  ([failover vf migration]  The failover vf will be unregistered  if canceling the migration whose status is "wait-unplug")
- Resolves: bz#1974579
  (It's not possible to start installation from a virtual USB device on aarch64)- kvm-acpi-pc-revert-back-to-v5.2-PCI-slot-enumeration.patch [bz#1977798]
- kvm-migration-failover-reset-partially_hotplugged.patch [bz#1787194]
- kvm-hmp-Fix-loadvm-to-resume-the-VM-on-success-instead-o.patch [bz#1959676]
- kvm-migration-Move-bitmap_mutex-out-of-migration_bitmap_.patch [bz#1959729]
- kvm-i386-cpu-Expose-AVX_VNNI-instruction-to-guest.patch [bz#1924822]
- kvm-ratelimit-protect-with-a-mutex.patch [bz#1838221]
- kvm-Update-Linux-headers-to-5.13-rc4.patch [bz#1838221]
- kvm-i386-Add-ratelimit-for-bus-locks-acquired-in-guest.patch [bz#1838221]
- kvm-iothread-generalize-iothread_set_param-iothread_get_.patch [bz#1930286]
- kvm-iothread-add-aio-max-batch-parameter.patch [bz#1930286]
- kvm-linux-aio-limit-the-batch-size-using-aio-max-batch-p.patch [bz#1930286]
- kvm-block-nvme-Fix-VFIO_MAP_DMA-failed-No-space-left-on-.patch [bz#1848881]
- Resolves: bz#1977798
  (RHEL8.5 guest network interface name changed after upgrade to qemu-6.0)
- Resolves: bz#1787194
  (After canceling the migration of a vm with VF which enables failover, using "migrate -d tcp:invalid uri" to re-migrating the vm will cause the VF in vm to be hot-unplug.)
- Resolves: bz#1959676
  (guest status is paused after loadvm on rhel8.5.0)
- Resolves: bz#1959729
  (SAP/3TB VM migration slowness [idle db])
- Resolves: bz#1924822
  ([Intel 8.5 FEAT] qemu-kvm AVX2 VNNI - Fast Train)
- Resolves: bz#1838221
  ([Intel 8.5 FEAT]  qemu-kvm Bus Lock VM Exit - Fast Train)
- Resol�x��������������X8k� ;�'�$�����������������'�'�'�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcpanel-mariadb-connector-3.3.15-2.cp130~el8.src.rpm��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������cpanel-mariadb-connector-develcpanel-mariadb-connector-devel(x86-64)cpanel-mariadb-native-client-devel




rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-1cpanel-mariadb-native-client-devel3.3.154.14.3hH@h,n�g���gr�@b�'�b�'�b(��`8�^�V@^��^F��Z��@Z��@Z��@Z��@Todd Rinaldo <toddr@cpanel.net> - 3.3.15-2.cp130~el8Todd Rinaldo <toddr@cpanel.net> - 3.3.15-1.cp130Sloane Bernstein <sloane.bernstein@webpros.com> - 3.3.13-2.cp108Sloane Bernstein <sloane.bernstein@webpros.com> - 3.3.13-1.cp108Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 3.3.1-1.cp108Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 3.2.6-1.cp108Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 3.2.6-1.cp1198Todd Rinaldo <toddr@cpanel.net> - 3.1.8-1.cp1198Chris Dillon <chris.dillon@cpanel.net> - 3.1.8-2.cp1186Chris Dillon <chris.dillon@cpanel.net> - 3.1.8-1.cp1186Thomas Baugh <thomas.baugh@cpanel.net> - 3.1.7-1.cp1186Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 3.0.3-1.cp1186Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 3.0.3-3.cp1174Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 3.0.3-2.cp1174Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 3.0.3-1.cp1174- Fix internal deps generated on RPM- Update to �x�������������p�������XP�kP
HcB3�$R����������������B3A3C3�9 to use RC4 implementation from OpenSSL
- Resolves bz#1618744
- Fix multilib issue bz#1663120- Rebuild with fixed binutils- Rebuilt for gdbm- New upstream (pre-)release
- Import LDFLAGS from redhat-rpm-config (#1548437)- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for switch to libxcrypt- Use mariadb-connector-c-devel instead of mysql-devel (#1493620)- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Add missing patch for separate mutexes per connection in GSSAPI- Allow cyrus sasl to get the ssf from gssapi- Removing the obsolete scriptlet /sbin/service dependency- Fix GSS SPNEGO support (#1421663)- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Add support for OpenSSL 1.1.0- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Revert tmpfiles.d and use new systemd feature RuntimeDirectory- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Add ability to handle logging in gssapi plugin (#1187097)- Rever "Do not leak memory in plugin_common.c ..." due the breakage of svn (#1202364)- Add and Document ability to run saslauthd as non-root user, fix tpmfiles ownership (#1189203)
- Do not leak memory in sample server (#852755)
- Do not leak memory in plugin_common.c for password callback (#1191183)
- Cleanup spec file: tmpfiles.d macros and tab/space- Change the ownership of /run/saslauth to saslauth:saslauth (#1189203)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- fix license handling- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Don't order service after syslog.target.- Treat SCRAM-SHA-1/DIGEST-MD5 as more secure than PLAIN (#970718)
- improve configuration error message- revert upstream commit 080e51c7fa0421eb2f0210d34cf0ac48a228b1e9 (#984079)- add ppc64p7 subarch support in config.sub (Fedora only)- build with RPM_OPT_FLAGS <ville.skytta@iki.fi> (#1005535)- fix hardening for /usr/sbin/saslauthd
- add testsaslauthd.8 man page to the package
- use static md5global.h file- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- detect gsskrb5_register_acceptor_identity macro <nalin@redhat.com> (#976538)- disable incorrect check for MkLinux to allow building with shared libraries on PPC- fix the spec file in order to build the cyrus-sasl-sql plugin
  with support for PostgreSQL and MySQL- don't include system sasl2 library needed for rebuilds after rebase- enable full relro and PIE compiler flags for saslauthd- fix library symlinks- actually apply size_t patch (#906519)- sasl.h: +#include<sys/types.h> for missing size_t type (#906519)
- tighten subpkg deps via %?_isa- update to 2.1.26
- fix segfaults in sasl_gss_encode (#886140)- always use the current external Berkeley DB when linking- update to 2.1.25
- add cyrus-sasl-scram and cyrus-sasl-gs2 packages- replace scriptlets with systemd macros (#856666)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- move /etc/tmpfiles.d/saslauthd.conf to /usr/lib/tmpfiles.d/saslauthd.conf (#840193)- properly deal with crypt() returning NULL (#816250)
- use fixed gid 76 for saslauth- re-enable libdb support and utilities- temporarily disable libdb support to resolve cyrus-sasl
  chicken and egg build problem against libdb- rebuild against new libdb- Change saslauth user homedir to /run/saslauthd (#752889)
- Change all /var/run/ to /run/
- DAEMONOPTS are not supported any more in systemd units- Ship with sasl_pwcheck_method: alwaystrue- remove support for logging of the remote host via PAM (#759334)
- fix systemd files (#750436)- Add partial relro support for libraries- Add support for berkeley db 5- Migrate the package to full native systemd unit files, according to the Fedora
  packaging guidelines.- repair rimap support (more packets in response)- repair ntlm support- add logging of the remote host via PAM- temporarilly revert systemd units- update scriptlet�x�����`���������X9.l�!8�
���$,���������������������						


ASCII textPOSIX shell script, ASCII text executable, with very long linesdirectoryC source, ASCII textC++ source, ASCII textC source, UTF-8 Unicode textUTF-8 Unicode textC source, ASCII text, with CRLF line terminatorsC source, ISO-8859 textISO-8859 text, with very long linesmakefile script, ASCII textM4 macro processor script, ASCII text, with very long linesPOSIX shell script, ASCII text executablePOSIX shell script, ASCII text executable, with escape sequencesM4 macro processor script, ASCII texta /usr/bin/env php script, ASCII text executableawk or perl script, ASCII textPOSIX shell script, ISO-8859 text executabletroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)utf-87d96b3eca1cce7d2cb774fa6d8d7ba7fbc226f3ce646c080277878a4c37b2749?���`
h�c�������OYä^�ވ]!��gdcW&���K�U�b��qi�ng
	�U�b��q�d�2�m�Շת)��`[�?	�
�B�c	�Jp�౸���[��]!��gdcW&���K�U�b��qi�ng
	�U�b��q������p^��̿R߸��.�r� �Xi��ӡE��w�T櫀N'fd42b65d52c9955342feb775d1f645a87e6bdfcae6b259e552c4b60a2ec9a1abd7af13c87fdfe0f3d7504d90830a9832c48e7dcbi�?�A�|i�?�ill O'Donnell) [1739607]
- [fs] xfs: zero initialize highstale and lowstale in xfs_dir2_leaf_addname (Bill O'Donnell) [1739607]
- [fs] xfs: clean up xfs_dir2_leafn_add (Bill O'Donnell) [1739607]
- [fs] xfs: Zero initialize highstale and lowstale in xfs_dir2_leafn_add (Bill O'Donnell) [1739607]
- [fs] xfs: fix backwards endian conversion in scrub (Bill O'Donnell) [1739607]
- [fs] xfs: fix uninitialized error variables (Bill O'Donnell) [1739607]
- [fs] xfs: rework breaking of shared extents in xfs_file_iomap_begin (Bill O'Donnell) [1739607]
- [fs] xfs: don't pass iomap flags to xfs_reflink_allocate_cow (Bill O'Donnell) [1739607]
- [fs] xfs: fix uninitialized error variable (Bill O'Donnell) [1739607]
- [fs] xfs: introduce an always_cow mode (Bill O'Donnell) [1739607]
- [fs] xfs: report IOMAP_F_SHARED from xfs_file_iomap_begin_delay (Bill O'Donnell) [1739607]
- [fs] xfs: make COW fork unwritten extent conversions more robust (Bill O'Donnell) [1739607]
- [fs] xfs: merge COW handling into xfs_file_iomap_begin_delay (Bill O'Donne�x�������������`��������XRom��������������u�$e����������������ut�
5Zh/03xrfAMgNPje3PSx9E0J9
pQKOjqKUT+gDWCpu78v2WErWsf5hHQcRr79UpuF6KtVF9gMx7sBvMDYbHwARAQAB
tB5XUCBUb29sa2l0IDxzdXBwb3J0QHBsZXNrLmNvbT6JAiwEEwEKABYFAmilm2YC
GwMGFQoJCAsCAh4BAheAAAoJENQm5aYfzxZUdYsP/0YV2t9eOKONvBudmKlmxEo3
+JXXrsFF7wdoJgjOVGs5VBmcDeFB/W7sXuycP1DMrGb9TVV7qh4VsEzPkSSUGbKR
Uc30rGc0sojaTE0GgJQ/fgtZyktj85HDMRdUpv83/8zzlQpSMVFL3c5OcROYRw5+
JD3nsr+1uuwd/n8VTMvOLdbG4Hx59+12Dhd8/kjFRRMAZM1/g/CFL/Dy7u8N9S6e
kMKMIhqhK44XdmNZrbmCLmjsCGekTO5gq7SE1ML9IGuiQzjHqdTE7JMKSuOxKFbN
W9kZPAAI3KprXzPDsOmsPYC09cgzhGcmWgHwnQBt1HOoX6196kV7Zd2bn7xOZ1wc
DOJiT3NXgYsblqnWxOLBPtvye0l1Tlb/Cm/wynxvBSTO9FWsvdpyoY8o8WnrXNpR
zFRpOO1jVZysKRsNElo/qxzaSSAJTD1Z3aQiD6xSQrsS6iu4JxoR+UUutp3bkucx
BzdZeYqpQhUnSe0yfh8+EvCbOD96mHyCXSGkN5H9O8Ubhf7ynxm3TgKJH1V01pgg
OJU5gefuIaEoHB8oO/ykWSfMUccs8KdzkdGAhxcORkPgnJpiryPYDkUJPvBAuouv
Jpa5D70+SUuNpras1jNzxwuoT+1IvSoHg7Ph11QwxOp+HdgGn6zR+UgEE/VLHd80
2EZ0PgZygIGBn2+6WxIxuQINBGilm2YBEACp1MKab5upYJrJUbrHOkYK3Q4974ef
fZ5c3tWJIfJdk9DX1DtqP3ZEaThdGuglY8qYKCDF3HOyWUPlibOUm67zAFEl1EEg
cQ0pIScWMn6bmK6CybWc9DrqTy2HQyjOc3BJUCpxoyvj4SwwSXqa8yNxQOrZT3VH
IstKN44LvkJ6yPEGH1y1Vqmd24Nc2RwUIlRNcrCl/Om93cioNqlWC//ryqA7LKey
ApRJVnyfItYAne1mtEX0PLc7332MEAZf2kkU4HgCY0leJIe3bA3GhLUaTWNS4MLr
eSHORQUb8fqmffs3ebvnWG4TV2dTzoF7/HSlEeovNT45n2EATty1thNLabHyXjHn
R6bEF6w5Zrqedfp+nkgd5RhZgErw6Ewl8bKn1WLk1fyWMCgkQ9Z5g9q4XGGioroM
eMFahbnV0pcGhgSTH2spH8S2XoEjGmmAI3mt+HCgMR0DPvdP02N0HSKDDG5tkmtD
GYqPonhGyV47Zmw0XfI0CqCxBIHwQe3yCK96oRCyxYL7gG5VuSGi81p86BXmCeZX
a6J+SjwmDhN8HT33qS37VR/GJhpBxi+YyjfJD8sQlswzW3xTAEFhxJVnyBRBDNvp
lYYtiqZeeNcA3mLn4eJpWVu3wP+1yf6g/tOTR5k+wOFy4FZVk72VFhLtnjqv5pM3
ELG+kmFHzsVwKwARAQABiQIfBBgBCgAJBQJopZtmAhsMAAoJENQm5aYfzxZUuvcQ
AKL8Y9C+MwQuAEKvp2JN1pPUeuLHpTXzf//04utz3FNoTGptfEaqjGU23aKwLV+Y
h5ymkgimO6gGjG64jDfn1XpzRQr6db/SfIb5W+7AbR++dGewZuRnXN67liLI0KYE
z+eJ/cmM/kypXfQ/+p63pgYAfHq+XXNiX9kXCAU/5rq4+Q3jd5luCPzi+EG3Qw4u
eW0S/7u5uemfv4PU2gB5QYEzlNtEC/gX2T2c3M+Au20QJ3fv14uYHe26Cd+hlt2F
hVX3W289Uw8VwsDhfvTyUsAtMBedWSzKr7jwE6VYhyw3lspEvzyVQ2rbApTeZkB4
O+PBfAfkY4ni7NE4y+DtdS96rfB0IeXJzfShbtz6gF5jNQLoGFDo0ImrWzywWmOF
NUfi7wCr1QaM5z6cSK+LKS2H7KI8Pp2VSqpb0XeDM1MyqALvr83ZnamUpS8tC7YZ
9AkaeyudLWq52w+PvZmka5dnb+2G6o3n2jvqPZiZ3Imk9QQcpL2dY8m1ti4vzPRY
OKdA/enbgUm5/Knc/3B+p472fRq6ni9qrHoQPbam2VAm/3GbudIeaRwLwTpM4zfP
1vdbsxo2GAKOj2jn+1hhUuKQs+KfxR/QTFfnXJrZ44GMWi8zygr7dkOLbVmI6FoM
EcBMp4G/ON9jNTmJe7sxowLPQs9py5DVa7+p9DI2+220
=7g+U
-----END PGP PUBLIC KEY BLOCK-----
h��flocalhostpubkeyWP Toolkit <support@plesk.com>Public Keys(none)gpg(WP Toolkit <support@plesk.com>)gpg(1fcf1654)gpg(9e53d5cb)4.14.34:d426e5a61fcf1654-68a59b664:d426e5a61fcf1654-68a59b664:40b7eb0c9e53d5cb-68a59b66?����27e8103ed2fef925485c16e321acc7540d4b453aicic���*��>g�@�š��K�2A)��OU.$�P��K%Z8}w�b�:ۯv��ڢ�0-����즯fb1593cb629c748c038cb66b5398832ad347d238882e2d2d1dddc90415fae6298432e5d8e0c84bc21f3e30bad792e8aaf78e2649i?�o�x�������������آ�������XS�k��������خ>��$.����������������>�=�?�� Try RO mount also if we get EACCES (vpodzime)
- Size in bytes for xfs_resize_device (kailueke)
- src/plugins/Makefile.am: Remove hard coded include path in /usr prefix (tristan.vanberkom)
- Fixed include for libvolume_key.h (tristan.vanberkom)
- Ignore parted warnings if possible (squimrel)
- bcache tests: Remove FEELINGLUCKY checks (tasleson)
- kbd.c: Code review corrections (tasleson)
- kbd.c: Make bd_kbd_bcache_create work without abort (tasleson)- Fix hardcoded reference to gcc (timo.gurr)
- Catch and ignore partial failures in LVM tests' cleanups (vpodzime)
- Fix hardcoded reference to pkg-config (timo.gurr)
- Make GObject introspection optional (vpodzime)
- Do not link libraries required by plugins to the GI files (vpodzime)
- Make sure the whole build status image is shown (vpodzime)
- Show CI status in README (at the GH repo's front page) (vpodzime)
- Always require the libudev pkg (tgurr)
- Make sure we give kernel time to fully setup zram device(s) (vpodzime)
- fs_test.py: Close FDs when calling utilities (tasleson)
- crypto.c: Correct segmentation fault (tasleson)- Temporarily skip vfat generic resize test on rawhide (vtrefny)
- Use "safeprobe" in "bd_fs_wipe" (vtrefny)
- Add a generic filesystem resize function (vtrefny)
- Add a function to get mountpoint for a device (vtrefny)
- Add a function to get filesystem type for a device (vtrefny)
- Only include the LVM DBus config when shipping LVM DBus (vpodzime)
- Skip the LVM DBus vgreduce tests on Rawhide (vpodzime)
- Do not build the lvm-dbus plugin on RHEL/CentOS (vpodzime)
- Give zRAM more time to settle before trying to remove a device (vpodzime)
- Put zram tests adding/removing devices into a separate class (vpodzime)
- Skip LVM cache and RAID tests on Rawhide (vpodzime)
- Fix the skip_on decorator factory for tests (vpodzime)
- Use 'blkid -p' instead of lsblk to get device's FS type (vpodzime)
- Improve the lvm_set_global_config test (vpodzime)
- Pass '-y' to pvresize (vpodzime)
- Create a copy of os.environ for a child process (vpodzime)
- Revert "Use the "C.UTF-8" locale instead of just "C"" (vpodzime)
- Fix how we create vfat FS in tests (vpodzime)
- Skip the test if requiring unavailable locales (vpodzime)
- Use the "C.UTF-8" locale instead of just "C" (vpodzime)
- Add functions for working with ext2 and ext3 filesystems (vtrefny)
- Link to gobject when lvm or btrfs is enabled (andreas)
- Link to libm where needed (andreas)
- Add a function for cleaning a device (vtrefny)
- Add few code exaples to documentation (vtrefny)
- Use a special exception for no fs signature when doing wipe (vpodzime)
- One more incompatible os.symlink() call (vpodzime)
- Do not use pass-by-name in the os.symlink() call (vpodzime)
- Ignore previous errors when falling back to using ioctl() (vpodzime)
- Use ioctl() call to teardown loop devices (vpodzime)
- Resolve the device to remove for mdadm (vpodzime)
- Add a function for getting device symlinks (vpodzime)
- Use the new resolve_device() function where appropriate (vpodzime)
- Add the resolve_device() function to the utils library (vpodzime)
- First try to read the 'autoclear' flag from /sys/ (vpodzime)- Skip btrfs min size tests on Fedora 25 (vtrefny)
- Make sure the loop device doesn't disappear during tests (vpodzime)
- Close the loop device when autoclear is (un)set (vpodzime)
- Do not enforce Python 3 for running tests in CI (vpodzime)
- Revert "Use different BTRFS_MIN_MEMBER_SIZE on aarch64" (vtrefny)
- Use both 'old' and 'new' sysfs files to read zRAM stats (vtrefny)
- Check if libparted-fs-resize pkgconfig is available (vpodzime)
- Do not try to get name for inactive partitions (vtrefny)
- Skip tests for getting free regions on CentOS/RHEL (vpodzime)
- Free the container holding the specs of free regions (vpodzime)
- Open loop devices as O_RDONLY when getting flags (vpodzime)
- Resolve maximum partition size when we know its start (vpodzime)
- Use --id instead of --part-type when setting partition id (vpodzime)
- Fix mdadm command for removing failed device from an array (vtrefny)
- Skip�x�����C������XWrmx(�������v�$f����������������v8
�?
�
��$�-�	6�	W�����������	


&(
UX
\Y
d

��
�h
�mQGiBFXAUiARBAC9lDsyU9L2dZRyhOp27adDZ99+tfPq9L0aX1xmZvpF+rO6FEa1
HCEi1blRq/icL784esCEuEe/k6eGeqKgOv6E05ZG9txvP/vhUofFJX6vAHsiScKN
QXwZQQqM2Fz3oPqeN/7zOE/dfASrTC8fET7J7+d+KNOOnDSSxIG9XJbGTwCg0BCd
2vNB4CduMm2oyTVNGcWXmCMEAIFJALIEEeNlevXvBxBPv86DB3eFdLUgYJNlwIfJ
aDCFr9plRNb6O/MMGPFPsp113r4E+o1M8bW5RBfZgnxXH+6Xi3i/kMBh9GtovAv+
qe4lMJQ+t7cFDedvsgsmigq7cl0cmSwe00zhYzT4t3lEg5F3l543Wwxk/kwQj2wp
t5cCA/9rAUUCZ4ewdO74tiuF5nmTb+lHNvIq4EKXacgA5gsVVMTw/SH8G0m0z+YH
3xJuVJaO18+6OrdCjGzmzJ78k8j6z1fuAZVWWaUK+XtjP6mn/ZsjwvrIGMxrbJ85
B/v+j4W7MOjIHmD37PScSibK56ItlQHjd2y0S6jy+e4UFIOnA7QbUGxlc2sgVGVh
bSA8aW5mb0BwbGVzay5jb20+iGAEExECACAFAlXAUiACGwMGCwkIBwMCBBUCCAME
FgIDAQIeAQIXgAAKCRC9EaaqkUvfflh7AKCDstpjOFDR1FarF2BU/sA6+rFteQCg
xHjO3vh+i2QiTnGlBhOUlCxuNFq5Ag0EVcBSJxAIAID5a6RrDkEIkaAc6u+BJJsp
Rychg18z+IdHPUrBABEeT7vCmH5KISP1bdhur8vgeDdFanhLjTjC7mYJ5OJnb3ZM
nl/L8B5uz/RQ8i7Sv/buwr69h/llVElkeOyx2SkkIdsHLPNXuxydZfADfz5B5Zjx
R7IVepDxEeA755rCQd3alAwk6lA0Iy+LCdCaNIGpzzC6j7goLeGE1tAoG3J0Lvja
xXGgTmqHHhImGjc875wngrDRo4yDu6Tfwi6b0RCfbkm6wgEWGvDwzSXz1+7iWRAC
kyagGrZPOqKJiKBfj+hVMnflB3EFZd2j5hfWl35U4j18U6v6JkxKIn0DvD5+cz8A
BAsH/RVWit+s/zXJbxd9U07EPbVS+ujZrhannBgV6xpMuGWDbl1QcMWXoQXU0zK4
Gr44UmHbe3h1F38GeMzELjfMYi8XAMvOQkC5i8Clv9jHJwfHxt8wcA/tE4kPtRNx
KhDhh3i2sZTg123h0EpEOlMvrVoboFyH8K7BN+KdEl3YtWgmbM9zhOO8R7LFGQ6m
VxxL4BlX7QNZ9cpDQ5sNTiPu4pij++oFoSaquXZKGXOO3KvTBQHHceps+w1cpYXv
EGzNjxvTvPmBYXZAVlu8dOInDMfl8wwctAmHXxPeh0kTGRlZT4QHJs1pJVgNuQbP
pjqmxx1SGEnYmE/TNDP+J1F7GISISQQYEQIACQUCVcBSJwIbDAAKCRC9EaaqkUvf
fmn2AJ9q31HpLe/9sHWQHAL/ul6qeSNIJwCeK2hBWeBcx0iC/ISo8T/EX8KTCcw=
gpg-pubkey914bdf7e55c05220gpg(Plesk Team <info@plesk.com>)-----BEGIN PGP PUBLIC KEY BLOCK-----
Version: rpm-4.14.3 (NSS-3)

mQGiBFXAUiARBAC9lDsyU9L2dZRyhOp27adDZ99+tfPq9L0aX1xmZvpF+rO6FEa1
HCEi1blRq/icL784esCEuEe/k6eGeqKgOv6E05ZG9txvP/vhUofFJX6vAHsiScKN
QXwZQQqM2Fz3oPqeN/7zOE/dfASrTC8fET7J7+d+KNOOnDSSxIG9XJbGTwCg0BCd
2vNB4CduMm2oyTVNGcWXmCMEAIFJALIEEeNlevXvBxBPv86DB3eFdLUgYJNlwIfJ
aDCFr9plRNb6O/MMGPFPsp113r4E+o1M8bW5RBfZgnxXH+6Xi3i/kMBh9GtovAv+
qe4lMJQ+t7cFDedvsgsmigq7cl0cmSwe00zhYzT4t3lEg5F3l543Wwxk/kwQj2wp
t5cCA/9rAUUCZ4ewdO74tiuF5nmTb+lHNvIq4EKXacgA5gsVVMTw/SH8G0m0z+YH
3xJuVJaO18+6OrdCjGzmzJ78k8j6z1fuAZVWWaUK+XtjP6mn/ZsjwvrIGMxrbJ85
B/v+j4W7MOjIHmD37PScSibK56ItlQHjd2y0S6jy+e4UFIOnA7QbUGxlc2sgVGVh
bSA8aW5mb0BwbGVzay5jb20+iGAEExECACAFAlXAUiACGwMGCwkIBwMCBBUCCAME
FgIDAQIeAQIXgAAKCRC9EaaqkUvfflh7AKCDstpjOFDR1FarF2BU/sA6+rFteQCg
xHjO3vh+i2QiTnGlBhOUlCxuNFq5Ag0EVcBSJxAIAID5a6RrDkEIkaAc6u+BJJsp
Rychg18z+IdHPUrBABEeT7vCmH5KISP1bdhur8vgeDdFanhLjTjC7mYJ5OJnb3ZM
nl/L8B5uz/RQ8i7Sv/buwr69h/llVElkeOyx2SkkIdsHLPNXuxydZfADfz5B5Zjx
R7IVepDxEeA755rCQd3alAwk6lA0Iy+LCdCaNIGpzzC6j7goLeGE1tAoG3J0Lvja
xXGgTmqHHhImGjc875wngrDRo4yDu6Tfwi6b0RCfbkm6wgEWGvDwzSXz1+7iWRAC
kyagGrZPOqKJiKBfj+hVMnflB3EFZd2j5hfWl35U4j18U6v6JkxKIn0DvD5+cz8A
BAsH/RVWit+s/zXJbxd9U07EPbVS+ujZrhannBgV6xpMuGWDbl1QcMWXoQXU0zK4
Gr44UmHbe3h1F38GeMzELjfMYi8XAMvOQkC5i8Clv9jHJwfHxt8wcA/tE4kPtRNx
KhDhh3i2sZTg123h0EpEOlMvrVoboFyH8K7BN+KdEl3YtWgmbM9zhOO8R7LFGQ6m
VxxL4BlX7QNZ9cpDQ5sNTiPu4pij++oFoSaquXZKGXOO3KvTBQHHceps+w1cpYXv
EGzNjxvTvPmBYXZAVlu8dOInDMfl8wwctAmHXxPeh0kTGRlZT4QHJs1pJVgNuQbP
pjqmxx1SGEnYmE/TNDP+J1F7GISISQQYEQIACQUCVcBSJwIbDAAKCRC9EaaqkUvf
fmn2AJ9q31HpLe/9sHWQHAL/ul6qeSNIJwCeK2hBWeBcx0iC/ISo8T/EX8KTCcw=
=NB3w
-----END PGP PUBLIC KEY BLOCK-----
U�R localhostpubkeyPlesk Team <info@plesk.com>Public Keys(none)gpg(Plesk Team <info@plesk.com>)gpg(914bdf7e)4.14.34:bd11a6aa914bdf7e-55c052204:bd11a6aa914bdf7e-55c05220?����fc29b86401abdbcdcb5403b1cdea6912db808a1cicicRRRRR5RR-RRFRRRRR-RRFRRRR-RRFRRRR-RRFRRRR-RRFRRRR-RRFRRRR�x����������������������XU�k���KD��$T����������������D�C�E��erator to work with 'const' return types (vpodzime)
- Add subpackages for the KBD plugin and its devel files (vpodzime)
- Add provided symbols to the documentation section of the KBD plugin (vpodzime)
- Implement the bcache_get_backing/cache_device functions (vpodzime)
- Exclude bcache tests from the normal 'test' target (vpodzime)
- Add some more and prolong some of the waits in KBD tests (vpodzime)
- Zero all newly allocated structures (vpodzime)
- Implement the bcache_status function and all it wants (vpodzime)
- Fix for the zram stats (vpodzime)
- Add bcache_get_mode and bcache_set_mode functions (vpodzime)
- Teach boilerplate_generator to work with enum return types (vpodzime)
- Teach boilerplate_generator to work with 'const' return types (vpodzime)
- Add the zram_get_stats function (vpodzime)
- Add the check() function for the KBD plugin (vpodzime)
- Add ErrorProxy instance for the KBD plugin (vpodzime)
- Add tests for bcache_create/attach/detach/destroy functions (vpodzime)
- Add the 'rebuild' Makefile target (vpodzime)
- Add bcache_create, bcache_attach, bcache_detach and bcache_destroy functions (vpodzime)
- Implement a helper function to echo string into a file (vpodzime)
- Add tests for zram_create_devices and zram_destroy_devices functions (vpodzime)
- Add the zram_destroy_devices function to the KBD plugin (vpodzime)
- Add first function to the KBD plugin: zram_create_devices (vpodzime)
- Add the KernelBlockDevices plugin (vpodzime)- Prevent a leaky test from running in Jenkins (vpodzime)
- Try harder when cleaning up after MD RAID tests (vpodzime)
- Improve the MD RAID activate/deactivate test (vpodzime)
- One more @contextmanager that needs try-finally (vpodzime)
- Do not require metadata version to be reported by 'mdadm --examine' (#1217900) (vpodzime)
- Make sure we always set things back in context managers (vpodzime)
- Make the release date for version 1.0 more realistic (vpodzime)
- Merge pull request #11 from vpodzime/master (vpodzime)
- Run utilities with LC_ALL=C (vpodzime) (#1219033)
- Free GMatchInfo instance even in case of no match (vpodzime)
- Resolve /dev/md/ symlinks when checking swap status. (dlehman)- Require minimum version of libblockdev-utils in some plugins (vpodzime)
- Report both stdout and stderr if exit code != 0 (vpodzime)- Fix issues with using overriden functions over ErrorProxy (vpodzime)
- Update the roadmap.rst and features.rst with new stuff (vpodzime)
- Fix two minor issues with docs generation (vpodzime)- Fix return type of the unload_plugins() function (vpodzime)
- Close the DL handle when check() or init() fail (vpodzime)
- Add one more check to the reload test (vpodzime)
- Drop reference to check() and init() functions (vpodzime)
- Add more cats to tests (vpodzime)
- Make regexp for getting btrfs version more generic (vpodzime)
- Merge pull request #8 from vpodzime/master-check_functions (vpodzime)
- Fix parameters passed to unoverridden swapon function (vpodzime)
- Implement and test swap plugin's check function (vpodzime)
- Implement and test MD RAID plugin's check function (vpodzime)
- Implement and test mpath plugin's check function (vpodzime)
- Try harder to get util's version (vpodzime)
- Implement and test loop plugin's check function (vpodzime)
- Implement and test DM plugin's check function (vpodzime)
- Implement and test BTRFS plugin's check function (vpodzime)
- Implement and test LVM plugin's check function (vpodzime)
- Init logging before loading plugins (vpodzime)
- Add function for utility availability checking (vpodzime)
- Fix default value for the fake_utils' path argument (vpodzime)
- Add ErrorProxy instance for the utils functions (vpodzime)
- Add function for version comparison (vpodzime)
- Merge pull request #9 from clumens/master (vpodzime)
- Disable pylint checking on the new exception proxy. (clumens)
- Fix XRules application and add a test for it (vpodzime)
- Raise NotImplementedError when an unavailable function is called (vpodzime)
- Merge pull request #4 from vpodzime/master-error_proxy (vpodzime)
- Merge branc�x�������������0q�������XV-mМ��������������B��$R����������������B�A�!���@NL��N7@M���M��M���MT�Mt�Mk�@MfH@MR��M'@M�@M�@Mg�L�8�LΫ�Lʷ@L���LH2�K��@K��@K�C�K�@K
@K��K�@J��@JlE@J_@J_@J\s@JY�@J> �I�'@I��@I��I��@I��@I}��I|T@Iy�@IC��I>]�I:i@I9�I*�@I9@H˫@H�(�H{?�Hv@G��G�Z@Gt�@GV��GV��GV@F��Fڥ�F�@F�S@F�S@F�]�F��Fw�@FiD�FA��F@f@F; @F�@F@Eّ@E�K@E��E�3@Eu_@El$�El$�Ej�@E[@E[@EG:�E#�@D�,@D��@D�b�D�b�D�(@DtJ�Dla�D_2�DX�@D;@C�@C�C�Q@Cˊ�Cǖ@C�
@C��C�f@C�q�C� @C��@C�7@C��@Cs6@CoA�CgX�C(�B�i�B{\@Bwg�Bl�B]	�B]	�B]	�B[�@BZf�BQ,@BM7�BJ��BB��B�B	�@A�@A��A��A�_�A�_�A�_�AJ�AJ�AJ�A@E�A
@Ag@Sergey Fokin <sfokin@cloudlinux.com> - 5.6.40-25.cloudlinux.10Razmik Manvelyan <rmanvelyan@cloudlinux.com> - 1:5.6.40-25.cloudlinux.9Levon Matshkalyan <lmatshkalyan@cloudlinux.com> - 1:5.6.40-25.cloudlinux.8Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 1:5.6.40-25.cloudlinux.7Levon Matshkalyan <lmatshkalyan@cloudlinux.com> - 1:5.6.40-25.cloudlinux.6Sergey Fokin <sfokin@cloudlinux.com> - 1:5.6.40-25.cloudlinux.5Razmik Manvelyan <rmanvelyan@cloudlinux.com> - 1:5.6.40-25.cloudlinux.4Arseniy Zolotarev <azolotarev@cloudlinux.com> - 1:5.6.40-25.cloudlinux.3Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 1:5.6.40-25.cloudlinux.2Sergey Fokin <sfokin@cloudlinux.com> - 1:5.6.40-25.cloudlinux.1Levon Matshkalyan <lmatshkalyan@cloudlinux.com> - 5.6.40-25Chris Castillo <chris.castillo@webpros.com> - 5.6.40-24Julian Brown <julian.brown@cpanel.net> - 5.6.40-23Vladimir D. Seleznev <vseleznev@cloudlinux.com> - 5.6.40-22.cloudlinux.12Sergey Fokin <sfokin@cloudlinux.com> - 5.6.40-22.1.cloudlinux.11Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 5.6.40-22.1.cloudlinux.10Vladimir D. Seleznev <vseleznev@cloudlinux.com> - 5.6.40-22.1.cloudlinux.9Azat Nurgaliev <anurgaliev@cloudlinux.com> - 5.6.40-22.1.cloudlinux.8Azat Nurgaliev <anurgaliev@cloudlinux.com> - 5.6.40-22.1.cloudlinux.7Lizi Ekseulidze <lekseulidze@cloudlinux.com> - 5.6.40-22.1.cloudlinux.6Lizi Ekseulidze <lekseulidze@cloudlinux.com> - 5.6.40-22.1.cloudlinux.5Vladimir D. Seleznev <vseleznev@cloudlinux.com> - 5.6.40-22.1.cloudlinux.4Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 5.6.40-22.1.cloudlinux.3Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 5.6.40-22.1.cloudlinux.2Dmitriy Popov <dpopov@cloudlinux.com> - 5.6.40-22.1.cloudlinux.1Tim Mullin <tim@cpanel.net> - 5.6.40-22Dmitriy Popov <dpopov@cloudlinux.com> - 5.6.40-22.cloudlinux.8Nikita Ivanov <nivanov@cloudlinux.com> - 5.6.40-22.cloudlinux.7Dmitriy Popov <dpopov@cloudlinux.com> - 5.6.40-22.cloudlinux.6Nikita Ivanov <nivanov@cloudlinux.com> - 5.6.40-22.cloudlinux.5Pavel Mayorov <pmayorov@cloudlinux.com> - 5.6.40-22.cloudlinux.4Pavel Mayorov <pmayorov@cloudlinux.com> - 5.6.40-22.cloudlinux.3Nikita Ivanov <nivanov@cloudlinux.com> - 5.6.40-22.cloudlinux.2Nikita Ivanov <nivanov@cloudlinux.com> - 5.6.40-22.cloudlinux.1Eduard Chiganov <echiganov@cloudlinux.com> - 5.6.40-22Travis Holloway <t.holloway@cpanel.net> - 5.6.40-21Dan Muey <dan@cpanel.net> - 5.6.40-20Nikita Ivanov <nivanov@cloudlinux.com> - 5.6.40-19.cloudlinux.3Eduard Abdullin <eabdullin@cloudlinux.com> - 5.6.40-19.cloudlinux.2Eduard Abdullin <eabdullin@cloudlinux.com> - 5.6.40-19.cloudlinux.1Travis Holloway <t.holloway@cpanel.net> - 5.6.40-19Eduard Abdullin <eabdullin@cloudlinux.com> - 5.6.40-18.cloudlinux.3Anatholy Scryabin <ascryabin@cloudlinux.com> - 5.6.40-18.cloudlinux.2Anatholy Scryabin <ascryabin@cloudlinux.com> - 5.6.40-18.cloudlinux.1Cory McIntire <cory@cpanel.net> - 5.6.40-18Eduard Abdullin <eabdullin@cloudlinux.com> - 5.6.40-17.cloudlinux.3Daniil Leonov <dleonov@cloudlinux.com> - 5.6.40-17.cloudlinux.2Eduard Abdullin <eabdullin@cloudlinux.con> - 5.6.40-17.cloudlinux.1Ivan Danilov <idanilov@cloudlinux.com> - 5.6.40-15.cloudlinux.6Tim Mullin <tim@cpanel.net> - 5.6.40-17Ivan Danilov <idanilov@cloudlinux.com> - 5.6.40-15.cloudlinux.5Nikolai Mikhno <nmikhno@cloudlinux.com> - 5.6.40-15.cloudlinux.4Ivan Danilov <idanilov@cloudlinux.com> - 5.6.40-15.cloudlinux.3Tim Mullin <tim@cpanel.net> - 5.6.40-16Nikolai Mikhno <nmikhno@cloudlinux.com> - 5.6.40-15.cloudl�x��������������`�������XWbmX�������H���������$w��������������������/V/NMSmEcE1XMOxFt9fX9T+XmKAWZ8L25lpILsHT3mB
VWrpHdbawUaiBp9elxhn6tFiTFR7qA7dlUyWrI+MMlINwSZ2AAXvmA2IajH/UIlh
xotxmSNiZYIQ6UbD3fk4wsFzBBABCgAdFiEEmy/52H2krRdju+d2+GQcuhDvLUgF
Ally44wACgkQ+GQcuhDvLUgkjQ//c3mBxfJm6yLAJD4s4OgsPv4pcp/EKmPcdztm
W0/glwopUZmq9oNo3VMMCGtusrQgpACzfUlesu9NWlPCB3olZkeGugygo0zuQBKs
55eG7bPzMLyfSqLKyogYocaGc4lpf4lbvlvxy37YGVrGpwT9i8t2REtM6iPKDcMM
sgVtNlqFdq3Fs2Haqt0m1EksX6/GSIrjK4LZEcPklrGPvUS3S+qkwuaGE/jXxncE
4jFQR9SYH6AHr6Vkt1CG9Dgpr+Ph0I9n0JRknBYoUZ1q51WdF946NplXkCskdzWG
RHgMUCz3ZehF1FzpKgfO9Zd0YZsmivV/g6frUw/TayP9gxKPt7z2Lsxzyh8X7cg6
TAvdG9JbG0PyPJT1TZ8qpjP/PtqPclHsHQQIbGSDFWzRM5znhS+5sgyw8FWInjw8
JjxoOWMa50464EfGeb2jZfwtRimJAJLWEf/JnvO779nXf5YbvUZgfXaX7k/cvCVk
U8M7oC7x8o6F0P2Lh6FgonklKEeIRtZBUNZ0Lk9OShVqlU9/v16MHq/Eyu/Mbs0D
en3vYgiYxOBR8czD1Wh4vsKiGfOzQ6oWti/DCURV+iTYhJc7mSWM6STzUFr0nCnF
x6W0j/zH6ZgiFAGOyIXW2DwfjFvYRcBL1RWAEKsiFwYrNV+MDonjKXjpVB1Ra90o
lLrZXAXCwHMEEgEKAB0WIQRMRw//78TT3Fl3hlXOGj3V48lPSQUCXAAgOgAKCRDO
Gj3V48lPSQxAB/43qoWteVZEiN3JW4FnHg+S60TnHSP69FKV+363XYKDa23pNpv4
tiJumo9Kvb4UoDft766/URHm5RKyPtrxy+wqotamrkGJUTtP2a68h7C31VX+pf6i
iQKmxRQz4zmW0pA5X01+AgpvcDH++Fv5NLBpnjqPdTh5b0gvr89E0zMNldNYOZu1
0H/mukrnGlFDu/osBuy+XJtP2MeasazVMLvjKs+hr//E+iLI9DZOwFBK6AX5gkkI
UEHkSeb4//AHwvanUMin9un9+F9iR+qDuDEKxuevYzM0owuoVcK5pAsRnRQJlnHW
/0BQ6FtNGpmljhvUk8a/l3xFf3z/uJG5vVKVzsFNBFb8EKsBEADDfCMsu2U1CdJh
r4xp6z4J89/tMnpCQASC8DQhtZ6bWG/ksyKt2DnDQ050XBEng+7epzHWA2UgT0li
Y05zZmFs1X7QeZr16B7JANq6fnHOdZB0ThS7JEYbProkMxcqAFLAZJCpZT534Gpz
W7qHwzjV+d13IziCHdi6+DD5eavYzBqY8QzjlOXbmIlY7dJUCwXTECUfirc6kH86
CS8fXZTke4QYZ55VnrOomB4QGqP371kwBETnhlhi74+pvi3jW05Z5x1tVMwuugyz
zkseZp1VYmJq5SHNFZ/pnAQLE9gUDTb6UWcPBwQh9Sw+7ahSK74lJKYm3wktyvZh
zAxbNyzs1M56yeFP6uFwJTBfNByyMAa6TGUhNkxlLcYjxKbVmoAnKCVM8t41TlLv
/a0ki8iQxqvphVLufksR9IpN6d3F15j6GeyVtxBEv04iv4vbuKthWytb+gjX4bI8
CAo9jGHevmtdiw/SbeKx2YBM1MF6eua37rFMooOBj4X7VfQCyS+crNsOQn8nJGah
YbzUDCCgnX+pqN9iZvXisMS79wVyD5DyISFDvT/5jY7IXxPibxr10P/8lfW1d72u
xyI2UiZKZpyHCt4k47yMq4KQGLGuhxJ6q6O3bi2aXRuz8bLqTBLca9dmx9wZFvRh
6jS/SKEg7eFcY0xbb6RVIv1UwGDYfQARAQABwsFfBBgBCAAJBQJW/BCrAhsMAAoJ
EPFlbyTHTNHYEBIQAJhFTh1u34Q+5bnfiM2dAdCr6T6w4Y1v9ePiIYdSImeseJS2
yRglpLcMjW0uEA9KXiRtC/Nm/ClnqYJzCKeIaweHqH6dIgJKaXZFt1Uaia7X9tDD
wqALGu97irUrrV1Kh9IkM0J29Vid5amakrdS4mwt2uEISSnCi7pfVoEro+S7tYQ9
iH6APVIwqWvcaty3cANdwKWfUQZ6a9IQ08xqzaMhMp2VzhVrWkq3B0j2aRoZR7BN
LH2I7Z0giIM8ARjZs99aTRL+SfMEQ3sUxNLb3KWP/n1lSFbrk4HGzqUBBfczESlN
c0970C6znK0H0HD11/3BTkMuPqww+Tzex4dpMQllMEKZ3wEyd9v6ba+nj/P1FHSE
y/VN6IXzd82s1lYOonKTdmXAIROcHnb0QUzwsd/mhB3jKhEDOV2ZcBTD3yHv8m7C
9G9y4hV+7yQlnPlSg3DjBp3SS5r+sOObCIy2Ad32upoXkilWa9g7GZSuhY9kyKqe
Eba1lgXXaQykEeqx0pexkWavNnb9JaPrAZHDjUGcXrREmjEyXyElRoD4CrWXySe4
6jCuNhVVlkLGo7osefynXa/+PNjQjURtx8en7M9A1FkQuRAxE8KIZgZzYxkGl5o5
POSFCA4JUoRPDcrl/sI3fuq2dIOE/BJ2r8dV+LddiR+iukhXRwJXH8RVVEUS
gpg-pubkeyc74cd1d856fc10abgpg(MariaDB Signing Key <signing-key@mariadb.org>)-----BEGIN PGP PUBLIC KEY BLOCK-----
Version: rpm-4.14.3 (NSS-3)

xsFNBFb8EKsBEADwGmleOSVThrbCyCVUdCreMTKpmD5p5aPz/0jc66050MAb71Hv
TVcfuMqHYO8O66qXLpEdqZpuk4D+rw1oKyC+d8uPD2PSHRqBXnR0Qf+LVTZvtO92
3R7pYnC2x6V6iVGpKQYFP8cwh2B1qgIa+9y/N8cQIqfD+0ghyiUjjTYek3YFBnqa
L/2h2V0Mt0DkBrDK80LqEY10PAFDfJjINAW9XNHZzi2KqUx5w1z8rItokXV6fYE5
ItyGMR6WVajJg5D4VCiZd0ymuQP2bGkrRbl6FH5vofVSkahKMJeHs2lbvMvNyS3c
n8vxoBvbbcwSAV1gvB1uzXXxv0kdkFZjhU1Tss4+Dak8qeEmIrC5qYycLxIdVEhT
Z8N8+P7Dll+QGOZKu9+OzhQ+byzpLFhUHKys53eXo/HrfWtw3DdP21yyb5P3QcgF
scxfZHzZtFNUL6XaVnauZM2lqquUW+lMNdKKGCBJ6co4QxjocsxfISyarcFj6ZR0
5Hf6VU3Y7AyuFZdL0SQWPv9BSu/swBOimrSiiVHbtE49Nx1x/d1wn1peYl07WRUv
C10eF36ZoqEuSGmDz59mWlwB3daIYAsAAiBwgcmN7aSB8XD4ZPUVSEZvwSm/IwuS
Rkpde+kIhTLjyv5bRGqU2P/Mi56dB4VFmMJaF26CiRXatxhXOAIAF9dXCwARAQAB
zS1NYXJpYURCIFNpZ25pbmcgS2V5IDxzaWduaW5nLWtleUBtYXJpYWRiLm9yZz7C
wXgEEwEIACIFAlb8EKsCGwMGCwkIBwMCBhUIAgkKCwQWAgMBAh4BAheAAAoJEPFl
byTHTNHYJZ0P/2Z2RURRkSTHLKZ/GqSvPReReeB7AI+ZrDapkpG/26xp1Yw1isCO
y99pvQ7hjTFhdZQ7xSRUiT/e27wJxR7s4G/ck5VOVjuJzGnByNLmwMjdN1ONIO9P
hQAs2iF3uoIbVTxzXof2F8C0WSbKgEWbtqlCWlaapDpN8jKAWdsQsNMdXcdpJ2os
WiacQRxLREBGjVRkAiqdjYkegQ4BZ0GtPULKjZWCUNkaat51b7O7V19nSy/T7MM7
n+kqYQLMIHCF8LGd3QQsNppRnolWVRzXMdtR2+9iI21qv6gt�x������������� P�������XX~l!P�V��$F����������������V�U�W��8ac017d23742ba33b06e79a048581419f4af45ad9bd24b86bb275f20d25dd4a45af1032e4786ffda9d6995337e8a6419f4af45ad9bd24b86bb275f20d25dd4a45af1032e4786ffda9d6995337e8a67ff61f29b4cd18f489818cdc2ad9ead6c835936f8c312158dbbbabe9f2d540037ff61f29b4cd18f489818cdc2ad9ead6c835936f8c312158dbbbabe9f2d540035f4a0ef4d7220920b58c29211549f245c2b0ca56f919b2c4358cec66e3ef923006b558609a0ab85c76b8e7d39ec84ad57f51232cb6e04602dde1cda5e6eb2183b432f51c28d993a2ec1583ef9580b0ce94c2cb05307fbe22913b7cbeb2b4c1acb5a32a68597e7c03ba7cd4e505156ae7d18c23c083db52e0cedcf47976bc0fc3b5a32a68597e7c03ba7cd4e505156ae7d18c23c083db52e0cedcf47976bc0fc3159d8b64af9886b8dbbfd969fa47d308cc1dd8c9ae6421b0a29f0d76246b6092159d8b64af9886b8dbbfd969fa47d308cc1dd8c9ae6421b0a29f0d76246b60925db64d5b9f00114acbc1e819ce3ff5a8dc855ed92d90340b707631c7959bc5694a5b156a5165263daa80bbf84b2b6b02cd2c4ea5897fcd2321c328f82f2a7e7cafe4e90a80cca3d41cad55311bc68ee5bfff131a538e10831077daee5661769aafe4e90a80cca3d41cad55311bc68ee5bfff131a538e10831077daee5661769a8febb6b9228f3d6ae4dfeaa341c39ebb826a33572261e0321756f05ed3e6d0698febb6b9228f3d6ae4dfeaa341c39ebb826a33572261e0321756f05ed3e6d06984cb5ad7b671f669eac95b36a8b13cae93ba2bdf97d6cdbb284098d96ae1f2d484cb5ad7b671f669eac95b36a8b13cae93ba2bdf97d6cdbb284098d96ae1f2d453f46e704f5189656d327c47999d617308e1f75d1d36075cd12ce119f2c840f753f46e704f5189656d327c47999d617308e1f75d1d36075cd12ce119f2c840f77c38cdee55ae261a857bc8f9459d2eeddcbbb59e9efa48804c153d50780da7247c38cdee55ae261a857bc8f9459d2eeddcbbb59e9efa48804c153d50780da724eb5d7974efe7ebaac1c47f30fb55a2a18e2891f3fd6418e1328e5ebab0a39d18a5b425cd73852b6b1560f0f260ea7744a9ce338c313468d96f65c1b7938f09fefdacbe0d7d5ce63196a8df42815472eab5217744d5777dfaae4420bdbf116c25fdacbe0d7d5ce63196a8df42815472eab5217744d5777dfaae4420bdbf116c25afd67fa8d4bcae9210992d9c646ce745ff2d6a72e76af926a03c6b57091b9b09b7b3334c0b36e6ec7275b6567b6a2f262502c1249adafc99ecff99cff063b27a20067d533b293a2fd5d942f737c79e330f768e533136ac6843e1dc936157c4aa20067d533b293a2fd5d942f737c79e330f768e533136ac6843e1dc936157c4aa658a771122f411ef66d09dedf21f209bd0f9b4499c10ae4ed28673ce10d648ebd5e014753d8fc1a596f2e0b0ff5810a1df0a3cde93cfb62474f445c662c433f155523f212effbdebbd405b64d644eaf3e3580b876fb471639ac42eb31dadf136bf2c5ce9831d4d1f1a79ae485ba83cda1be2b439e48d3a8b99b019f39ffa8100d99f2b8291d74d5c1674aae8e39eeb2f1c10a762dd654b9ca5f6feda38e9ee84a49531d50a303892b9a6279e44fdec1ee988ded9d869b0ca8c0f300c7c0586e1a49531d50a303892b9a6279e44fdec1ee988ded9d869b0ca8c0f300c7c0586e15efa358d04da67c200b3ab3771c97291f27b668913967cba2a2570eb249789ec5efa358d04da67c200b3ab3771c97291f27b668913967cba2a2570eb249789ecb02989d9757761a6194323b3c591f1e9e6b807e8d7b996f648d41c311ab8a440b02989d9757761a6194323b3c591f1e9e6b807e8d7b996f648d41c311ab8a4409d140f48831e80595f632a6cc1237a6330889b2f552861e6eb92810420fa5eda9d140f48831e80595f632a6cc1237a6330889b2f552861e6eb92810420fa5edae65475d1fe00e58067053cbb7a50ca7a8ccacf0f5d82b0832c197fde52c947dbe65475d1fe00e58067053cbb7a50ca7a8ccacf0f5d82b0832c197fde52c947db25cc5b9fddfa920c1d5e2e2843e2d050af79a64e2541552676b038b8f3b2fda525cc5b9fddfa920c1d5e2e2843e2d050af79a64e2541552676b038b8f3b2fda5efac97f5d5d3c0113a100a162e7960b8996f8268597a107d724d15b43cdbd668efac97f5d5d3c0113a100a162e7960b8996f8268597a107d724d15b43cdbd668aae566eca5535890f2693b1e51555da5aa5b493d11e125c168d665e3839e2059c2ff6c98ad9209856950ad7967162bbe0046b710f8ef15e9d6f25a59e0aa526d3029232bd692e962aa335657ef6fd82b108c2d201410070a6ce2a8252cd8d8f23029232bd692e962aa335657ef6fd82b108c2d201410070a6ce2a8252cd8d8f25f8139bfaf8b9ffb1f63fc946b8f071a2dc03d4853e1414ff1365942a61caea35f8139bfaf8b9ffb1f63fc946b8f071a2dc03d4853e1414ff1365942a61caea3ca2bd51e217cf1b5b88a1c25a0d8f582c61fff6ff61c1cc0490b516d9a75b141ca2bd51e217cf1b5b88a1c25a0d8f582c61fff6ff61c1cc0490b516d9a75b141684fecc1790f8b802a8a2f37756a317ec2e6984747b2e375b1e7f0cb53516910684fecc1790f8b802a8a2f37756a317ec2e6984747b2e375b1e7f0cb53516910cfc203b0fdfec26a02144f20b8d2e65c9722403937bbbbc69501ed725e08cfaacfc203b0fdfec26a02144f20b8d2e65c9722403937bbbbc69501ed725e08cfaaa6b74e�x��������������?�������XYl*8 ���������$�����������������������8eab1819685372c4421119b5b857360f6f3fd34a4dabd4cee8b4e2164c3d32ea8340a59bf06942db5477621f4b3554931c195488d8236ac499122dcb59b1261261c2ce5d4c1571f5bf827e81251e2a9db2c846d9540a33fcc87302d611aec6b0ef9a5a2607a332b6bdd4c5c148df5ae5e23a313e4c8721f76b3d780f518c69bc343d463acdadd1dc7d8fcd504465693302ef9878bd89a439b08a9e84552da9805af0594a2d4aea40d50d6b96926a391a3ec6d8e4e26c0287b2fab7eb5a4bf71fd7a8f5563aa9e96ba35e0b12648387717950fa0c55cf4cc407cc19ad809294a2b89a18240968166cf2152b456f04c79f202232ceb37fc7f1facec08974de8574c99cdfdf70c9252f7b02337d0ee1c1a2303d3720b6c674a5193b4bab2ade2f9af1310521e1848ca5decbb19535877ccc12c654dad79063a2a589a8b95ef147f482c33f21717e8e6cd2501f350e749fae1a7351593b889533046deb033609af8fd03dad6b60b791e5465f73e7fe2361e44523f6a30bd20ff6f8ea22e4b781e3d0e4a4eb092b5628ab05e653bcce4564945c6230d4f3c90929ec0b0f4f9062eb81686188a3dc0f15ea6599af566e44bf878f8e4b2c8006bbd9a756203b7c0cf9eb85a3dc89723cb266405540e0d903297126307c85f77b643544e539f3e1952d46eeeb3b07b5290adbe88dd8e7119c4b07e9e673335915c2cc99fc6fecfc01e2bcd4e912575fe2a9ea4781e7520e38a926c8d26e4cf84b50127664b7fdc47f2686b498fc7b8570a0905310fc39bb7addc45f646a7e34fbc2bf43adfc45ce530c023100f9d11587c87cb61589b2c024f8ef734d144f4f8cc4d59387d131755f3dd7d27ffbf4514e1bdf01bad2d602f02deb463222e14c393c3c77a0880924e1f1c73b71e0d8bb3f173832a1f7bb0c1b5d7cc96f8f3815575972d7a9633eeee95525da3a2d09dc9ec649f76647b034aa863ef3486a590454d7502d1ec6c287ff38cbd55cfd694c4fe4308734e06e51438264c88850c847cfbcae3b030d66af9eb27fea057b4ccf7193d92be065b27056e746576cbb720228f464be1f05f1ded00533cb7bec17c3b36e7e0c774fe6aab4471c3ee468b4bdd4cd4d8fec467652d5495e65858333bdd7cc852c23766c1530febe67e8a2651cf34da013fd62f63e8d98677acf9c6dfa8b3f471c18cff86abb395bf77f5f86ad097258e2384d32c7e8ea5223bc5da432056e1dccd4f16d0a2b09bba93c2b297926513ed64ce5b92049ba75462bf1e1b69a54a4cf43ecb168fbe4e331bfce9be065ed8ce0c940cb454079523896b2fd38536227ed1207193e83ceeacafd8dfef69c8b42a54863504a7dba945383b51f8c4a3914a1d6ede6938163ee398015b3a0e896ca00d1cde9717895f1d420a24a51e146b35719305750499ace79374e8088a4c3776a619fc0d43b8762293927375d43aec8ea57504e74aaa1cd7a1435acfd3099db67f1bbcf675855a21cb1d56b5ee7c6e31a514d6dc609f161e11cf801dc72ed915c7a0e4a9c5dafe1bc17015a69ea26edbe05eb719bba8d7c09067d6d1240211f6a6c427f1a87ac850f8c01185a67a5bb960981bd5b0b40b14b95440787f580d741b170e854f47fe5ed0f67123e224a93ccb2065760fb9ce80b4c7e00ad6abc032b4c5c5d2c92a9e52ecfcf7fbbad6bc799ad741c8a386b4d028caaa80cd99c14a65e6f9d6fd370bcbb7a0a28afe211bb8a22da799e7d526a38ad8854cb76bc98d738d135a7c188e41cba43cd0b80a9cb9321b5d28f0c013b99a7c49cdb08a0ea830571296b65f29b68e4a0466dceb9e58e64853d30dfb7f5c646debee9d90bb900397440882400165b617b9af34871e2b9f764ca6bc6c54175c924987fe8378e4988f938488f33126766273838a4304d75bf6d568616dede93796972f89951affae6d12b45b5ca0345ac7b117414aeeaa77c11194e0cd540f7bfa7bdc00f88c8f1018a96753359284c114d93fc957bc5153b0ef4ec146d764f3fabbdd80103e1f4940758596afde6fc775e8127af742a7fbbb0a6481dac0589f8ce2804457de3502249c4042d1cc71215d58bcd6f98158853a105df448b6f9fd3f4863614e5806114c9c9f176d55a796a166cd61d3aa3c489344755a117787a4214b626e9ee32ba2eaef0a7a695c59aa230abad4b340bdd52061340d2283a33edcc303fc5a7042f203cead2d2998aad6f63e0683589fe568daf21fdbd70aab943a364fd11ca212423f6c6626d5398c273ec908ba33f81c986f2f6f006e80cdb5326bb2b663addd4b4da47a696edbe2b39f2379e4f3c776db7fa7f36367825ff7f0eaf568e050f1e0a429b49e77137e083668e034a43290d5e6f9e9c4633737bb86728a94b932169a169a097d54477c0b4b692e0489bfcaa559737a898f1fa4cfdb859ff442d332a9024ee7c4c0b5b1b9c1c7e70f51e59d01182c6a939a17707d75720ca7db0b90202f2431c97ec4accb7e56ecdc5e15c71e8275df7da1ee7071b79f4c39a3ec0d3d379827c67660354f4d9bbe0b338cb56c9adf806cc8d0a003d2f9a7698a86851fdd7c00ffdfe94de99662fd40fe4f8f00126b7cc5c533f45edfc38838bfff88239549ae18d11cad64ba0946ffc0be02a9487a23aeac3dff3c99dcd09304318438bd8068d710618745d131d2bc287b6d280abd5275cd80fac34d12d82190a04af345ca2c1cca68fff266885c32de6e08a708ae8ef26b1cebc66c81fe177d89437738861b614669008f8a76bd2748c6293677ccc8779dfeda16647f9157dfa22b4346075cb23233360a36fb0d1c232129412566f50d3c799662c�x�������������/�������XZ�k��������������֧�$F����������������֧էP��ild for new libimobiledevice and usbmuxd- Update to 1.12.0- Update to 1.11.5- Update to 1.11.4- Update to 1.11.3- Exclude the obexftp package from s390 builds- Rebuilt for new libarchive- Add udisks2 runtime Requires- Prelease that works with udisks2- Update to 1.11.2- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Update to 1.11.1- Rebuilt for new libbluray- Rebuild for libcdio-0.83- Rebuild for new libarchive- Rebuilt for glibc bug#747377- Update to 1.11.0- Update to 1.10.1- Update to 1.10.0- Update to 1.9.5- Update to 1.9.4
- New AFP backend in separate subpackage- Update to 1.9.3
- Drop obsolete patches
- Clean up spec a bit- Update to 1.9.2
- Enable real statfs calls in the fuse daemon- Update to 1.9.1- Update to 1.9.0- Update gsettings scriptlet- Update to 1.8.1- Build without HAL -> expect obexftp breakage.- Fix threadsafety of closing channels
- Fix d-bus messages leaks
- Fix /dev symlink checks in gdu volume monitor- Update to 1.8.0- Update to 1.7.3- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Update to 1.7.2- Update to 1.7.1- Update to 1.7.0- Update to 1.6.5
- Drop upstreamed patches- Use correct "usb:" address for GPhoto mounts with gudev (#642836)- FUSE: Add O_TRUNC support for open()- Fix sftp poll timeout- Update to 1.6.4- Fix smb daemons deadlock due to GConf initialization- s390(x) machines can't connect mobile phones or players- Update to 1.6.3- Update to 1.6.2- Fix Nautilus 100% CPU after trashing a file with an emblem (#584784)- Explicitly require minimal glib2 version (#585912)- Update to 1.6.1- Use update-gio-modules- Update to 1.6.0- Fix build with new libimobiledevice
- Don't mount both gphoto and AFC mounts on AFC devices- Rebuild for new stable libimobiledevice- Update to 1.5.5- Re-add missing service files- Update to 1.5.4- sftp: fix crash on unmount- Update to 1.5.3- ftp: backport several PASV/EPSV fixes from master (#542205, #555033)- AFC: Use new libimobiledevice library- Fix AFC build against new libiphone- Update the GIO module cache- Update to 1.5.2- Rebuild for libcdio-0.82- Avoid crash on race to mount gvfstrash (#555337)
- Nuke HAL volume monitor- Don't leak mount job operation (#552842)
- Recognize gphoto2 cameras which don't implement get storageinfo (#552856)
- ObexFTP: Use a private D-Bus connection for obex-data-server (#539347)- Rebuilt against new libiphone- Metadata fixes
- SMB: Fix free space calculation for older samba servers
- fuse: Fix setting timestamps- Update to 1.5.1
- AFC: temporarily disable setting file modification times- Add obsoletes for gnome-mount- Add obsoletes for gnome-vfs2-obexftp- SMB: Support querying filesystem size and free space- gdu-volume-monitor: don't crash on NULL devices (#529982)- Reload .mount files when single package is installed- Update to 1.4.1- HTTP: Support g_file_input_stream_query_info()
- HTTP: Use libsoup header parsing function
- Set correct MIME type for MTP music players- Fix crasher in ObexFTP (#528181)- Don't always overwrite on trash restore
- Separate "Safely Remove Drive" from "Eject"
- Don't advertise can_poll for drives not using removable media
- Disallow mounting empty drives
- Disallow ejecting empty drives
- Silently drop eject error messages when detaching drive- Fix Nautilus not displaying friendly icons for SSH-connected system (#526892)
- Actually apply the logical partitions patch- Consider logical partitions when deciding if a drive should be ignored- Fix the lack of icons in the http backend- Update to 1.4.0- Rebuilt with new fuse- Update to 1.3.6- Don't mount interactively during login- Update to 1.3.5- Fix Nautilus can't create "untitled folder" on sftp mounts (#512611)- Update AFC patch- More complete fix for DAV mount path prefix issues- Fix crash on startup for the afc volume monitor- libgudev-devel is required for the gphoto2 monitor- Add AFC backend- Update to 1.3.4- Fix bad mount prefix stripping (part of #509612)
- Fix gvfsd-sftp segfault when askin�x���������������������X[�k����������
?��$/����������������?�>�@�� bcache tests on CentOS/RHEL 7 (vpodzime)
- Use six.assertRaisesRegex in the FS tests (vpodzime)
- Use mkdtemp() instead of TemporaryDirectory() (vpodzime)
- Fix installation without specifying --exec-prefix (vpodzime)
- Add options to force mkfs.ext4/vfat to create a FS on the whole device (vpodzime)
- Skip the test for device escrow on CentOS/RHEL (vpodzime)
- Define DEVNULL on our own if not in subprocess (vpodzime)
- Remove the patches from the spec file (vpodzime)
- Sync the spec file with downstream (vpodzime)
- Stop skipping zRAM stats tests (vtrefny)
- Add more tests for zRAM stats (vtrefny)
- Fix reading zRAM properties from sysfs (vtrefny)- Do not try to parse 'raid_spec' for 'bd_md_activate' (vtrefny)
  Resolves: rhbz#1439111- Make sure the returned thpool MD size is valid (vpodzime)- Move the  part_err library before part and fs (vtrefny)
- Fix BuildRequires for crypto and dm packages (vtrefny)
- Fix mounting read-only devices (vtrefny)
- Fix the bd_s390_dasd_is_ldl function. (vponcova)
- Add the bd_s390_dasd_is_fba function to check if DASD is FBA (vponcova)
- Disable MD RAID tests on 32bit systems (vpodzime)
- Fix error message when mounting with a wrong fs type (vtrefny)
- Only create RPMs for requested/configured  plugins (vpodzime)
- Only check dependencies of plugins to be built (vpodzime)
- Only build and distribute plugins if configured so (vpodzime)
- Fix format-security and unused-result compiler warnings (vtrefny)
- Add an AC macro for modular builds (vpodzime)
- Add functions for mounting and unmounting filesystems (vtrefny)- Do not try to get GVariant after not adding anything to its builder (vpodzime)
- Replace NULL with "" when building ExtraArg (vpodzime)
- Replace NULL with "" when adding it as a 's' GVariant (vpodzime)
- Make sure we don't try to add NULL as GVariant to DBus params (vpodzime)
- Add function for getting recommended thpool metadata size (vpodzime)
- Make udev settle after we create a LIO device (vpodzime)
- Always use '--yes' for lvremove (vpodzime)- Update specs.rst to use present-tense and current API (agrover)
- Add functions using BLOBs as LUKS passphrases (vpodzime)
- Make sure the _error_quark() functions are in the library (vtrefny)
- Return a special error when trying to wipe empty device (vtrefny)
- Adapt tests to use LIO devices instead of loop devices (vpodzime)
- Add functions for creating and deleting LIO devices (vpodzime)
- MDRAID: Allow path as input for functions that work with sysfs (vtrefny)- Rebuild with changelog fixed up- Allow specifying raid 'name' in multiple way when calling md functions (vtrefny)
- Allow using both path and raid name in bd_md_set_bitmap_location (vtrefny)
- Fix potential memory issues in s390 sanitizate functions (vpodzime)
- Try multiple times when probing device for wiping (vpodzime)
- Check for libvolume_key.h and dmraid.h in configure.ac (vpodzime)
- Define our own macro for testing required header files (vpodzime)
- Include blockdev/utils.h in mdraid.h (vtrefny)
- Fix misspelling (agrover)
- Skip the bcache tests even on x86_64 (vpodzime)
- Take a break between bcache creation tests (vpodzime)
- Make sure ./configure fails if there are some soft failures (vpodzime)
- Improve the error message on missing GI support (vpodzime)
- Only require bcache-tools if supporting bcache (vpodzime)
- Skip bcache tests on non-x86_64 architectures (vpodzime)
- Try harder to register a new bcache device (vpodzime)
- Reimplement swapon/swapoff functions by using syscalls (vpodzime)
- Make sure bcache functions are correctly provided or not (vpodzime)
- Changelog fixup (vpodzime)- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Rebuild with changelog fixed up- Use the .in file as source when bumping version (vpodzime)
- Run pylint based on the python version and make it optional (vpodzime)
- Disable python3 and bcache on RHEL (vpodzime)
- Make bcache support optional (vpodzime)
- Teach boileplate_generator.py to skip things based on patterns (vpodzime)
- Require lower versions of some utilities�x��������������������X\rl���������!��$`�������������������Gx�?tHd����	�	B�\�`�x�|�������	����
�j�j	�j
hjj zj
!$j"�j$�j&�'j(�(�),*�(*�8*�%9+D%:2�%GP�jHRljITjXU\YUh\U�j]W(j^][ibkdlcelhflkllmtl�jun0jvo�wp|jxr$jys��s��s��t�tDtXt\�u�v�
w�w��xxjx�gx�hx�Clibbytesize1.43.el8A library for working with sizes in bytesThe libbytesize is a C library that facilitates work with sizes in
bytes. Be it parsing the input from users or producing a nice human readable
representation of a size in bytes this library takes localization into
account. It also provides support for sizes bigger than MAXUINT64.^��,build.cloudlinux.com̕CloudLinuxCloudLinuxLGPLv2+CloudLinux Packaging Team <packager@cloudlinux.com>Unspecifiedhttps://github.com/storaged-project/libbytesizelinuxx86_64*~ gP���-���D������0������������������1������������	$%�(	������������������@���0%���������������A�A�����A큤A큤��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������^��+^��+^��+^��*^��+^��+Z؀�^��+Z؀�^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(^��(ee026404d5a873fe8e4a1b171295626098540090454fb7b4b787995c0dbddb0d872b71ce5f2bd75582e131ddb6dc914a73e2326118220bc06ad907bd578b299697bdc721d875501b6243a456333fdfdb1ab64d31c4da2554de845caf4674b946571d63af5890afd28bedae32f4f3a243ec43e8582965eac69ee6ed69f66e8655eb124a8193464c0568b1309d9db47afabb5facbbe48716130898b533d7185091bfc92270d1c6a1c48a293696ebe9a8a482995fbeb41d0e30d49f514ba010fca3be9d39e4c817837cc91eab9bf74a1a502a390d109481e0d025bd2d1916cf59bde1781804db675840d1e29a85c47cf514eede8c63b580c7de86c5a7bbdf997dc520ea448c4061e17139c55aa50ff1381d8001cc182979974ddf3d4b945714285bedb30d16242354e1163c55b8d196ec84e9262eac8c4cb8bca4adcd0e35e7b69c3f7d12df3545a46047507467e915d16775b0a7dd62e9e9fee3b5f712eda0ae7bc8dfbce50b4022ad576ea9cdb6e91bc820329ef75510cd0dfebf21b2c46dd3a13a52de57054f96ca4b0f1f2bcd921690d0ece234ac70f6dbf26b139d1bfdd4c37001c87a7317ed662c85bfe7c5c1ed2c5c5b49f4d4c53a7d8628495d46730e872a5886f8f1d8cd48696e9d54eed2b83354b20ff1e8a9eb126e744e26bbb7d26c21c0e959e26fca1455b0b7dabf7ed613275a76d1e30673ed1975f45fa6855f9b04a3bb71ec487fe16b5d9d7d06e38d769b971e3e9f5d5d358905f24b947beca2269c294�x�����Hj������(��������X�l��������&L�$6����������������&L%L'L�r new behavior- add mysqlnd sub-package
- drop patch4, use --libdir to use /usr/lib*/php/build
- add patch to redirect mysql.sock (in mysqlnd)- update to 5.3.8
  http://www.php.net/ChangeLog-5.php#5.3.8- update to 5.3.7
  http://www.php.net/ChangeLog-5.php#5.3.7
- merge php-zts into php (#698084)- rebuild for net-snmp SONAME bump- enable mhash extension (emulated by hash extension)- rebuild for new MySQL client library- update to 5.3.6
  http://www.php.net/ChangeLog-5.php#5.3.6
- fix php-pdo arch specific requires- disable zip extension per "No Bundled Libraries" policy (#551513)- rebuild for icu 4.6- fix systemd-units requires- add tmpfiles.d configuration for php-fpm
- add Arch specific requires/provides- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- update to 5.3.5
  http://www.php.net/ChangeLog-5.php#5.3.5
- clean duplicate configure options- rebuild against MySQL 5.5.8
- remove all RPM_SOURCE_DIR- security patch from upstream for #660517- update to 5.3.4
  http://www.php.net/ChangeLog-5.php#5.3.4
- move phpize to php-cli (see #657812)- ghost /var/run/php-fpm (see #656660)
- add filter_setup to not provides extensions as .so- use mysql_config in libdir directly to avoid biarch build failures- rebuild for new net-snmp- add php-fpm sub-package- PHP 5.3.3 released- garbage collector upstream  patches (#580236)- rebuild for icu 4.4- PHP 5.3.2 Released!
- remove mime_magic option (now provided by fileinfo, by emu)
- add patch for http://bugs.php.net/50578
- remove patch for libedit (upstream)
- add runselftest option to allow build without test suite- update to v7 of systzdata patch- fix build with autoconf 2.6x- update to 5.3.1
- remove openssl patch (merged upstream)
- add provides for php-pecl-json
- add prod/devel php.ini in doc- use libedit instead of readline to resolve licensing issues- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- rediff systzdata patch- update to v6 of systzdata patch; various fixes- update to v5 of systzdata patch; parses zone.tab and extracts
  timezone->{country-code,long/lat,comment} mapping table- update to 5.3.0
- remove ncurses, dbase, mhash extensions
- add enchant, sqlite3, intl, phar, fileinfo extensions
- raise sqlite version to 3.6.0 (for sqlite3, build with --enable-load-extension)
- sync with upstream "production" php.ini- update to 5.2.10
- add interbase sub-package- update to 5.2.9- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add recode support, -recode subpackage (#106755)
- add -zts subpackage with ZTS-enabled build of httpd SAPI
- adjust php.conf to use -zts SAPI build for worker MPM- fix patch fuzz, renumber patches- drop obsolete configure args
- drop -odbc patch (#483690)- split out sysvshm, sysvsem, sysvmsg, posix into php-process- move wddx to php-xml, build curl shared in -common
- remove BR for expat-devel, bogus configure option- rebuild for new MySQL- libtool 2 workaround for phpize (#476004)
- add missing php_embed.h (#457777)- update to 5.2.8- libtool 2 workaround- update to 5.2.7
- enable pdo_dblib driver in php-mssql- tweak Summary, thanks to Richard Hughes- move gd_README to php-gd
- update to r4 of systzdata patch; introduces a default timezone
  name of "System/Localtime", which uses /etc/localtime (#469532)- enable XPM support in php-gd
- Fix BR for php-gd- enable T1lib support in php-gd- update to 5.2.6
- sync default php.ini with upstream
- drop extension_dir from default php.ini, rely on hard-coded
  default, to make php-common multilib-safe (#455091)
- update to r3 of systzdata patch- split pspell extension out into php-spell (#443857)- Autorebuild for GCC 4.3- ext/date: use system timezone database- rebuild for libc-client bump- Rebuild for openssl bump- update to 5.2.5- correct pcre BR version (#333021)
- restore metaphone fix (#205714)
- add READMEs to php-cli- update to 5.2.4- rebuild for fixed APR- add ldconfig post/postun for -embedded (Hans de Goede)- add php-embedded sub-p�x��������������������X^�l��D
�4�${�����������������4�4�4�fore we are
  first started (same as #636876)- don't try to "close" our shared connection to the bus when the bus
  hangs up on us -- at some point libdbus started abort()ing when we try
  that (#634356)- documentation tweaks for man pages- drop the shared library and python bindings, which so far as i can tell
  weren't being used, obsoleting them to avoid a mess on upgrades
- move the mkhomedir helper from %{_libdir}/%{name} to
  %{_libexecdir}/%{name} to make the multilib configuration files agree
  (#559232)
- use %global instead of %define- show that we implement force-reload and try-restart in the init script's
  help message (#522131)- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Rebuild for Python 2.6- when we install the mkhomedir subpackage, if there's a running oddjobd, ask
  it to reload its configuration
- fix missing bits from the namespace changes in configuration files
- restart the service in %postun- Autorebuild for GCC 4.3- split off mkhomedir bits into a subpackage (#236820)
- take a pass at new-init-ifying the init script (#247005)- move helpers to libexecdir, keeping pkglibdir around in the package (#237207)- split off python subpackage, make -devel depend on -libs, let autodeps
  provide the main package's dependency on -libs (#228377)- configure with --disable-dependency-tracking (Ville Skyttä, #228928)- unmark the init script as a %config file (part of #197182)- rebuild- rebuild- rebuild- rebuild- rebuild- update to 0.27-1:
  - don't attempt to subscribe to all possible messages -- the message bus
    will already route to us messages addressed to us, and if we try for
    more than that we may run afoul of SELinux policy, generating spewage
- add a build dependency on pkgconfig, for the sake of FC3
- update docs and comments because D-BUS is now called D-Bus- rebuild- rebuild- rebuild- update to 0.26-1:
  - don't get confused when ACL entries for introspection show up in the
    configuration before we add the handlers for them
  - export $ODDJOB_CALLING_USER to helpers- add recommended dependency on pkgconfig in the -devel subpackage- rebuild- rebuild- rebuild- rebuild- rebuild- rebuild- rebuild- update to 0.25:
  - add introspection for parents of objects specified in the configuration
  - oddjobd can reload its configuration now
  - add -u (umask) and -s (skeldir) flags to the mkhomedir helper (#246681)- update to 0.24, fixing some build errors against D-BUS 0.30-0.33
- require xmlto, because the generated HTML differs depending on whether
  or not we know how to enforce ACLs which include SELinux context info
- build with DocBook 4.3- rebuild- rebuild- fix compilation against older versions of D-BUS if the
  GetConnectionSELinuxSecurityContext method turns out to be available- fix some path mismatches in the sample configuration files
- don't try to set a reconnect timeout until after we've connected- prefer BuildRequires: to BuildPrereq (#176452)
- require /sbin/service at uninstall-time, because we use it (#176452)
- be more specific about when we require /sbin/chkconfig (#176452)- add some missing build-time requirements- fix the location for the sample D-BUS configuration doc file
- own more created directories- update to 0.20
- break shared libraries and modules for PAM and python into a subpackage
  for better behavior on multilib boxes
- if we're not building a sample subpackage, include the sample files in
  the right locations as %doc files/bin/sh/bin/sh/bin/shoddjob-develoddjob-libsoddjob-python/bin/sh	

 !"#$%&0.34.7-3.el80.34.7-3.el80.34.7-3.el80.300.300.30�x�������������h�������X_�l��������P�����6��$&����������������6�7�5����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������libSvtAv1Dec.so.0()(64bit)libSvtAv1Enc.so.0()(64bit)svt-av1-libssvt-av1-libs(x86-64)@@@@@@@@@@@@@



@libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libm.so.6(GLIBC_2.27)(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libpthread.so.0(GLIBC_2.3.2)(64bit)libpthread.so.0(GLIBC_2.3.4)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.3`�R@_��}_���_�m�_%Y@_!d�^��^��^7@^4�]��9]��]�}�]�@]<<�]�]�HRobert-André Mauchin <zebob.m@gmail.com> - 0.8.7-1Robert-André Mauchin <zebob.m@gmail.com> - 0.8.6-1Andreas Schneider <asn@redhat.com> - 0.8.5-2Robert-André Mauchin <zebob.m@gmail.com> - 0.8.5-1Fedora Release Engineering <releng@fedoraproject.org> - 0.8.4-3Fedora Release Engineering <releng@fedoraproject.org> - 0.8.4-2Robert-André Mauchin <zebob.m@gmail.com> - 0.8.4-1Robert-André Mauchin <zebob.m@gmail.com> - 0.8.3-1Robert-André Mauchin <zebob.m@gmail.com> - 0.8.1-1Fedora Release Engineering <releng@fedoraproject.org> - 0.8.0-2Robert-André Mauchin <zebob.m@gmail.com> - 0.8.0-1Robert-André Mauchin <zebob.m@gmail.com> - 0.7.5-1Robert-André Mauchin <zebob.m@gmail.com> - 0.7.0-1Vasiliy Glazov <vascom2@gmail.com> - 0.6.0-3Fedora Release Engineering <releng@fedoraproject.org> - 0.6.0-2Robert-André Mauchin <zebob.m@gmail.com> - 0.6.0-1Robert-André Mauchin <zebob.m@gmail.com> - 0.5.0-1.20190620gitcc2ee45- Update to 0.8.7
- Close: rhbz#1983484- Update to 0.8.6
- Close: rhbz#1902481- Add patch to fix building on modern Linux system- Update to 0.8.5
- Close: rhbz#1876641- Second attempt - Rebuilt for
  https://fedoraproject.org/wiki/Fedora_33_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_33_Mass_Rebuild- Update to 0.8.4 (#1851799)- Update to 0.8.3- Update to 0.8.1- Rebuilt for https://fedoraproject.org/wiki/Fedora_32_Mass_Rebuild- Release 0.8.0 (#1785814)- Release 0.7.5 (#1776119)- Release 0.7.0- Added gstreamer plugin- Rebuilt for https://fedoraproject.org/wiki/Fedora_31_Mass_Rebuild- Release 0.6.0- Initial release�x���������������������X`1mX��������������$��$4����������������$�#�%��i Collet <Fedora@famillecollet.com> 5.3.6-3Remi Collet <Fedora@famillecollet.com> 5.3.6-2Remi Collet <Fedora@famillecollet.com> 5.3.6-1Joe Orton <jorton@redhat.com> - 5.3.5-6Caolán McNamara <caolanm@redhat.com> 5.3.5-5Remi Collet <Fedora@famillecollet.com> 5.3.5-4Remi Collet <Fedora@famillecollet.com> 5.3.5-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.3.5-2Remi Collet <Fedora@famillecollet.com> 5.3.5-1Remi Collet <rpms@famillecollet.com> 5.3.4-2Remi Collet <rpms@famillecollet.com> 5.3.4-1.1Remi Collet <Fedora@famillecollet.com> 5.3.4-1Remi Collet <Fedora@famillecollet.com> 5.3.3-5Joe Orton <jorton@redhat.com> - 5.3.3-4Joe Orton <jorton@redhat.com> - 5.3.3-3Remi Collet <Fedora@famillecollet.com> 5.3.3-2Remi Collet <Fedora@famillecollet.com> 5.3.3-1Remi Collet <Fedora@famillecollet.com> 5.3.2-3Caolán McNamara <caolanm@redhat.com> 5.3.2-2Remi Collet <Fedora@famillecollet.com> 5.3.2-1Joe Orton <jorton@redhat.com> - 5.3.1-3Joe Orton <jorton@redhat.com> - 5.3.1-2Remi Collet <Fedora@famillecollet.com> 5.3.1-1Tom "spot" Callaway <tcallawa@redhat.com> - 5.3.0-7Tomas Mraz <tmraz@redhat.com> - 5.3.0-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.3.0-5Joe Orton <jorton@redhat.com> 5.3.0-4Joe Orton <jorton@redhat.com> 5.3.0-3Joe Orton <jorton@redhat.com> 5.3.0-2Remi Collet <Fedora@famillecollet.com> 5.3.0-1Remi Collet <Fedora@famillecollet.com> 5.2.10-1Remi Collet <Fedora@FamilleCollet.com> - 5.2.9-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.2.8-10Joe Orton <jorton@redhat.com> 5.2.8-9Joe Orton <jorton@redhat.com> 5.2.8-8Joe Orton <jorton@redhat.com> 5.2.8-7Joe Orton <jorton@redhat.com> 5.2.8-5Joe Orton <jorton@redhat.com> 5.2.8-4Joe Orton <jorton@redhat.com> 5.2.8-3Remi Collet <Fedora@FamilleCollet.com> 5.2.8-2Remi Collet <Fedora@FamilleCollet.com> 5.2.8-1Remi Collet <Fedora@FamilleCollet.com> 5.2.7-1.1Remi Collet <Fedora@FamilleCollet.com> 5.2.7-1Joe Orton <jorton@redhat.com> 5.2.6-7Joe Orton <jorton@redhat.com> 5.2.6-6Remi Collet <Fedora@FamilleCollet.com> 5.2.6-5Remi Collet <Fedora@FamilleCollet.com> 5.2.6-4Joe Orton <jorton@redhat.com> 5.2.6-3Joe Orton <jorton@redhat.com> 5.2.5-7Fedora Release Engineering <rel-eng@fedoraproject.org> - 5.2.5-6Joe Orton <jorton@redhat.com> 5.2.5-5Joe Orton <jorton@redhat.com> 5.2.5-4Release Engineering <rel-eng at fedoraproject dot org> - 5.2.5-3Joe Orton <jorton@redhat.com> 5.2.5-2Joe Orton <jorton@redhat.com> 5.2.4-3Joe Orton <jorton@redhat.com> 5.2.4-2Joe Orton <jorton@redhat.com> 5.2.3-9Joe Orton <jorton@redhat.com> 5.2.3-8Hans de Goede <j.w.r.degoede@hhs.nl> 5.2.3-7Joe Orton <jorton@redhat.com> 5.2.3-6Joe Orton <jorton@redhat.com> 5.2.3-5Joe Orton <jorton@redhat.com> 5.2.3-4Joe Orton <jorton@redhat.com> 5.2.3-3Joe Orton <jorton@redhat.com> 5.2.3-2Joe Orton <jorton@redhat.com> 5.2.2-4Joe Orton <jorton@redhat.com> 5.2.2-3Joe Orton <jorton@redhat.com> 5.2.2-2Joe Orton <jorton@redhat.com> 5.2.1-5Joe Orton <jorton@redhat.com> 5.2.1-4Joe Orton <jorton@redhat.com> 5.2.1-3Joe Orton <jorton@redhat.com> 5.2.1-2Joe Orton <jorton@redhat.com> 5.2.0-10Joe Orton <jorton@redhat.com> 5.2.0-9Joe Orton <jorton@redhat.com> 5.2.0-8Joe Orton <jorton@redhat.com> 5.2.0-7Joe Orton <jorton@redhat.com> 5.2.0-6Joe Orton <jorton@redhat.com> 5.2.0-5Joe Orton <jorton@redhat.com> 5.2.0-4Joe Orton <jorton@redhat.com> 5.2.0-3Joseph Orton <jorton@redhat.com> 5.1.6-4Joe Orton <jorton@redhat.com> 5.1.6-3Joe Orton <jorton@redhat.com> 5.1.6-2Jesse Keating <jkeating@redhat.com> - 5.1.4-8.1Joe Orton <jorton@redhat.com> 5.1.4-8Joe Orton <jorton@redhat.com> 5.1.4-7Joe Orton <jorton@redhat.com> 5.1.4-6Radek Vokal <rvokal@redhat.com> 5.1.4-5.1Joe Orton <jorton@redhat.com> 5.1.4-5Joe Orton <jorton@redhat.com> 5.1.4-3Joe Orton <jorton@redhat.com> 5.1.3-3Joe Orton <jorton@redhat.com> 5.1.2-5Jesse Keating <jkeating@redhat.com> - 5.1.2-4.3Jesse Keating <jkeating@redhat.com> - 5.1.2-4.1Joe Orton <jorton@redhat.com> 5.1.2-4Joe Orton <jorton@redhat.com> 5.1.2-3Joe�x�������������X��������Xa
mX���������������	�$�����������������	�	�	���=�y@=@=r@=C@Fedora Release Engineering <releng@fedoraproject.org> - 2.1.2-5Fedora Release Engineering <releng@fedoraproject.org> - 2.1.2-4Fedora Release Engineering <releng@fedoraproject.org> - 2.1.2-3Fedora Release Engineering <releng@fedoraproject.org> - 2.1.2-2Nils Philippsen <nils@tiptoe.de> - 2.1.2-1Nils Philippsen <nils@tiptoe.de> - 2.1.2-1Fedora Release Engineering <releng@fedoraproject.org> - 2.1.0-7Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.1.0-6Till Maas <opensource@till.name> - 2.1.0-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.1.0-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.1.0-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.1.0-2Jay Fenlason <fenlason@redhat.com> 2.1.0-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0.8-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0.8-3Jay Fenlason <fenlason@redhat.com> 2.0.8-2Jay Fenlason <fenlason@redhat.com> 2.0.8-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0.7-2Jarod Wilson <jarod@redhat.com> 2.0.7-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0.6-2Jay Fenlason <fenlason@redhat.com> 2.0.6-1Jarod Wilson <jarod@redhat.com> 2.0.5-2Jay Fenlason <fenlason@redhat.com> 2.0.5-1Jarod Wilson <jarod@redhat.com> - 2.0.4-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0.1-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0.1-2Jarod Wilson <jarod@redhat.com> - 2.0.1-1Jarod Wilson <jarod@redhat.com> - 2.0.0-6Jarod Wilson <jarod@redhat.com> - 2.0.0-5Jarod Wilson <jarod@redhat.com> - 2.0.0-4Jarod Wilson <jarod@redhat.com> - 2.0.0-3Jarod Wilson <jarod@redhat.com> - 2.0.0-2Jarod Wilson <jwilson@redhat.com> - 2.0.0-1Jarod Wilson <jwilson@redhat.com> - 2.0.0-0.2.20080430_gitJarod Wilson <jwilson@redhat.com> - 2.0.0-0.1.20080430_gitJarod Wilson <jwilson@redhat.com> - 1.3.0-7Jarod Wilson <jwilson@redhat.com> - 1.3.0-6Jarod Wilson <jwilson@redhat.com> - 1.3.0-5Jarod Wilson <jwilson@redhat.com> - 1.3.0-4Jarod Wilson <jwilson@redhat.com> - 1.3.0-3Jarod Wilson <jwilson@redhat.com> - 1.3.0-2Jarod Wilson <jwilson@redhat.com> - 1.3.0-1Fedora Release Engineering <rel-eng at fedoraproject dot org> - 1.2.1-10Jarod Wilson <jwilson@redhat.com> - 1.2.1-9Jarod Wilson <jwilson@redhat.com> - 1.2.1-8Kristian Høgsberg <krh@redhat.com> - 1.2.1-7Kristian Høgsberg <krh@redhat.com> - 1.2.1-6Kristian Høgsberg <krh@redhat.com> - 1.2.1-5Kristian Høgsberg <krh@redhat.com> - 1.2.1-4Kristian Høgsberg <krh@redhat.com> 1.2.1-3Jarod Wilson <jwilson@redhat.com> - 1.2.1-2Jarod Wilson <jwilson@redhat.com> - 1.2.1-1Jesse Keating <jkeating@redhat.com> - 1.2.0-3.fc5.2.1Jesse Keating <jkeating@redhat.com> - 1.2.0-3.fc5.2Jesse Keating <jkeating@redhat.com> - 1.2.0-3.fc5.1Warren Togami <wtogami@redhat.com> - 1.2.0-3Jesse Keating <jkeating@redhat.com>Warren Togami <wtogami@redhat.com> - 1.2.0-2Warren Togami <wtogami@redhat.com> - 1.2.0-1Elliot Lee <sopwith@redhat.com>Warren Togami <wtogami@redhat.com. 1.1.0-2Warren Togami <wtogami@redhat.com> 1.1.0-1Tim Waugh <twaugh@redhat.com> 0.10.1-3Elliot Lee <sopwith@redhat.com>Warren Togami <wtogami@redhat.com> 0.10.1-1Elliot Lee <sopwith@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Warren Togami <wtogami@redhat.com> 0.10.0-1Bill Nottingham <notting@redhat.com> 0.9.0-12Elliot Lee <sopwith@redhat.com>Jeremy Katz <katzj@redhat.com> 0.9.0-10Elliot Lee <sopwith@redhat.com>Tim Powers <timp@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Tim Powers <timp@redhat.com>Michael Fulbright <msf@redhat.com>Michael Fulbright <msf@redhat.com>- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- fix bogus changelog date- version 2.1.2
- tidy up spec file
- use %�x��������������������Xb�l���������������n��$~����������������n�m�o��ompletion: implement completion for clean cmd (Igor Gnatenko)
- bash_completion: implement downgrade command (Igor Gnatenko)
- bash-completion: refactor to python helper (Igor Gnatenko)
- command downgrade does downgrade_to (RhBug:1191275) (Jan Silhan)
- AUTHORS: updated (Jan Silhan)
- clean: 'dnf clean all' should also clean presto and updateinfo solvx files
  (Parag Nemade)
- dnf-yum: modified warning message (RhBug:1207965) (Jan Silhan)- subject: expand every glob name only once (RhBug:1203151) (Michal Luscon)
- group mark: skips already installed groups (Jan Silhan)
- Merge pull request #246 from mluscon/yum2dnf (mluscon)
- Add yum2dnf man page (Michal Luscon)
- doc: extend cli_vs_yum (Michal Luscon)
- dnf-yum package does not conflict with yum 3.4.3-505+ (Jan Silhan)
- fixed double set of demand from 0e4276f (Jan Silhan)
- group: remove cmd don't load available_repos, see 04da412 (Jan Silhan)
- spec: /var/lib/dnf owned by dnf-conf (Jan Silhan)
- spec: apply the weak dependencies only on F21+ (Radek Holy)
- dnf-automatic: fixed python_sitelib (RhBug:1199450) (Jan Silhan)
- Add release instructions (Michal Luscon)
- setup tito to bump version in VERSION.cmake (Michal Luscon)
- initialize to use tito (Michal Luscon)
- prepare repo for tito build system (Michal Luscon)
- spec: recommends bash-completion (RhBug:1190671) (Jan Silhan)
- completion: work with just python(3)-dnf (Jan Silhan)
- spec: move necessary files inside python(3) subpackages (RhBug:1191579) (Jan Silhan)
- bash-completion: use python method to get commands (RhBug:1187579) (Igor Gnatenko)
- api: exposed pluginconfpath main config (RhBug:1195325) (Jan Silhan)
- updated AUTHORS (Jan Silhan)
- add reinstall to bash_completion (Alberto Ruiz)
- added new packages to @System for duplicated query test (Michael Mraka)
- test for duplicated, installonly and latest_limit pkgs (Michael Mraka)
- tests for autoremove, extras and recent pkgs (Michael Mraka)
- moved push_userinstalled from base to goal (Michael Mraka)
- filter or skip 'n' latest packages (Michael Mraka)
- moved recent to query (Michael Mraka)
- moved autoremove to query (Michael Mraka)
- moved extras list to query (Michael Mraka)
- create query for installonly packages (Michael Mraka)
- create query for duplicated packages (Michael Mraka)
- cosmetic: base: fixed pylint warnings (Jan Silhan)
- do transaction cleanup after plugin hook (RhBug:1185977) (Michal Luscon)
- base: extend download lock (RhBug:1157233) (Michal Luscon)
- lock: output meaningful error for malformed lock file (Michal Luscon)
- util: fix race condition in ensure_dir() (Michal Luscon)
- lock: switch metadata lock to blocking mode (Michal Luscon)
- install nonmandatory group packages as optional (Related:RhBug:1167881) (Michal Luscon)
- remove command deletes whole dependency tree (RhBug:1154202) (Jan Silhan)
- cmd list takes <package-name-specs> as parameter, revert of 526e674 (Jan Silhan)
- spec: own /var/lib/dnf directory (RhBug:1198999) (Jan Silhan)
- transifex update (Jan Silhan)
- doc: fixed systemd execution of dnf-automatic (Jan Silhan)
- doc: how to run dnf-automatic (RhBug:1195240) (Jan Silhan)
- cosmetic: added forgotten :api mark from 05b03fc (Jan Silhan)
- api: exposed Repo.skip_if_unavailable config (RhBug:1189083) (Jan Silhan)
- updated documentation for 'dnf list autoremove' (Michael Mraka)
- reuse list_autoremove() in autoremove command (Michael Mraka)
- function for autoremove package list (Michael Mraka)
- implemented dnf list autoremove (Michael Mraka)
- exclude not documented history subcommands (RhBug:1193914,1193915) (Jan Silhan)
- better file pattern recognition (RhBug:1195385) (Jan Silhan)
- spec: fix Obsoletes of the new DNF (Radek Holy)
- remove boot only constraint and add missing download lock (Michal Luscon)
- util: remove unused user_run_dir() function (Michal Luscon)
- lock: change the destination folder of locks to allow suided programs work properly (RhBug:1195661) (Michal Luscon)
- install dnf-3 only when python3 is enabled (thanks glensc) (Jan Silhan)
- fixed unicode Downl�x�������������H��������Xc�l����������������5��$%����������������5�6�4��	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%��0.8.7-1.el80.8.7-1.el8	

.build-id7a46d6cf59d34293d06439c6e6f7b1960ac38ba5f160c524839fc83167bd262d1d4a1b6356e1d2balibSvtAv1Dec.so.0libSvtAv1Dec.so.0.8.7libSvtAv1Enc.so.0libSvtAv1Enc.so.0.8.7svt-av1-libsCHANGELOG.mdCONTRIBUTING.mdDocsAppendix-Alt-Refs.mdAppendix-CDEF.mdAppendix-CfL.mdAppendix-Compliant-Subpel-Interpolation-Filter-Search.mdAppendix-Compound-Mode-Prediction.mdAppendix-DLF.mdAppendix-Film-Grain-Synthesis.mdAppendix-Filter-Intra.mdAppendix-Global-Motion.mdAppendix-Intra-Block-Copy.mdAppendix-Local-Warped-Motion.mdAppendix-Palette-Prediction.mdAppendix-Restoration-Filter.mdAppendix-SQ-Weight.mdAppendix-Subpel-Interpolation-Open-Loop-ME.mdAppendix-TX-Search.mdAppendix-Variance-Based-Adaptive-Quantization.mdREADME.mdimg10bit_packed.png10bit_unpacked.png10bit_yuv420p.png64x64_after_2bit_compression.png64x64_after_unrolling.png8bit_yuv420p.pngCfL_fig2.pngCfL_fig3.pngWedge_Codebook_2020_01_11.pngaltref_fig1.pngaltref_fig2.pngaltref_math1.pngaltref_math10.pngaltref_math11.pngaltref_math12.pngaltref_math13.pngaltref_math14.pngaltref_math15.pngaltref_math16.pngaltref_math17.pngal�x����������������������Xd?j����������?�$����������������??" for recent gcc on x86
- disable sqlite pending audit of warnings and subpackage split- don't build dom extension into 2.0 SAPI- ExclusiveArch: x86 ppc x86_64 for the moment- fix default extension_dir and conf.d/php.conf- update to 5.0.1
- only build shared modules once
- put dom extension in php-dom subpackage again
- move extension modules into %{_libdir}/php/modules
- don't use --with-regex=system, it's ignored for the apache* SAPIs- Merge in some spec file changes from Jeff Stern (jastern@uci.edu)- bump to 5.0.0
- add patch to prevent clobbering struct re_registers from regex.h
- remove domxml references, replaced with dom now built-in
- fix php.ini to refer to php5 not php41:5.5.38-64.el8.cloudlinux.31:5.5.38-64.el8.cloudlinux.31:5.5.38-64.el8.cloudlinux.3ftp.iniftp.so.build-id4a5eb4ca0fa354d92f36ed066d07718b37f7ea00/opt/cpanel/ea-php55/root/etc/php.d//opt/cpanel/ea-php55/root/usr/lib64/php/modules//usr/lib//usr/lib/.build-id//usr/lib/.build-id/4a/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnuASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4a5eb4ca0fa354d92f36ed066d07718b37f7ea00, not strippeddirectoryutf-843371fa38bdfd07be6215fed739129ee6a98494d86e81b45d02c7e6e32115988?���`aDyB.y�G�%�<�W{ň]!��gdcW&���K�U�b��qi�nl
	�U�b��q�9��O�6�`�Z&k����G$�m�1]������2���*S���]!��gdcW&���K�U�b��qi�nl
	�U�b��q���GN��s�Z�.�
!�f�>�3��eH�m�,�VZ�>�OuA987cafad45f54d0b3612993a79eca77e1b5423bff78bfaef42b2d722270f650d8330ad4cca803ecd830ea8a9759cef49691266c1iݵS,�iݵ1: indicate HEAD state in tarball/rpm name (Jarod Wilson)
- selftest: net: Test IPv4 PMTU exceptions with DSCP and ECN (Guillaume Nault) [2081453]
- ipv4: Fix route lookups when handling ICMP redirects and PMTU updates (Guillaume Nault) [2081453]
- ipv4: tcp: send zero IPID in SYNACK messages (Guillaume Nault) [2081453]
- ipv4: raw: lock the socket in raw_bind() (Guillaume Nault) [2081453]
- net/af_packet: add VLAN support for AF_PACKET SOCK_RAW GSO (Hangbin Liu) [2066976]
- net/packet: fix packet_sock xmit return value checking (Hangbin Liu) [2066976]
- doc/ip-sysctl: add bc_forwarding (Xin Long) [2080486]
- net/packet: fix packet_sock xmit return value checking (Xin Long) [2080486]
- net: handle ARPHRD_PIMREG in dev_is_mac_header_xmit() (Xin Long) [2080486]
- net/packet: fix slab-out-of-bounds access in packet_recvmsg() (Xin Long) [2080486]
- veth: fix races around rq->rx_notify_masked (Xin Long) [2080486]
- af_packet: fix data-race in packet_setsockopt / packet_setsockopt (Xin Long) [2080486]
- ipv4: remove sparse error in ip_neigh_gw4() (Xin Long) [2080486]
- af_unix: annote lockless accesses to unix_tot_inflight & gc_in_progress (Xin Long) [2080486]
- veth: Do not record rx queue hint in veth_xmit (Xin Long) [2080486]
- veth: ensure skb entering GRO are not cloned. (Xin Long) [2080486]
- ethtool: Fix link extended state for big endian (Xin Long) [2080486]
- ethtool: do not perform operations on net devices being unregistered (Xin Long) [2080486]
- ethtool: Add transceiver module extended state (Xin Long) [2080486]
- ethtool: runtime-resume netdev parent in ethnl_ops_begin (Xin Long) [2080486]
- ethtool: move netif_device_present check from ethnl_parse_header_dev_get to ethnl_ops_begin (Xin Long) [2080486]
- ethtool: move implementation of ethnl_ops_begin/complete to netlink.c (Xin Long) [2080486]
- net: validate lwtstate->data before returning from skb_tunnel_info() (Xin Long) [2080486]- bnx2x: fix napi API usage sequence (Manish Chopra) [2080659]
-�x�������������8y�������Xe1k���������C��$J��������������������ov@cloudlinux.com> - 7.4.10-2.cloudlinux.2Tim Mullin <tim@cpanel.net> - 7.4.10-2Cory McIntire <cory@cpanel.net> - 7.4.10-1Ivan Danilov <idanilov@cloudlinux.com> - 7.4.9-1.cloudlinux.2Cory McIntire <cory@cpanel.net> - 7.4.9-1Darya Malyavkina <dmalyavkina@cloudlinux.com> - 7.4.8-2.cloudlinux.1Tim Mullin <tim@cpanel.net> - 7.4.8-2Cory McIntire <cory@cpanel.net> - 7.4.8-1Julian Brown <julian.brown@cpanel.net> - 7.4.7-2Darya Malyavkina <dmalyavkina@cloudlinux.com> - 7.4.7-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 7.4.7-1Tim Mullin <tim@cpanel.net> - 7.4.6-3Tim Mullin <tim@cpanel.net> - 7.4.6-2Cory McIntire <cory@cpanel.net> - 7.4.6-1Anatholy Scryabin <ascryabin@cloudlinux.com> - 7.4.5-2.cloudlinuxDaniel Muey <dan@cpanel.net> - 7.4.5-3Tim Mullin <tim@cpanel.net> - 7.4.5-2Cory McIntire <cory@cpanel.net> - 7.4.5-1Julian Brown <julian.brown@cpanel.net> - 7.4.2-3Daniel Muey <dan@cpanel.net> - 7.4.2-2Daniel Muey <dan@cpanel.net> - 7.4.2-1Dan Muey <dan@cpanel.net> - 7.4.1-1- EA4D-797: revert to use system libxml2 lib for all platforms
- EA4D-808: fix Provides field in debian/control to use exact versions
- EA4D-811: remove libphp7.so from _root_httpd_moddir to fix file conflicts- Update php-fpm patch to v4 for per-domain resource isolation support- EA4D-793: Update php-fpm LVE patch- EA4D-789: Security fixes
- CVE-2025-14178: fix integer overflow in array_merge (ext/standard/array.c)
- CVE-2025-1736: fix for PHP SOAP extension- remove ea-mod_php provide and require- EA4D-773: Rebuild ea-php74 on rhel>=9 with system libxml2 as cPanel- Synchronize with cpanel but leave using ea-libxml2 on all OS- EA4D-746: Update php-fpm lve patch to extract doc_root from php_admin_values
  for CageFS per-domain isolation- EA4-136: Fix libxml2 v2.15.0 compatibility- EA4D-789: Security fixes
- CVE-2025-1220: fix null byte termination in hostnames
- CVE-2025-6491: fix NULL pointer dereference in PHP SOAP extension via large
  XML namespace prefix- EA4D-677: rebuild with new libtidy 5.8.0- EA4D-789: Security fixes
- CVE-2024-11235: use-after-free for ??= due to incorrect live-range calculation- EA4D-789: Security fixes
- CVE-2025-1219: fix wrong `content-type` on redirect in libxml streams
- CVE-2025-1217: http stream wrapper: fix handling folded headers
- CVE-2025-1734: http stream wrapper: fix handling headers with invalid name and no colon
- CVE-2025-1861: fix http redirect location truncation- EA4D-636: rebuild with ea-libicu 77- ZC-12614: Rolling “ea-php74” back to “2ae8a0c01d69dbc710734ff516c17a19a479fa13”: was not meant to be merged- ZC-12614: Build on Alma 9- EA4D-789: Security fixes
- CVE-2024-8929: fix various heap buffer over-reads for mysqlnd- EA4D-789: Security fixes
- CVE-2024-11234: fix HTTP fulluri CRLF injection
- CVE-2024-11233: fix single byte overread with convert.quoted-printable-decode
  filter
- CVE-2024-11236: prevent integer overflow in quoters causing OOB writes- ZC-12495: Do gcc like newer PHPs so that the libicu update won’t break the build- EA4D-789: Security fixes
- CVE-2024-8925: Fix data integrity violation while parsing multipart/form-data
  boundaries larger than the read buffer
- CVE-2024-9026: Fix possible altering of children logs
- CVE-2024-8927: Fix bypass of cgi.force_redirect configuration- ZC-12246: Correct conffiles for Ubuntu- ALTPHP-1839: Change lsapi naming- ZC-12153: make opcache INI a configfile for debs- ZC-12114: Apply fix for libxml2- Fix for hardened PHP
- CVE-2024-5458: Fix early-out for ipv6 hostname validation, ensure full check
  is performed- remove libbrolti requires for rhel<=7- Fix for hardened PHP
- CVE-2024-2756: fix __Host-/__Secure-cookie bypass due to partial
  CVE-2022-31629 fix
- CVE-2024-3096: Disallow null character in bcrypt password to fix bug causing
  password_verify to erroneously return true- EA-10753: Have snmp module require 'snmp-mibs-downloader' for deb- CVE-2022-4900: Prevent potential buffer overflow for php_cli_server_workers_max
- EA4D-470: build intl with system icu for RHEL >= 9-�x�������������`h�������X+nm��(�������t�$d����������������tu�?�
�������	��	������������	*1(qXxY�
��hmQINBGilm2YBEADs2+JvSx0MvxXshLhGzgZF+WWfDxLZZN5DMhZB/xyeaJahxglL
RYSPxKaqwSx2zZWj7OEmpi1Jc/q24euICCOZTpQvPzr7G3jYYeqMQHp5Y6pFCJoi
n9f788DGCEs3QsVP5OYjlejv/HP6feiVoFOXrj/EFyn6t65UnKNNX3aZa/xU9QM/
ufVnjExZHye2i4x4vDKpF9rdy5DSZswpPULtQEaW+aPC5/rqQdaTkwTf9LGBk1SO
wAM+NDzwRKmmbBH9eEZFJHUQ3WIyu4fK4nx6XuVAXwYLJSeiu0X8di3okPbKMHtE
6ObOPCI7n702n8eL6C7ztpvlIOmbWBK0MQ9FmeZkQ2CnB2w2XjIdqHuKio/IXtoT
Cqs2gcq3n1H/thAeRuPF+KF2kcJrM2Lacm62AVmDhplB/fd5V7nFi3hFJImelzA/
kprmLTBfH1+LC/QhOxoHvuZTk8chhGJszCKk1QhE9y/J7eUfao3pworwlF3Rs7zV
lT5zmhfmvrAImfYUDNWxpMAfTnAut4p8uVC5jWLdgG+htCVHidTYdUJW3y42oIt8
9WjrwhQsMkLYmz+sfjtydY4FOCQMGhEen9h72EV5Zh/03xrfAMgNPje3PSx9E0J9
pQKOjqKUT+gDWCpu78v2WErWsf5hHQcRr79UpuF6KtVF9gMx7sBvMDYbHwARAQAB
tB5XUCBUb29sa2l0IDxzdXBwb3J0QHBsZXNrLmNvbT6JAiwEEwEKABYFAmilm2YC
GwMGFQoJCAsCAh4BAheAAAoJENQm5aYfzxZUdYsP/0YV2t9eOKONvBudmKlmxEo3
+JXXrsFF7wdoJgjOVGs5VBmcDeFB/W7sXuycP1DMrGb9TVV7qh4VsEzPkSSUGbKR
Uc30rGc0sojaTE0GgJQ/fgtZyktj85HDMRdUpv83/8zzlQpSMVFL3c5OcROYRw5+
JD3nsr+1uuwd/n8VTMvOLdbG4Hx59+12Dhd8/kjFRRMAZM1/g/CFL/Dy7u8N9S6e
kMKMIhqhK44XdmNZrbmCLmjsCGekTO5gq7SE1ML9IGuiQzjHqdTE7JMKSuOxKFbN
W9kZPAAI3KprXzPDsOmsPYC09cgzhGcmWgHwnQBt1HOoX6196kV7Zd2bn7xOZ1wc
DOJiT3NXgYsblqnWxOLBPtvye0l1Tlb/Cm/wynxvBSTO9FWsvdpyoY8o8WnrXNpR
zFRpOO1jVZysKRsNElo/qxzaSSAJTD1Z3aQiD6xSQrsS6iu4JxoR+UUutp3bkucx
BzdZeYqpQhUnSe0yfh8+EvCbOD96mHyCXSGkN5H9O8Ubhf7ynxm3TgKJH1V01pgg
OJU5gefuIaEoHB8oO/ykWSfMUccs8KdzkdGAhxcORkPgnJpiryPYDkUJPvBAuouv
Jpa5D70+SUuNpras1jNzxwuoT+1IvSoHg7Ph11QwxOp+HdgGn6zR+UgEE/VLHd80
2EZ0PgZygIGBn2+6WxIxuQINBGilm2YBEACp1MKab5upYJrJUbrHOkYK3Q4974ef
fZ5c3tWJIfJdk9DX1DtqP3ZEaThdGuglY8qYKCDF3HOyWUPlibOUm67zAFEl1EEg
cQ0pIScWMn6bmK6CybWc9DrqTy2HQyjOc3BJUCpxoyvj4SwwSXqa8yNxQOrZT3VH
IstKN44LvkJ6yPEGH1y1Vqmd24Nc2RwUIlRNcrCl/Om93cioNqlWC//ryqA7LKey
ApRJVnyfItYAne1mtEX0PLc7332MEAZf2kkU4HgCY0leJIe3bA3GhLUaTWNS4MLr
eSHORQUb8fqmffs3ebvnWG4TV2dTzoF7/HSlEeovNT45n2EATty1thNLabHyXjHn
R6bEF6w5Zrqedfp+nkgd5RhZgErw6Ewl8bKn1WLk1fyWMCgkQ9Z5g9q4XGGioroM
eMFahbnV0pcGhgSTH2spH8S2XoEjGmmAI3mt+HCgMR0DPvdP02N0HSKDDG5tkmtD
GYqPonhGyV47Zmw0XfI0CqCxBIHwQe3yCK96oRCyxYL7gG5VuSGi81p86BXmCeZX
a6J+SjwmDhN8HT33qS37VR/GJhpBxi+YyjfJD8sQlswzW3xTAEFhxJVnyBRBDNvp
lYYtiqZeeNcA3mLn4eJpWVu3wP+1yf6g/tOTR5k+wOFy4FZVk72VFhLtnjqv5pM3
ELG+kmFHzsVwKwARAQABiQIfBBgBCgAJBQJopZtmAhsMAAoJENQm5aYfzxZUuvcQ
AKL8Y9C+MwQuAEKvp2JN1pPUeuLHpTXzf//04utz3FNoTGptfEaqjGU23aKwLV+Y
h5ymkgimO6gGjG64jDfn1XpzRQr6db/SfIb5W+7AbR++dGewZuRnXN67liLI0KYE
z+eJ/cmM/kypXfQ/+p63pgYAfHq+XXNiX9kXCAU/5rq4+Q3jd5luCPzi+EG3Qw4u
eW0S/7u5uemfv4PU2gB5QYEzlNtEC/gX2T2c3M+Au20QJ3fv14uYHe26Cd+hlt2F
hVX3W289Uw8VwsDhfvTyUsAtMBedWSzKr7jwE6VYhyw3lspEvzyVQ2rbApTeZkB4
O+PBfAfkY4ni7NE4y+DtdS96rfB0IeXJzfShbtz6gF5jNQLoGFDo0ImrWzywWmOF
NUfi7wCr1QaM5z6cSK+LKS2H7KI8Pp2VSqpb0XeDM1MyqALvr83ZnamUpS8tC7YZ
9AkaeyudLWq52w+PvZmka5dnb+2G6o3n2jvqPZiZ3Imk9QQcpL2dY8m1ti4vzPRY
OKdA/enbgUm5/Knc/3B+p472fRq6ni9qrHoQPbam2VAm/3GbudIeaRwLwTpM4zfP
1vdbsxo2GAKOj2jn+1hhUuKQs+KfxR/QTFfnXJrZ44GMWi8zygr7dkOLbVmI6FoM
EcBMp4G/ON9jNTmJe7sxowLPQs9py5DVa7+p9DI2+220
gpg-pubkey1fcf165468a59b66gpg(WP Toolkit <support@plesk.com>)-----BEGIN PGP PUBLIC KEY BLOCK-----
Version: rpm-4.14.3 (NSS-3)

mQINBGilm2YBEADs2+JvSx0MvxXshLhGzgZF+WWfDxLZZN5DMhZB/xyeaJahxglL
RYSPxKaqwSx2zZWj7OEmpi1Jc/q24euICCOZTpQvPzr7G3jYYeqMQHp5Y6pFCJoi
n9f788DGCEs3QsVP5OYjlejv/HP6feiVoFOXrj/EFyn6t65UnKNNX3aZa/xU9QM/
ufVnjExZHye2i4x4vDKpF9rdy5DSZswpPULtQEaW+aPC5/rqQdaTkwTf9LGBk1SO
wAM+NDzwRKmmbBH9eEZFJHUQ3WIyu4fK4nx6XuVAXwYLJSeiu0X8di3okPbKMHtE
6ObOPCI7n702n8eL6C7ztpvlIOmbWBK0MQ9FmeZkQ2CnB2w2XjIdqHuKio/IXtoT
Cqs2gcq3n1H/thAeRuPF+KF2kcJrM2Lacm62AVmDhplB/fd5V7nFi3hFJImelzA/
kprmLTBfH1+LC/QhOxoHvuZTk8chhGJszCKk1QhE9y/J7eUfao3pworwlF3Rs7zV
lT5zmhfmvrAImfYUDNWxpMAfTnAut4p8uVC5jWLdgG+htCVHidTYdUJW3y42oIt8
9WjrwhQsMkLYmz+sfjtydY4FOCQMGhEen9h72EV�x�������������(X�������XgWm��xb�������$�����������������t	
���������������zni]XLG;6*%���������������{oj^YMH<7+&	�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
|
p
k
_
Z
N
I
=
8
,
'




���������������}ql`[OJ>9-(���������������~rma\PK?:.)�
�
�
�
�
�
�
�
�
�
�
�
�
�
�

s
n
b
]
Q
L
@
;
/
*




�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	t	o	c	^	R	M	A	<	0	+						����������������upd_SNB=1, 
����������������vqe`TOC>2-!����������������wrfaUPD?3."���������������xsgbVQE@4/#
���������������ythcWRFA50$���������������zuidXSGB61%�*��/�
�A�h!X1�>[;jp��ɣ���E�1�-|�����\=�O�wWO��E�1�.�	���W��`�>[;�	���*�(�
�v�y@�>[;��H�E����
�E�1�-���뽏(-�O�w��p�E�1m.�	����l��*��q��
�v���
�>[;�m��������L���E�1 }������z�>[;�(|�O�w���(�E�1�.��	���B��w�>[;&	8�O�w=E�G�
���*l�
�,fQ$W�>[;{l��>[;P�L�������E�13}�������1�>[;.(()�O�w���P�E�1�.�	��뻢�8�>[;�3P>�>[;�Dq�O�w�E �
Ƭ�7-dC�
��
hR�>[;�k���>[;�/����'��E�1�D0����R��n�O�w����E�1w$X�	���ˡ�>[;3P!�>[;W�7�O�w�F��
�]����
��s|�>[;k�R�>[;K|�����oh^�E�1_DH�>[;Y'$W�O�w'���E�1�$�	�������>[;�2�*�>[;�+�O�w�G��
E�1�#��
���T�>[;*�G��7�8�O�w�B�
O�w�B�
O�w�B�
O�w�B�
O�w�B�
O�w�B�
O�w�B�
O�w�B�
O�w�B�
�q��lY��q��lY��q��lY��q��lY��q��lY��q��lY��q��lY��q��lY��q��lY��q��lY��q��lY��q��lY��A�h!X1���uZ�����+}����+}����+}�Iq�zD����뽏(-��q��Kt�����l��q����5���u���+}�(�>[;�(|��+}�|�`�����+}:
�>[;{l���$�� #������1�O�w���P��q�ʼ�_�>[;�Dq��q��p=���
hR���uV����>[;�/��+}D��+}�(�>[;3P!��+}d���]����
>[;k�R��$������q��x)��������>[;�+��q�N�DH����T�>[;*��+}D��>[;�1(���+}���>[;/h�i��oV�8�T�G��r���>[;��p���q����@�>[;bs�O�wiH�
�q���L_~����}>[;WP{�+}��uE�14ts	>[;�0�Hq�+}��p>[;�Ol�oVw.�
k>[;o�x3g�]t��f���}�8�b>[;��H`�q�c-�r^��`t}]
���|@\>!�)�T�Y>[;$ tV�+}�$UE�1Y3pS	�+}��
P>[;�9�LG��O64IVg�m�(-H>[;]$@�q�(A��>�����6=�f,�7��<�Âm 
9>[;� |s6�+}%T5�+}�0�+}�
�
+����">[;BDd �q��?�0'D�>[;�
%�q�V�LL�+}g�>[;9+�F�+}ZL���(�
�+}�
�>[;q�LO�w�����q�����͑�`�x��������������G�������Xhm���:�D�$�����������������D�&�D�trootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcpanel-geoipfree-data-130.4-1.cp130~el8.src.rpm�������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������x�������������7�������Xi�mX�������`X���������$z�����������������������otrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcloudlinux-release-8.10-13.el8.src.rpm������������������������������������������������������������������������������������������������������������������������������������������������almalinux-releasealmalinux-release(upstream)almalinux-release-eulacentos-linux-releasecentos-linux-reposcentos-releasecentos-release(upstream)cloudlinux-releasecloudlinux-release(x86-64)config(cloudlinux-release)redhat-releaseredhat-release-eulasystem-releasesystem-release(releasever)@ 



/bin/bash/bin/shconfig(cloudlinux-release)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)8.10-13.el83.0.4-14.6.0-14.0-15.2-1cloudlinux-ea4-releaserhn-client-tools1-112.11.54.14.3h��h��@h~+�hw�@h^��hZ�@gř�g���g��gY@fqv�fi��f!@e��e��@eWU�doM�db�d%y�c{h@cjD�b��@a���a��a��a#��`��`��`7�@`&m�_�H@^��@^j$@^\�@^ P@^�@]�f@]���Andrew Lukoshko <alukoshko@cloudlinux.com> - 8.10-13Andrew Lukoshko <alukoshko@cloudlinux.com> - 8.10-12Oleksandr Shyshatskyi <oshyshatskyi@cloudlinux.com> - 8.10-11Oleksandr Shyshatskyi <oshyshatskyi@cloudlinux.com> - 8.10-10Andrew Lukoshko <alukoshko@cloudlinux.com> - 8.10-9Andrew Lukoshko <alukoshko@cloudlinux.com> - 8.10-8Eduard Abdullin <eabdullin@cloudlinux.com> - 8.10-7Eduard Abdullin <eabdullin@cloudlinux.com> - 8.10-6Roman Krompets <rkrompets@cloudlinux.com> - 8.10-5Redouane Elkaboussi <relkaboussi@cloudlinux.com> - 8.10-4Roman Prilipskii <rprilipskii@cloudlinux.com> - 8.10-3Sergey Fokin <sfokin@cloudlinux.com> - 8.10-2Eduard Abdullin <eabdullin@cloudlinux.com> - 8.10-1Andrew Lukoshko <alukoshko@cloudlinux.com> - 8.9-3Andrew Lukoshko <alukoshko@cloudlinux.com> - 8.9-2Andrew Lukoshko <alukoshko@cloudlinux.com> - 8.9-1Roman Prilipskii <rprilipskii@cloudlinux.com> - 8.8-2Andrew Lukoshko <alukoshko@cloudlinux.com> - 8.8-1Vasily Kleschov <vkleschov@cloudlinux.com> - 8.7-3Andrew Lukoshko <alukoshko@cloudlinux.com> - 8.7-2Andrew Lukoshko <alukoshko@cloudlinux.com> - 8.7-1Andrew Lukoshko <alukoshko@cloudlinux.com> - 8.6-1Andrew Lukoshko <alukoshko@cloudlinux.com> - 8.5-4Andrew Lukoshko <alukoshko@cloudlinux.com> - 8.5-3Andrew Lukoshko <alukoshko@cloudlinux.com> - 8.5-1Andrew Lukoshko <alukoshko@cloudlinux.com> - 8.4-4Andrew Lukoshko <alukoshko@cloudlinux.com> - 8.4-1Andrew Lukoshko <alukoshko@cloudlinux.com> - 8.3-3.2Sergey Fokin <sfokin@cloudlinux.com> - 8.3-3.1Vyacheslav Potoropin <vpotoropin@cloudlinux.com> - 8.3-3Sergey Fokin <sfokin@cloudlinux.com> - 8.3-2Diana Bautina <dbautina@cloudlinux.com> - 8.2-1Eugene Zamriy <ezamriy@cloudlinux.com> - 8.1-1.4Sergey Fokin <sfokin@cloudlinux.com> - 8.1-1.3Eugene Zamriy <ezamriy@cloudlinux.com> - 8.1-1.2Sergey Fokin <sfokin@cloudlinux.com> - 8.1-1.1Sergey Fokin <sfokin@cloudlinux.com> - 8.1-1Sergey Fokin <sfokin@cloudlinux.com> - 8.0-1- Add conflicts to packages with old RPM-GPG-KEY-CloudLinux included- Add CloudLinux Extension Signer key to RPM-GPG-KEY-CloudLinux- CLOS-3481: Update EULA text- CLOS-3472: Add sending systemid to rollout service- Remove CloudLinux Extension Signer key from RPM-GPG-KEY-CloudLinux- Add CloudLinux Extension Signer key to RPM-GPG-KEY-CloudLinux- Make sure that rollout-ng is used in the rollout repo file- Update rollout reposiroties- Update EULA- Replace /etc/os-release file with symlink to ../usr/lib/os-release- Rename CloudLinux Shared to CloudLinux Legacy in EULA- add 2 more rollout slots repositories- 8.10 stable- Set VARIANT_ID- Added new AlmaLinux 8 GPG key- 8.9 stable
- Update EULA- Clean cldeploy yum/dnf auto-excludes, if any are present- 8.8 stable- Add 4 more rollout slots repositories- Use cloudlinux_releasever dnf variable in CloudLinux repos-�x��������������&�������Xj7mX��9������*��$:����������������*�)�+�� non-threaded Apache mpm (EA-3982)- Enabled short_open_tags (ZC-1283)- Disable ZTS Support (EA-3790)- make ea-php5x-php-fpm depend on ea-php5X-php-cli (EA-3836)- Updated to version 5.6.16 via update_pkg.pl (EA-3923)- Rename www.conf to www.conf.example (ZC-1206)- Updated to version 5.6.15 via update_pkg.pl (EA-3784)- Use libphp5.so as module name for simplicity/consistency (EA-3750)- Updated to version 5.6.14 via update_pkg.pl- Updated to version 5.6.13 via update_pkg.pl
- Updated timezonedb patch- Updated to version 5.6.12 via update_pkg.pl- Enabled mcrypt for all builds- Moved "ea-php-cli" to correct package- Added ea-php-cli requirement- Fix macros.php syntax error- Change ea-apache2 to ea-apache24
- corrected version number in previous change log entry- Set imap and recode to be incompatible
- Added libzip compile flags, but set to incompatible with all
  current versions of CentOS (e.g. <= 7).  RHEL patches PHP to
  be compatible with the version of libzip that's supplied by
  them.
- developer version of opcache.ini is distributed instead of auto-gen- Updated to PHP 5.6.6
- Made compatible with EA4 version of web server- Added back in the upstream archive, replaced the excised JSON- fileinfo: fix out-of-bounds read in elf note headers. CVE-2014-3710- xmlrpc: fix out-of-bounds read flaw in mkgmtime() CVE-2014-3668
- core: fix integer overflow in unserialize() CVE-2014-3669
- exif: fix heap corruption issue in exif_thumbnail() CVE-2014-3670- gd: fix NULL pointer dereference in gdImageCreateFromXpm().
  CVE-2014-2497
- gd: fix NUL byte injection in file names. CVE-2014-5120
- core: fix heap-based buffer overflow in DNS TXT record
  parsing. CVE-2014-4049
- network: fix segfault in dns_get_record
  (incomplete fix for CVE-2014-4049). CVE-2014-3597
- core: unserialize() SPL ArrayObject / SPLObjectStorage
  type confusion flaw. CVE-2014-3515
- core: type confusion issue in phpinfo(). CVE-2014-4721
- spl: fix use-after-free in ArrayIterator due to object
  change during sorting. CVE-2014-4698
- spl: fix use-after-free in SPL Iterators. CVE-2014-4670
- fileinfo: cdf_unpack_summary_info() excessive looping
  DoS. CVE-2014-0237
- fileinfo: CDF property info parsing nelements infinite
  loop. CVE-2014-0238
- fileinfo: cdf_read_short_sector insufficient boundary
  check. CVE-2014-0207
- fileinfo: fix extensive backtracking in regular expression
  (incomplete fix for CVE-2013-7345). CVE-2014-3538
- fileinfo: cdf_check_stream_offset insufficient boundary
  check. CVE-2014-3479
- fileinfo: cdf_count_chain insufficient boundary check
  CVE-2014-3480
- fileinfo: fix mconvert incorrect handling of truncated
  pascal string size. CVE-2014-3478
- fileinfo: cdf_read_property_info insufficient boundary
  check. CVE-2014-3487
- fileinfo: fix cdf_read_property_info
  (incomplete fix for CVE-2012-1571). CVE-2014-3587- fileinfo: fix out-of-bounds memory access CVE-2014-2270
- fileinfo: fix extensive backtracking CVE-2013-7345- gd: fix NULL deref in imagecrop CVE-2013-7327
- gd: drop vpx support, fix huge memory consumption #1075201- fix patch name
- fix memory leak introduce in patch for CVE-2014-1943
- fix heap-based buffer over-read in DateInterval CVE-2013-6712- fix infinite recursion in fileinfo CVE-2014-1943- fix heap overflow vulnerability in imagecrop CVE-2013-7226- allow multiple paths in ini_scan_dir #1058161- add security fix for CVE-2013-6420- rebuild- rebuild with test enabled
- add dependency on php-pecl-jsonc- update to PHP 5.5.6
- buildstrap build- update to PHP 5.5.5
- mod_php only for httpd24- update to PHP 5.5.4
- improve security, use specific soap.wsdl_cache_dir
  use /var/lib/php/wsdlcache for mod_php and php-fpm
- sync short_tag comments in php.ini with upstream
- relocate RPM macro- update to PHP 5.5.3
- improve system libzip patch
- fix typo and add missing entries in php.ini- update to PHP 5.5.1 for php55 SCL- rebuild for new httpd-mmn value- remove ZTS conditional stuf for ligibility
- add mod_php for apache 2.4 (from httpd24 collection)- improve mod_p�x�����Pr��������������XJ8k���������#&�$����������������&&doraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Update to 1.0.0- Update to 0.9.94- Fixes load table.conf in German locale- Update to 0.9.93- Update to 0.9.92- Update to 0.9.91- Fixes import dictionary- Update to 0.8.93- Update to 0.8.92- Update to 0.8.91- Update to 0.8.1
- Fixes pinyin_init crashes- Fixes incomplete pinyin- Fixes chewing input- Update to 0.8.0- Update to 0.7.92- Update to 0.7.91- Update to 0.7.1- Update to 0.7.0- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Update libpinyin-0.7.x-head.patch- Update to 0.6.92- Removes provides ibus-pinyin-db- Fixes "jv" => "ju"- Update to 0.6.0- Update to 0.5.92- Provides ibus-pinyin-db- Improves full pinyin parser2- Update to 0.5.91- Fixes pinyin parsers- Update to 0.5.0- Update to 0.4.93- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Update to 0.4.92- Update to 0.4.91- Increase train factor- Update to 0.3.0- Update to 0.2.99.3- Fixes memory leak and save_db- Update libpinyin-0.3.x-head.patch- Add requires- Add patch libpinyin-0.3.x-head.patch- Update to 0.2.99.2- Update to 0.2.99.1- Split data sub package- Initial version/sbin/ldconfig/sbin/ldconfig	
��2.2.0-2.el82.2.0-2.el8.build-idf9df4d3969649d44d9a2742a332fa5badf0d9eadlibpinyinlibpinyin.so.13libpinyin.so.13.0.0libpinyinAUTHORSCOPYINGREADME/usr/lib//usr/lib/.build-id//usr/lib/.build-id/f9//usr/lib64//usr/share/doc//usr/share/doc/libpinyin/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryELF 64-bit LSB shared object, x86-64, version 1 (GNU/Linux), dynamically linked, BuildID[sha1]=f9df4d3969649d44d9a2742a332fa5badf0d9ead, strippedASCII textPPRRRRRRRRRRRR	R
RRRRRutf-8f40af04702436c3de0a61bcd0fa8b5eb063452effee9155d5c3520791c82b145?���  t��!�<���Q�d~���b_q
	Q�d~������C��fa�v��MP�c�R&�����T�a�EP��@��6�.���ķ�$/,A�z��qZ^�d�;P�'���*R��_7�t^28�����ţ�/��R���}�*.�a�
�&�Zc��)��-����A�N��S�PK-�^\5���'Ć�B��Vo���<h��qQ;�"�ȏG\r�h�*;^^D�*E��R2�~o_3���\�vN�^�yʋҽs�%�x�%ܳ{tn�*n��ל��e6���oX���H�s��WCBS��Orsk�^�|p@�1(Z$��d2�:в5���s|�
k<Խ��c=������t5՜>��S?��=�nGLY�I�o{��Im㨿`�4&H@��D��#���a�)��O��m�qz��[���D��!�<��ΰ��Q�d~���b_p
	Q�d~���$o�D�l��=ӈ�>GE���?7�oZ�]-���7��RYBV�����n��_�5u2A��k��y�#�w�g��ʡh��>.I9c�.��������r�wI�h��\,
Ԡ��%�������p�$�ʨ��*NW�=�[���+we���iٳ�4�E��u���L|���esf���d�"���M�6xMLJlʉ�'�3L�3zC$��|��JP/M�r��n�l04�M�i�IOYNk��=t��8@̯�ph�l��/[�q���c��\b��8�9�%1��v}�F���tj���W'�b"�dzj6�B�#��l��-u��N�eOF��˿�&����ᜦ���GrL{�㘄gdQ ��0���jq�HN�
R�+i�JE��647ea18a45d14f199943ad5b3ae5c3279101333a1c2c22c48d64755cd1d6bcb056b866b589eb60534f3d905b519e1f07799d7f15i/'|F�i/&�-H_HOME_NODE_ASSOCIATIVITY.patch [bz#1661967]
- kvm-redhat-Fixing-.gitpublish-to-include-AV-information.patch []
- Resolves: bz#1656510
  (Machine types for qemu-kvm based on rebase to qemu-3.1 (s390x))
- Resolves: bz#1661967
  (Kernel prints the message "VPHN is not supported. Disabling polling...")- kvm-redhat-define-pseries-rhel8.0.0-machine-type.patch [bz#1656508]
- Resolves: bz#1656508
  (Machine types for qemu-kvm based on rebase to qemu-3.1 (ppc64le))- kvm-pc-7�x���������������������Xl�l�g���������������$G�������������������A�?�d����	+�	7�\�`�|���	����������	
D��
�p�		X!h��(�89 :\>UG`H�IX!Y�!\�]H^Jb?d�e�f�l�t�uvT����������
)�lp�g�h�Ccpanel-perl-542-xml-sax1.021.cp130~el8CPAN moduleCpanel build perl module 'XML::SAX'h#Ӊbh-centos-8.dev.cpanel.net��perlcpanel/perlhttps://metacpan.orglinuxnoarch


touch `/usr/local/cpanel/3rdparty/perl/542/bin/perl -MConfig -e'print $Config{vendorlib}'`/XML/SAX/ParserDetails.ini
/usr/local/cpanel/3rdparty/perl/542/bin/perl -MXML::SAX -e 'XML::SAX->add_parser(q(XML::SAX::PurePerl))->save_parsers()'$5B9��PkB`W2
D�t�	�K	��Fq
=�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$]�&]��]�]�&]�&]��]��]�]��]��]��]��]��]��]��]��]��]��]��]��f6fb49c570353829a0d7c1e8bd148a5f1d5140c828480a4fa27fb72b9170bcbb0abeda789792e29e831d640c2e0fd146ae30c46f9e021fcd8385a10ae8846d37e046d7d416ef0587b4a5a38bf7cd1b6e681ca3c799dc2d7d132e5b805bf44d03a680c05422c7e542de183c1f373e601afa43d8c00e17349acd8c19b5fd03598492e1fac2e06e2097349acc56588e1665991917b581b52801169fdeece457bea5a334c77ec58b3f0e3fed20ba566122d713a53e77e1e4058d3dd18c75b65cc269df26478efbe5045802e1196d1bc19f6955cb00f419f20a62b2aa77137d48d1712807d22d4863a5f43f26ccd3a99e9d7b3c08656a8309d0d6732a758c78901e5e5466b413c5fe8ab0641d1ca7a044abc5d7c8efcab3d0b958f825865f2f1774e5d93807be95b521123d0f081a5b89deb75b06f1e1e0ce0805261168dab42ed7172fd0d09749fe8410b7b3f55fcb894d2de76709dee5c1f71f326362b1850dd2b374b6e89f9128ff5fd9316728502f730e8b6028dde56e85faad6fcbfd052e076a9f5d00fcae37f5fb8e3211fd5c932d8fe1a92a134de9cf09ad36a86db11cf878d53b2e37f97259c1f01500f962d19491779290f30a5674b50e4d0495865f255fec8b81679b23f6fa7a6b5cfba215e947b58a20c9866fa6278037277ae9285b6865973b548276b0d8beff1917e2011fa3401d519122523c1043f366594d9731fdf9c6f451fb0b41caec8173471ef8a5f44f554fe9dad742e27e472c4deac3fef4397d27d0740eac48c407363886618495f3f4961c5a8ad96b1b4428901d4a8c491a146d86a698186f00409ce1b5b36e0801c3851a43c6506054a4e49de657d89969df228905e2d75c1d0ba835c5bba7da2aacc5a0d9727e83b0b73e15a4e57d7drootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcpanel-perl-542-xml-sax-1.02-1.cp130~el8.src.rpm��������������������������������������������������������������������������������cpanel-perl(XML::SAX)cpanel-perl(XML::SAX::DocumentLocator)cpanel-perl(XML::SAX::ParserFactory)cpanel-perl(XML::SAX::PurePerl)cpanel-perl(XML::SAX::PurePerl::DebugHandler)cpanel-perl(XML::SAX::PurePerl::Exception)cpanel-perl(XML::SAX::PurePerl::Productions)cpanel-perl(XML::SAX::PurePerl::Reader)cpanel-perl(XML::SAX::PurePerl::Reader::Stream)cpanel-perl(XML::SAX::PurePerl::Reader::String)cpanel-perl(XML::SAX::PurePerl::Reader::URI)cpanel-perl-542-xml-saxcpanel-perl-542-xml-sax-documentlocatorcpanel-perl-542-xml-sax-parserfactorycpanel-perl-542-xml-sax-pureperlcpanel-perl-542-xml-sax-pureperl-debughandlercpan�x�������������������Xmm��x�d��$t����������������d�c�e��nson <pbrobinson@fedoraproject.org> 17.2.0-2Peter Robinson <pbrobinson@fedoraproject.org> 17.2.0-1Peter Robinson <pbrobinson@fedoraproject.org> 17.2.0-0.3.rc6Peter Robinson <pbrobinson@fedoraproject.org> 17.2.0-0.2.rc5Peter Robinson <pbrobinson@fedoraproject.org> 17.2.0-0.1.rc4Fedora Release Engineering <releng@fedoraproject.org> - 17.1.5-1.2Fedora Release Engineering <releng@fedoraproject.org> - 17.1.5-1.1Peter Robinson <pbrobinson@fedoraproject.org> 7.1.5-1Adam Jackson <ajax@redhat.com>Peter Robinson <pbrobinson@fedoraproject.org> 7.1.4-1Peter Robinson <pbrobinson@fedoraproject.org> 7.1.3-2Peter Robinson <pbrobinson@fedoraproject.org> 7.1.3-1Peter Robinson <pbrobinson@fedoraproject.org> 7.1.2-2Peter Robinson <pbrobinson@fedoraproject.org> 7.1.2-1Adam Jackson <ajax@redhat.com> - 17.1.1-2Peter Robinson <pbrobinson@fedoraproject.org> 17.1.1-1Dave Airlie <airlied@redhat.com> - 17.1.0-1Peter Robinson <pbrobinson@fedoraproject.org> 17.1.0-0.4.rc4Peter Robinson <pbrobinson@fedoraproject.org> 17.1.0-0.3.rc2Peter Robinson <pbrobinson@fedoraproject.org> 17.1.0-0.2.rc2Igor Gnatenko <ignatenko@redhat.com> - 17.1.0-0.1.rc1Igor Gnatenko <ignatenko@redhat.com> - 17.0.3-1Igor Gnatenko <ignatenko@redhat.com> - 17.0.2-2Peter Robinson <pbrobinson@fedoraproject.org> 17.0.2-1Hans de Goede <hdegoede@redhat.com> - 17.0.1-3Peter Robinson <pbrobinson@fedoraproject.org> 17.0.1-2Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 17.0.1-1Peter Robinson <pbrobinson@fedoraproject.org> 17.0.0-1Peter Robinson <pbrobinson@fedoraproject.org> 17.0.0-0.6.rc3Hans de Goede <hdegoede@redhat.com> - 17.0.0-0.5.rc2Hans de Goede <hdegoede@redhat.com> - 17.0.0-0.4.rc2Peter Robinson <pbrobinson@fedoraproject.org> 17.0.0-0.3.rc2Peter Robinson <pbrobinson@fedoraproject.org> 17.0.0-0.2.rc1Igor Gnatenko <ignatenko@redhat.com> - 17.0.0-0.rc1Hans de Goede <hdegoede@redhat.com> - 13.0.3-3Igor Gnatenko <ignatenko@redhat.com> - 13.0.3-2Peter Robinson <pbrobinson@fedoraproject.org> 13.0.3-1Igor Gnatenko <i.gnatenko.brain@gmail.com> - 13.0.2-2Peter Robinson <pbrobinson@fedoraproject.org> 13.0.2-1Peter Robinson <pbrobinson@fedoraproject.org> 13.0.1-1Peter Robinson <pbrobinson@fedoraproject.org> 13.0.0-3Peter Robinson <pbrobinson@fedoraproject.org> 13.0.0-2Peter Robinson <pbrobinson@fedoraproject.org> 13.0.0-1Dave Airlie <airlied@redhat.com> - 13.0.0-0.3.rc2Peter Robinson <pbrobinson@fedoraproject.org> 13.0.0-0.2.rc2Igor Gnatenko <i.gnatenko.brain@gmail.com> - 13.0.0-0.1.rc1Hans de Goede <hdegoede@redhat.com> - 12.0.3-2Peter Robinson <pbrobinson@fedoraproject.org> 12.0.3-1Peter Robinson <pbrobinson@fedoraproject.org> 12.0.2-1Hans de Goede <hdegoede@redhat.com> - 12.0.1-7Adam Jackson <ajax@redhat.com> - 12.0.1-6Igor Gnatenko <ignatenko@redhat.com> - 12.0.1-5Igor Gnatenko <ignatenko@redhat.com> - 12.0.1-4Igor Gnatenko <ignatenko@redhat.com> - 12.0.1-3Orion Poplawski <orion@cora.nwra.com> - 12.0.1-2Igor Gnatenko <ignatenko@redhat.com> - 12.0.1-1Igor Gnatenko <ignatenko@redhat.com> - 12.0.0-1Igor Gnatenko <ignatenko@redhat.com> - 12.0.0-0.3.rc4Adam Jackson <ajax@redhat.com> - 12.0.0-0.3.rc3Igor Gnatenko <ignatenko@redhat.com> - 12.0.0-0.2.rc3Dominik Mierzejewski <rpm@greysector.net> - 12.0.0-0.2.rc2Igor Gnatenko <ignatenko@redhat.com> - 12.0.0-0.1.rc2Igor Gnatenko <ignatenko@redhat.com> - 12.0.0-0.1.rc1Igor Gnatenko <ignatenko@redhat.com> - 11.3.0-0.4.gitcbcd7b6Igor Gnatenko <ignatenko@redhat.com> - 11.3.0-0.3.git171a570Björn Esser <fedora@besser82.io> - 11.3.0-0.2.gitea2bff1Igor Gnatenko <i.gnatenko.brain@gmail.com> - 11.3.0-0.1.gitea2bff1Igor Gnatenko <i.gnatenko.brain@gmail.com> - 11.2.0-0.1.rc3.20160320Dave Airlie <airlied@redhat.com> 11.2.0-0.devel.11Dave Airlie <airlied@redhat.com> 11.2.0-0.devel.10Adam Jackson <ajax@redhat.com> 11.2.0-0.devel.9Fedora Release Engineering <releng@fedoraproject.org> - 11.2.0-0.devel.8.24ea81a.1Adam Jackson <ajax@redhat.com> 11.2.0-0.devel.8Igor Gnatenko <i.gnatenko.brain@gmail.com> - 11.2.0-0.devel.7.24ea81aPeter Robinson <pbrobinson@fedorapro�x�������������p������Xn�l���������cv��$f����������������v�u�w��Integrate the redone components with Base. (Ales Kozumplik)
- Add comps Solver. (Ales Kozumplik)
- groups: redo the GroupPersistor class. (Ales Kozumplik)
- doc: faq: why we don't check for root. (RhBug:1088166) (Ales Kozumplik)
- cosmetic: reordered import statements (Jan Silhan)
- added --refresh option (RhBug:1064226) (Jan Silhan)
- added forgotten import (Jan Silhan)
- fixed import errors after yum/i18n.py removal (Jan Silhan)
- removed to_utf8 from yum/i18n.py (Jan Silhan)
- removed to_str from yum/i18n.py (Jan Silhan)
- removed utf8_text_fill from yum/i18n.py (Jan Silhan)
- removed utf8_width from yum/i18n.py (Jan Silhan)
- removed utf8_width_fill from yum/i18n.py (Jan Silhan)
- removed to_unicode from yum/i18n.py (Jan Silhan)
- make all strings unicode_literals implicitly (Jan Silhan)
- moved _, P_ to dnf/i18n.py (Jan Silhan)
- removed utf8_valid from yum/i18n.py (Jan Silhan)
- removed str_eq from yum/i18n.py (Jan Silhan)
- removed exception2msg from yum/i18n.py (Jan Silhan)
- removed dummy_wrapper from yum/i18n.py (Jan Silhan)
- cosmetics: leave around the good things from 660c3e5 (documentation, UT). (Ales Kozumplik)
- Revert "fix: provides are not recognized for erase command. (RhBug:1087063)" (Ales Kozumplik)
- fix: provides are not recognized for erase command. (RhBug:1087063) (Ales Kozumplik)
- test: fix UsageTest test, so it work without dnf is installed on the system PEP8 cleanup (Tim Lauridsen)
- cleanup: getSummary() and getUsage() can be dropped entirely now. (Ales Kozumplik)
- test: use Command.usage & Command.summary API in unittest (Tim Lauridsen)
- show plugin commands in separate block api: add new public Command.usage & Command.summary API cleanup: make Commands (Tim Lauridsen)
- tests: move libcomps test to a separate test file. (Ales Kozumplik)
- refactor: put DistoSyncCommand into its own file (Tim Lauridsen)
- refactor: commands.group: _split_extcmd is a static method. (Ales Kozumplik)
- GroupsCommand: make the way comps are searched more robust. (RhBug:1051869) (Ales Kozumplik)
- tests: move GroupCommand tests to a more proper place. (Ales Kozumplik)
- fix leak: Base.__del__ causes GC-uncollectable circles. (Ales Kozumplik)
- gruops: 'list' and similar commands should run without root. (RhBug:1080331) (Ales Kozumplik)
- refactor: conf is given to Output on instantiation. (Ales Kozumplik)
- remove: Command.done_command_once and Command.hidden. (Ales Kozumplik)
- [doc] improve documentation of '--best' (RhBug:1084553) (Ales Kozumplik)
- api: Command.base and Command.cli are API attributes. (Ales Kozumplik)
- demands: similarly to 78661a4, commands should set the exit success_exit_status directly. (Ales Kozumplik)
- demands: commands requiring resolving dymamically need to set the demand now. (Ales Kozumplik)
- doc: typo in group doc. (RhBug:1084139) (Ales Kozumplik)
- api: Base.resolve() takes allow_erasing. (RhBug:1073859) (Ales Kozumplik)
- refactor: OptionParser._checkAbsInstallRoot is static. (Ales Kozumplik)
- option_parser: remove base dependency. (Ales Kozumplik)
- move: dnf.cli.cli.OptionParser -> dnf.cli.option_parser.OptionParser. (Ales Kozumplik)
- doc: 'clean packages' incorrectly mentions we do not delete cached packages. (RhBug:1083767) (Ales Kozumplik)
- fix: TypeError in dnf history info <id> (RHBug: #1082230) (Tim Lauridsen)
- Start new version: 0.5.0. (Ales Kozumplik)
- remove: instance attrs of Base, namely cacheonly. (Ales Kozumplik)
- tests: remove: support.MockCli. (Ales Kozumplik)
- tests: fix locale independence. (Radek Holy)
- cleanups in cli.OptionParser. (Ales Kozumplik)
- fix: PendingDeprecationWarning from RPM in gpgKeyCheck(). (Ales Kozumplik)
- api: add Cli.demands.root_user (RhBug:1062889) (Ales Kozumplik)
- api: add Cli.demands and Command.config() to the API (RhBug:1062884) (Ales Kozumplik)
- Integrate DemandSheet into CLI. (Ales Kozumplik)
- Command.configure() takes the command arguments like run(). (Ales Kozumplik)
- Add dnf.cli.demand.DemandSheet. (Ales Kozumplik)
- remove: dead code for deplist, version and check-rpmdb commands. (�x���������������������Xo�l���������z������'L�$7����������������'L&L(L�ackage- fix build with new glibc
- fix License- define php_extdir in macros.php- obsolete php-dbase- add mcrypt, mhash, tidy, mssql subpackages (Dmitry Butskoy)
- enable dbase extension and package in -common- update to 5.2.3 (thanks to Jeff Sheltren)- fix php-pdo *_arg_force_ref global symbol abuse (#216125)- rebuild against uw-imap-devel- update to 5.2.2
- synch changes from upstream recommended php.ini- enable SASL support in LDAP extension (#205772)- drop mime_magic extension (deprecated by php-pecl-Fileinfo)- fix regression in str_{i,}replace (from upstream)- update to 5.2.1
- add Requires(pre) for httpd
- trim changelog to versions >= 5.0.0- bump default memory_limit to 32M (#220821)
- mark config files noreplace again (#174251)
- drop trailing dots from Summary fields
- use standard BuildRoot
- drop libtool15 patch (#226294)- add php(api), php(zend-abi) provides (#221302)
- package /usr/share/php and append to default include_path (#225434)- fix filter.h installation path
- fix php-zend-abi version (Remi Collet, #212804)- rebuild again- rebuild for net-snmp soname bump- build json and zip shared, in -common (Remi Collet, #215966)
- obsolete php-json and php-pecl-zip
- build readline extension into /usr/bin/php* (#210585)
- change module subpackages to require php-common not php (#177821)- provide php-zend-abi (#212804)
- add /etc/rpm/macros.php exporting interface versions
- synch with upstream recommended php.ini- update to 5.2.0 (#213837)
- php-xml provides php-domxml (#215656)
- fix php-pdo-abi provide (#214281)- rebuild for curl soname bump
- add build fix for curl 7.16 API- from upstream: add safety checks against integer overflow in _ecalloc- update to 5.1.6 (security fixes)
- bump default memory_limit to 16M (#196802)- rebuild- Provide php-posix (#194583)
- only provide php-pcntl from -cli subpackage
- add missing defattr's (thanks to Matthias Saou)- move Obsoletes for php-openssl to -common (#194501)
- Provide: php-cgi from -cli subpackage- split out php-cli, php-common subpackages (#177821)
- add php-pdo-abi version export (#193202)- rebuilt for new libnetsnmp- provide mod_php (#187891)
- provide php-cli (#192196)
- use correct LDAP fix (#181518)
- define _GNU_SOURCE in php_config.h and leave it defined
- drop (circular) dependency on php-pear- update to 5.1.4- update to 5.1.3- provide php-api (#183227)
- add provides for all builtin modules (Tim Jackson, #173804)
- own %{_libdir}/php/pear for PEAR packages (per #176733)
- add obsoletes to allow upgrade from FE4 PDO packages (#181863)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuild for new libc-client soname- only build xmlreader and xmlwriter shared (#177810)- update to 5.1.2- rebuild again- rebuild for new net-snmp- enable short_open_tag in default php.ini again (#175381)- rebuilt- require net-snmp for php-snmp (#174800)- add /usr/share/pear back to hard-coded include_path (#174885)- rebuild for httpd 2.2- update to 5.1.1
- remove pear subpackage
- enable pdo extensions (php-pdo subpackage)
- remove non-standard conditional module builds
- enable xmlreader extension- rebuilt against new openssl- pear: update to XML_RPC 1.4.4, XML_Parser 1.2.7, Mail 1.1.9 (#172528)- rebuild for new libnetsnmp- update to 5.0.5
- add fix for upstream #34435
- devel: require autoconf, automake (#159283)
- pear: update to HTTP-1.3.6, Mail-1.1.8, Net_SMTP-1.2.7, XML_RPC-1.4.1
- fix imagettftext et al (upstream, #161001)- ldap: restore ldap_start_tls() function- disable RPATHs in shared extensions (#156974)- build simplexml_import_dom even with shared dom (#156434)
- prevent truncation of copied files to ~2Mb (#155916)
- install /usr/bin/php from CLI build alongside CGI
- enable sysvmsg extension (#142988)- prevent build of builtin dba as well as shared extension- split out dba and bcmath extensions into subpackages
- BuildRequire gcc-c++ to avoid AC_PROG_CXX{,CPP} failure (#155221)
- pear: update to DB-1.7.6
- enable FastCGI support in /usr/bi�x�������������`�������Xp_m������������$�������������������:�
���������������xsgbVQE@4/#
���������������ythcWRFA50$�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
z
u
i
d
X
S
G
B
6
1
%
 



���������������{vjeYTHC72&!���������������|wkfZUID83'"�
�
�
�
�
�
�
�
�
�
�
�
�
�
}
x
l
g
[
V
J
E
9
4
(
#




�	�	�	�	�	�	�	�	�	�	�	�	�	�	~	y	m	h	\	W	K	F	:	5	)	$					��������������zni]XLG;6*%���������������{oj^YMH<7+&	���������������|pk_ZNI=8,'
���������������}ql`[OJ>9-(���������������~rma\PK?:.)���������������snb]QL@;/�A�:����A�:����A�:����A�:����A�:����A�:����A�:���Vg����4�Vg����4��A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:����A�:���>[;�	�>�O�w���k�>[;%p<��>[;�)�_�����l��|!����n�Ğ�O�w[O���q�߻���q�6��5�>[;�	�'���uP�ԧ�>[;�]�>[;�(`)�Iq��,����멏���>[;5�E��q��Kx��q�w��5������-���u���>[;�m�>[;�(�A��$�+�`$�`��1����T���O�wԁ����q��L����q���;�>[;	�?�>[;tl�<��$�:�8%������|������-�>[;�3���O�w���_��q�߼�d��q��LN����
����!Lw�>[;�k���>[;�*�>[;�'���$�Śd^�>[;!3���q�fMh��q�t��>������
��u�$�>[;Fx1�����o��>[;�j��>[;l'H����,�8��q�b����q�C�I�����(�G���k8�>[;�ixO�>[;,$�>[;�&��[�<�����>[;ʋ�&��M����>[;�1-��q�NdL��q���4J������G��PD��>[;+h���oV�4�>[;�L%�>[;���^�>[;T1ķ��q���hJ��q���D_�����&>[;Z�>~G���~%{�oVu7Pdy>[;P`:y>[;�%HCx>[;��xTu>[;�08sE�14�q	�q�7*(_p��)1o>[; nO�w�H|m
G��P�=k
��6�t�j�oV�.��
i�]t��/hT��R�IJd��떙��d>[;0̫c��
#(XaE�17h+a	�q�(<{`��U8_>[;��=^>!�9�T�[G��OP 9[>[;��Y>[;��U>[;J/T@S���=YQE�1]3�Q	�q���P�����KG��J6h2K>[;�98-J�oVI7�I>[;v,WIW��
H>[;"�HVg�t��2F>[;C~$E>[;4.�eCE�1�%\A	�q�9A@Vg����.?���\;?>[;N�>�Â�4S;>[;a9<+:>[;(�9Vg���d-6>[;�}d+5���ٔ�E4>[;�-hL3�q��@0���X�|�/>[;�@4.�q����L+>[;^8<*>[;>}�V%O�wO��."�q��?� �f#�,���%�� >[;�q�L�b0*��>[;�7�0�@��0�q��>4����\��q���$E>[;�7�A��2�+>[;�p�>[;�*XwO�w��A��[�ԫ�q����x�������������ز�������Xq-l8|�#
���$-�����������������������hp_content_types.hphp_getopt.hphp_globals.hphp_ini.hphp_logos.hphp_main.hphp_memory_streams.hphp_network.hphp_open_temporary_file.hphp_output.hphp_reentrancy.hphp_scandir.hphp_streams.hphp_syslog.hphp_ticks.hphp_variables.hphp_version.hrfc1867.hsnprintf.hspprintf.hstreamsphp_stream_context.hphp_stream_filter_api.hphp_stream_glob_wrapper.hphp_stream_mmap.hphp_stream_plain_wrapper.hphp_stream_transport.hphp_stream_userspace.hphp_streams_int.hsapiclicli.hbuildMakefile.globalacinclude.m4config.guessconfig.sublibtool.m4ltmain.shmkdep.awkphpize.m4run-tests.phpscan_makefile_in.awkshtoolphp-config.1.gz/etc/rpm//opt/cpanel/ea-php54/root/usr/bin//opt/cpanel/ea-php54/root/usr/include//opt/cpanel/ea-php54/root/usr/include/php//opt/cpanel/ea-php54/root/usr/include/php/TSRM//opt/cpanel/ea-php54/root/usr/include/php/Zend//opt/cpanel/ea-php54/root/usr/include/php/ext//opt/cpanel/ea-php54/root/usr/include/php/ext/date//opt/cpanel/ea-php54/root/usr/include/php/ext/date/lib//opt/cpanel/ea-php54/root/usr/include/php/ext/dom//opt/cpanel/ea-php54/root/usr/include/php/ext/ereg//opt/cpanel/ea-php54/root/usr/include/php/ext/ereg/regex//opt/cpanel/ea-php54/root/usr/include/php/ext/filter//opt/cpanel/ea-php54/root/usr/include/php/ext/gd//opt/cpanel/ea-php54/root/usr/include/php/ext/gd/libgd//opt/cpanel/ea-php54/root/usr/include/php/ext/hash//opt/cpanel/ea-php54/root/usr/include/php/ext/iconv//opt/cpanel/ea-php54/root/usr/include/php/ext/json//opt/cpanel/ea-php54/root/usr/include/php/ext/libxml//opt/cpanel/ea-php54/root/usr/include/php/ext/mbstring//opt/cpanel/ea-php54/root/usr/include/php/ext/mbstring/libmbfl//opt/cpanel/ea-php54/root/usr/include/php/ext/mbstring/libmbfl/mbfl//opt/cpanel/ea-php54/root/usr/include/php/ext/mbstring/oniguruma//opt/cpanel/ea-php54/root/usr/include/php/ext/mysqli//opt/cpanel/ea-php54/root/usr/include/php/ext/mysqlnd//opt/cpanel/ea-php54/root/usr/include/php/ext/pcre//opt/cpanel/ea-php54/root/usr/include/php/ext/pdo//opt/cpanel/ea-php54/root/usr/include/php/ext/session//opt/cpanel/ea-php54/root/usr/include/php/ext/sockets//opt/cpanel/ea-php54/root/usr/include/php/ext/spl//opt/cpanel/ea-php54/root/usr/include/php/ext/standard//opt/cpanel/ea-php54/root/usr/include/php/ext/xml//opt/cpanel/ea-php54/root/usr/include/php/main//opt/cpanel/ea-php54/root/usr/include/php/main/streams//opt/cpanel/ea-php54/root/usr/include/php/sapi//opt/cpanel/ea-php54/root/usr/include/php/sapi/cli//opt/cpanel/ea-php54/root/usr/lib64/php//opt/cpanel/ea-php54/root/usr/lib64/php/build//opt/cpanel/ea-php54/root/usr/share/man/man1/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu�x�������������P��������Xr�k���������������<��$,����������������<�;��E:�?9�d����0�	4�	v���������������	"�8�L�R\p	z
��
h|����@
t
�
(48<]9�]:�]G5�H5�I5�X5�Y5�\6]6,^6vb7d8Qe8Vf8Yl8[t8tu8�v8��9D�9H�9N�9�9�9�9�_:_
:v:��:�:�:�g:�h:�Cea-php80-php-iconv8.0.309.el8.cloudlinux.6A module for PHP applications that need to convert character setsThe php-iconv package delivers a module which will allow PHP scripts
to access the iconv character set conversion facility. With this
module, you can turn a string represented by a local character set
into the one represented by another character set, which may be the
Unicode character set. Supported character sets depend on the iconv
implementation of your system. Note that the iconv function on some
systems may not work as you expect. In such case, it would be a good
idea to install the GNU libiconv library. It will most likely end up
with more consistent results.i�}pbuild.cloudlinux.com�CCloudLinuxCloudLinuxPHPCloudLinux Packaging Team <packager@cloudlinux.com>Development/Languageshttp://www.php.net/linuxx86_643�C����A�A�i�}[i�}^i�}li�}li�}lff39bb617a69ee9982216336b30f89dea151edd26388220cb6e0944c9b55b3816ebdde0e93fb02f0ed0f709ba7ec84db3d7934f5e41bdaafc4b8497f4a24ae9e../../../../opt/cpanel/ea-php80/root/usr/lib64/php/modules/iconv.sorootrootrootrootrootrootrootrootrootrootea-php80-php-8.0.30-9.el8.cloudlinux.6.src.rpm��������������������config(ea-php80-php-iconv)ea-php80-php-iconvea-php80-php-iconv(x86-64)@@@@@



@config(ea-php80-php-iconv)ea-php80-php-cli(x86-64)ea-php80-php-common(x86-64)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)1:8.0.30-9.el8.cloudlinux.61:8.0.30-9.el8.cloudlinux.61:8.0.30-9.el8.cloudlinux.63.0.4-14.6.0-14.0-15.2-14.14.3i�q@i���i�5�i�A@i���ix��h�@h�C�ht�@h4W�h%�@g�g��g}@g�@f�X@f�o@f�K�f>@e��e��ehy@ee�@d��@d��du�@df@dd��dX�@d,@c�w�c��@c���c�E�cs@c[�@c6�@c5��c1�@c��b�b��b�2@b|��bY^@b3"�b\@b�@a�N�aՈ@a�@a�d�a���a�{�a���a�@aqV@an�@a]��aV�@aLl@a'�@a�@`�#@`ݮ@`ٹ�`�
@`��`� @`���`[)�`Gc@`B@`@�`7�@`3@_���_��_��_���_�G@_��@_�i�_�#�_��@_��@_���_���_���_�"�_i�@_FN�_
�@Sergey Fokin <sfokin@cloudlinux.com> - 8.0.30-9.cloudlinux.6Razmik Manvelyan <rmanvelyan@cloudlinux.com> - 1:8.0.30-9.cloudlinux.5Levon Matshkalyan <lmatshkalyan@cloudlinux.com> - 1:8.0.30-9.cloudlinux.4Sergey Fokin <sfokin@cloudlinux.com> - 1:8.0.30-9.cloudlinux.3Razmik Manvelyan <rmanvelyan@cloudlinux.com> - 8.0.30-9.cloudlinux.2Arseniy Zolotarev <azolotarev@cloudlinux.com> - 8.0.30-9.cloudlinux.1Chris Castillo <chris.castillo@webpros.com> - 8.0.30-9Vladimir D. Seleznev <vseleznev@cloudlinux.com> - 8.0.30-8.cloudlinux.6Sergey Fokin <sfokin@cloudlinux.com> - 8.0.30-8.cloudlinux.5Dmitrii Samoilov <dsamoilov@cloudlinux.com> - 8.0.30-8.cloudlinux.4Azat Nurgaliev <anurgaliev@cloudlinux.com> - 8.0.30-8.cloudlinux.3Ser�x�������������ȑ�������Xsol�����������������$)������������������>
xecutabledirectoryUTF-8 Unicode textASCII textunified diff output, UTF-8 Unicode text, with very long lines, with escape sequencestroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)Perl5 module source textPerl POD document, ASCII text
AFJNTWZ^fux}�����������������������+
RRWRXRRRR;RWRYRPRR)R6R<R?RPRRRSRWRXRYPRR	R
RRR
RRRRRRRRRRRR R!R"R#R$R%R&R)R*R/R1R3R5R6R7R8R:R;R>RFRGRJRKRWRXPRQRRRWRXPRRWRXPRRWRXPRR*R8RWRXPRWRXPRWRXP	RVRWRXP
RRR&R*R:RWRXPRPP
PPPPPPR&R/R;RWRXPRVRXPPRVRWRXPRVRWRXPRVRWRXPRVRWRXPRR5R6R:RWRXPRWPRR)R3R6R:R;R>RWRXPR@RRWRXPRWRXPR&R6R:R;RWRXP RWRXP!R
R*RWRXP"R;RWRXP#RRWRXP%P$R&R5R>RDRWRXP&RWRXP'R1RWRXP(RWRYP)R:R;P*RVRXP+P,RWRXP-R&R*RWRXP.R
R6RWRXP/RVRXP0RWRXperl(Term::ReadKey)perl(Text::Levenshtein::Damerau::XS)perl(YAML::Syck)utf-84b24aab280bd4ddf04b1d7bf4ebc26c7531fdd6fa41632ddef7b277150487bc6?������3!�^���P,��*����%�h?

	*����%�����@���|��F&�!K�·"��䤮�K��3�^C��ձ<��^�&�NZ)��,hb[<9��\F4@�!͍+�r�k�v�ˉj�(��-���x#��#a�4�S�AdY�_���q�nY�0�O(��?��g*��iT�[��s���+ah��`ZH�3V�I�F�G��Pʕ1H�F���v�ku�C�FFd c�3Բ�Uy�D�d)HJ@[�UIb����)��"���ե%��]���k/��3��S�e
�Q��x+Q�|�@ܖ��L�f`��
�.�r�$��4���(�0�E��mYZ����lb9F<�pL��u���8�!f�[?������#mgα;8<;z���Y��|Od��z�T��ΫW������d�����1�TZ4cr/���n���6=��90��`��;��8������ȟ�CX���.��2�)����h���
)�a/�XJ����-9�r1o�/�.`SB@��z���@���ha��������d�1�賁 �3!�^���P,��*����%�h?

	*����%����\
Ƥ�E1V*��Ry���K� ���D��u/^�E�H2�`��p5Ɂ�#J��TAUɐ�����k>Q+B|2���̐Y�k�&Gy��W�[kuϻ�đ�wr���e~���'�k�خTZ'�2^��	t��;��Za��� �s�hP�&B���`��2�-h_������Y�K�?l$�+n��ݤ;zf�h5蚧��N?��S	O���'}V,�VZ�!�(B��En�y˸C�@�G?~<��OR�D�*�M|mz;@���؍O��|T��GַU�W��Xon�sh��:����*�-���P��ڮ����m�U�u�_��s�y�0b	hfO�.�����Qy2�%Ce��9�pf
��4�Xejm=�T;i�φj���Z/SDU��ҁ��9�*����r�d[�]����/�L����Ѣ�w��$�3����g�Ϧ`fk;,e��].w�u=�J)�}��&P����<<6�!R�s�A7Z#|0� 5�G@kL6244b0680b7ad1fd44d63373298f6804bb0e2521aa4ac93978b3ecf570f63d0601903b6ff6fb7ab7f6b5c363f6284d4d3d6a1786i02���i02�p pam_stack module as it is obsolete
- some changes to silence rpmlint- properly include /var/log/faillog and tallylog as ghosts
  and create them in post script (#209646)
- update gmo files as we patch some po files (#218271)
- add use_current_range option to pam_selinux (#220487)
- improve the role selection in pam_selinux
- remove shortcut on Password: in ja locale (#218271)
- revert to old euid and not ruid when setting euid in pam_keyinit (#219486)
- rename selinux-namespace patch to namespace-level- fix selection of role- add possibility to pam_namespace to only change MLS component
- Resolves: Bug #216184- add select-context option to pam_selinux (#213812)
- au�x�������������������X)'l���������s���$3�����������������������ckage summary and description
- add security fix for CVE-2013-4248- improve mod_php, pgsql and ldap description
- add missing man pages (phar, php-cgi)
- add provides php(pdo-abi) for consistency with php(api) and php(zend-abi)
- use %__isa_bits instead of %__isa in ABI suffix #985350- add security fix for CVE-2013-4113
- add missing ASL 1.0 license- run tests during build- rebase to 5.4.16
- fix hang in FindTishriMolad(), #965144
- patch for upstream Bug #64915 error_log ignored when daemonize=0
- patch for upstream Bug #64949 Buffer overflow in _pdo_pgsql_error, #969103
- patch for upstream bug #64960 Segfault in gc_zval_possible_root- remove wrappers in /usr/bin (#966407)- rebuild for libjpeg (instead of libjpeg_turbo)
- fix unowned dir %{_datadir}/fpm and %{_libdir}/httpd (#956221)- update to 5.4.14
- clean old deprecated options- update to 5.4.13
- security fixes for CVE-2013-1635 and CVE-2013-1643
- make php-mysql package optional (and disabled)
- make ZTS build optional (and disabled)
- always try to load mod_php (apache warning is usefull)
- Hardened build (links with -z now option)
- Remove %config from /etc/rpm/macros.php- update to 5.4.11
- fix php.conf to allow MultiViews managed by php scripts- update to 5.4.10
- remove patches merged upstream
- drop "Configure Command" from phpinfo output
- prevent php_config.h changes across (otherwise identical)
  rebuilds- update to 5.4.9- fix php.conf- filter private shared in _httpd_modir
- improve system libzip patch to use pkg-config
- use _httpd_contentdir macro and fix php.gif path
- switch back to upstream generated scanner/parser
- use system pcre only when recent enough- improves php.conf, no need to be relocated- clarify Licenses
- missing provides xmlreader and xmlwriter
- change php embedded library soname version to 5.4- fix mysql_sock macro definition- fix standard build (non scl)- fix installed headers- use libldap_r for ldap extension- add missing scl_prefix in some provides/requires- make php-enchant optionnal, not available on RHEL-5
- make php-recode optionnal, not available on RHEL-5
- disable t1lib on RHEL-5- enable tidy on RHEL-6 only
- re-enable unit tests- minor macro fixes for RHEL-5 build
- update autotools workaround for RHEL-5
- use readline when libedit not available (RHEL-5)- update to 5.4.8
- define both session.save_handler and session.save_path
- fix possible segfault in libxml (#828526)
- use SKIP_ONLINE_TEST during make test
- php-devel requires pcre-devel and php-cli (instead of php)
- provides php-phar
- update systzdata patch to v10, timezone are case insensitive- php-fpm: create apache user if needed
- php-cli: provides cli command in standard root (scl)- add configtest option to init script
- test configuration before service reload
- fix php-fpm service relocation
- fix php-fpm config relocation
- drop embdded subpackage for scl- missing requires on scl-runtime
- relocate /var/lib/session
- fix php-devel requires
- rename, but don't relocate macros.php- initial spec rewrite for scl build- fix typo in systemd macro- php-fpm: enable PrivateTmp
- php-fpm: new systemd macros (#850268)
- php-fpm: add upstream patch for startup issue (#846858)- systemd integration, https://bugs.php.net/63085
- no odbc call during timeout, https://bugs.php.net/63171
- check sqlite3_column_table_name, https://bugs.php.net/63149- most failed tests explained (i386, x86_64)- fix for http://bugs.php.net/63126 (#783967)- patch to ensure we use latest libdb (not libdb4)- really fix rhel tests (use libzip and libdb)- fix test to enable zip extension on RHEL-7- remove session.save_path from php.ini
  move it to apache and php-fpm configuration files- update to 5.4.7
  http://www.php.net/releases/5_4_7.php
- php-fpm: don't daemonize- enable php-fpm on secondary arch (#849490)- update to 5.4.6
- update to v9 of systzdata patch
- backport fix for new libxml- update to 5.4.5- also provide php(language)%{_isa}
- define %{php_version}- drop BR for libevent (#835671)
- provide php(language) to allow ve�x�����0>������hp�������X��l���������������h��$x����������������h�g�i��l Luscon)
- shell: handle ctrl+D more gracefully (Michal Luscon)
- groups: set demands in configure instead of run (Michal Luscon)
- shell: implement config cmd (Michal Luscon)
- shell: add help (Michal Luscon)
- shell: make alias repo list -> repolist (Michal Luscon)
- shell: catch exceptions from do_transaction (Michal Luscon)
- shell: resolve transaction in ts run (Michal Luscon)
- shell: add default value for internal methods argument (Michal Luscon)
- shell: create run alias for ts run (Michal Luscon)
- shell: add ts list cmd (Michal Luscon)
- shell: refill sack after every successful repo cmd (Michal Luscon)
- shell: allow running multiple transaction in one session (Michal Luscon)
- shell: add ts command (Michal Luscon)
- shell: catch cmd parsing and run exceptions (Michal Luscon)
- shell: allow to run scripts (Michal Luscon)
- shell: add repo cmd (Michal Luscon)
- shell: add resolving + transaction run support (Michal Luscon)
- shell: implement quit method (Michal Luscon)
- shell: add custom cmds stubs (Michal Luscon)
- shell: implement basic logic (Michal Luscon)
- shell: register new cmd (Michal Luscon)- tests: catch ModuleNotFoundError as well (Igor Gnatenko)
- Switch out automatic service for automatic-download and automatic-install
  (Pat Riehecky)
- Make upgrade-to alias for upgrade (RhBug:1327999) (Jaroslav Mracek)
- skip appending an empty option (RhBug: 1400081) (Michael Mraka)
- Add description of nevra foems for commands and autoremove args (Jaroslav
  Mracek)
- Add support of arguments nevra forms for autoremove command (Jaroslav Mracek)
- Add nevra forms for remove command (Jaroslav Mracek)
- Add nevra forms for install command (Jaroslav Mracek)
- add bin/yum into .gitignore (Michal Luscon)
- clean: acquire all locks before cleaning (RhBug:1293782) (Michal Luscon)
- Change hawkey version requirement (Jaroslav Mracek)
- Add information for translators (RhBug:1386078) (Jaroslav Mracek)
- Change info to warning for clean repoquery output (RhBug:1358245) (Jaroslav
  Mracek)
- Add description of pkg flag for Query (RhBug:1243393) (Jaroslav Mracek)
- Add minor changes in documentation (Jaroslav Mracek)
- Do not always overwrite the name with the repo ID (Neal Gompa)- See http://dnf.readthedocs.io/en/latest/release_notes.html- See http://dnf.readthedocs.io/en/latest/release_notes.html- Obsolete dnf-langpacks
- Backport patch for dnf repolist disabled- Update to 1.1.10- Fix typo- Also change shebang for %{?system_python_abi} in %{_bindir}/dnf- Add %{?system_python_abi}- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- Revert "group: treat mandatory pkgs as mandatory if strict=true" (RhBug:1337731)
- enforce-api: reflect changes from #992475 in completion_helper (RhBug:1338504)
- enforce-api: add compatibility methods for renamed counterparts (RhBug:1338564)- doc: release notes 1.1.9 (Igor Gnatenko)
- spec: correctly set up requirements for python subpkg (Igor Gnatenko)
- spec: follow new packaging guidelines & make compatible with el7 (Igor
  Gnatenko)
- zanata update (Jan Silhan)
- enforce-api: add missing bits of Base class (Michal Luscon)
- help: unify help msg strings (Michal Luscon)
- enforce-api: decorate Base class (Michal Luscon)
- util: add decorator informing users of nonapi functions (Michal Luscon)
- Added description for 'autoremove' in dnf help (RhBug:1324086) (Abhijeet
  Kasurde)
- i18n: fixup for 0db13feed (Michal Luscon)
- i18n: use fallback mode if terminal does not support UTF-8 (RhBug:1332012)
  (Michal Luscon)
- Revert "spec: follow new packaging guidelines & make compatible with el7"
  (Michal Luscon)
- move autoglob feature directly to filterm() and filter() (Michael Mraka)
- group: treat mandatory pkgs as mandatory if strict=true (RhBug:1292892)
  (Michal Luscon)
- locks: fix lock paths in tmpfsd config since cachedir has been changed
  (Michal Luscon)
- remove formating from translation strings (Michal Luscon)
- base: set diskspace check filter before applying the filters (RhBug:1328674)
  (Michal Luscon)
- order �x������������� `�������Xv�l�<"L�$2����������������"L!L#L�.- EA4D-65: Added patch for LiteSpeed SIGTERM cleanup- Updated to version 7.0.30 via update_pkg.pl (EA-7426)- EA4D-53: Update LSAPI to 7.1
- ALTPHP-491: add use_reject to LSPHP- ZC-3603: Update litespeed to the latest version (7.1).- EA-7382: Update dependency on ea-openssl to require the latest version with versioned symbols.- EA4D-4: Duplications in cli and litespeed were removed- EA-7347: Update to v7.0.29, drop v7.0.28- EA4D-50: Change ea-openssl directory to /opt/cpanel/ea-openssl- ZC-3552: Added versioning to ea-openssl and ea-libcurl requirements.- ZC-3475: Update for ea-openssl shared object- Updated to version 7.0.28 via update_pkg.pl (EA-7272)- HB-3287: Increase open file limit for php-fpm by default- Filter libxml2.so from requires- HB-3263: Ensure securetmp is done before starting FPM- EA-7044: Adjust PHPs to use ea-libxml2- HB-3061: Fix epoll bug.- ALTPHP-424: Add timestamps to LSPHP log messages- Updated to version 7.0.27 via update_pkg.pl (EA-7078)- Updated to version 7.0.26 via update_pkg.pl (ZC-3095)- EA-6812: build PHP against ea-openssl like Apache- Updated to version 7.0.25 via update_pkg.pl (EA-6939)- EA-6866: Update mail-header patch for segfaults under Apache- EA-4653: Update mail header patch for 7.0- HB-2873: Added network-online.target to "After" in the service file- EA-6819: Patch to support libtidy 5.4.0- Updated to version 7.0.24 via update_pkg.pl (EA-6854)- Update to 7.0.24- ALTPHP-380: added user.ini lookup in home dir
- ALTPHP-380: changed CRIU messaging- Update to 7.0.23- Updated to version 7.0.23 via update_pkg.pl (EA-6761)- ALTPHP-364: Added сorrect exit from lve if the nproc limit is reached- Updated to version 7.0.22 via update_pkg.pl (EA-6591)- update to 7.0.22- EA-6574: Make permissions on FPM socket dir more secure- ALTPHP-351: make lsphp error messaqges more informative
- ALTPHP-354: SIGCHILD handler fix after CRIU restoring- update PHP to 7.0.21
- update LiteSpeed SAPI to 6.11- add require for ea-libnghttp2- EA-6484: Clarify Summary and Description for DSO- EA-6232: Build -curl with HTTP/2 support- LSPHP: fix php_value wrong priorities
- LSPHP: fix using options from .user.ini- Update to 7.0.20- EA-6292: Switch libxml2 to OS provided libraries- EA-6282: Swapped ea-php## symlinks to match EasyApache 3 compatibility- Update to 7.0.19- Updated to version 7.0.19 via update_pkg.pl (EA-6265)- Switch libxml2 to cPanel distributed packages- EA-6063: Add ea-php70 binary symlinks to /usr/bin and /usr/local/bin- Disable dtrace functionality since CentOS does not provide dtrace via repos.- EA-6203: Correct OpCache blacklist directory- rebuild with ea-libcurl from Stable repository- ALTPHP-333: Update to 7.0.18- Updated to version 7.0.18 via update_pkg.pl (EA-6153)- ALTPHP-323: LSPHP: update CRIU patch- EA-2422: use ea-libcurl instead of system curl package- Updated to version 7.0.17 via update_pkg.pl (EA-6067)- ZC-2475: PHPs need build reqs when building for libcurl- EA-2422: Have PHPs use our ea-libcurl- EA-6008: remove bz2 and calendar from common’s Provides- Updated to version 7.0.16 via update_pkg.pl (EA-5993)- EA-5863: Remove patch from 7.0.12-2 as it adds duplicate info- EA-5946: force requirement of ea-libtidy instead of .so from BuildRequires ea-libtidy-devel- EA-5839: Add opcache.validate_permission to opcache ini- EA-5807: enable php-tidy on rhel 6 and above- ALTPHP-306: LSPHP: Return response code and response status line in cgi/fcgi manner
- Update CRIU patch to version 7- update to 7.0.15- CRIU patch updated- updated wink_server_is_ready patch
- added criu patch (CL7)- update to 7.0.14- EA-3685: do not create apache user/group since we use nobody- Fix erronous getpwnam message in php-fpm jailshell code- Ensure the same extensions are compiled statically across all
  SAPI types (EA-5587)- Make php-cli require php-litespeed- Updated to version 7.0.13 via update_pkg.pl (EA-5626)- ALTPHP-238: litespeed-php updated to 6.10
- AL-1865: Back to ea-php "Ensure that php.d is not scanned �x��������������O�������Xw~j���������T��$��������������������> - 5.33-9Kamil Dudka <kdudka@redhat.com> - 5.33-8Kamil Dudka <kdudka@redhat.com> - 5.33-7Kamil Dudka <kdudka@redhat.com> - 5.33-6Kamil Dudka <kdudka@redhat.com> - 5.33-5Kamil Dudka <kdudka@redhat.com> - 5.33-4Miro Hrončok <mhroncok@redhat.com> - 5.33-3Kamil Dudka <kdudka@redhat.com> - 5.33-2Kamil Dudka <kdudka@redhat.com> - 5.33-1Kamil Dudka <kdudka@redhat.com> - 5.32-4Fedora Release Engineering <releng@fedoraproject.org> - 5.32-3Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 5.32-2Kamil Dudka <kdudka@redhat.com> - 5.32-1Zbigniew Jędrzejewski-Szmek <zbyszek@in.waw.pl> - 5.31-10Marek Cermak <macermak@redhat.com> - 5.31-9Marek Cermak <macermak@redhat.com> - 5.31-8Marek Cermak <macermak@redhat.com> - 5.31-7Fedora Release Engineering <releng@fedoraproject.org> - 5.31-6Marek Cermak <macermak@redhat.com> - 5.31-5Florian Weimer <fweimer@redhat.com> - 5.31-4Fedora Release Engineering <releng@fedoraproject.org> - 5.31-3Marek Cermak <macermak@redhat.com> - 5.31-2Kamil Dudka <kdudka@redhat.com> - 5.31-1Kamil Dudka <kdudka@redhat.com> - 5.30-6Kamil Dudka <kdudka@redhat.com> - 5.30-5Kamil Dudka <kdudka@redhat.com> - 5.30-4Kamil Dudka <kdudka@redhat.com> - 5.30-3Kamil Dudka <kdudka@redhat.com> - 5.30-2Kamil Dudka <kdudka@redhat.com> - 5.30-1Kamil Dudka <kdudka@redhat.com> - 5.29-3Charalampos Stratakis <cstratak@redhat.com> - 5.29-2Kamil Dudka <kdudka@redhat.com> - 5.29-1Kamil Dudka <kdudka@redhat.com> - 5.28-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.28-3Igor Gnatenko <i.gnatenko.brain@gmail.com> - 5.28-2Kamil Dudka <kdudka@redhat.com> - 5.28-1Fedora Release Engineering <releng@fedoraproject.org> - 5.25-6Jan Kaluza <jkaluza@redhat.com> - 5.25-5Jan Kaluza <jkaluza@redhat.com> - 5.25-4Jan kaluza <jkaluza@redhat.com> - 5.25-3Robert Kuska <rkuska@redhat.com> - 5.25-2Jan Kaluza <jkaluza@redhat.com> - 5.25-1Jan Kaluza <jkaluza@redhat.com> - 5.24-1Jan Kaluza <jkaluza@redhat.com> - 5.22-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.22-4Till Maas <opensource@till.name> - 5.22-3Jan Kaluza <jkaluza@redhat.com> - 5.22-2Jan Kaluza <jkaluza@redhat.com> - 5.22-1Jan Kaluza <jkaluza@redhat.com> - 5.19-7Jan Kaluza <jkaluza@redhat.com> - 5.19-6Jan Kaluza <jkaluza@redhat.com> - 5.19-5Jan Kaluza <jkaluza@redhat.com> - 5.19-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.19-3Tom Callaway <spot@fedoraproject.org> - 5.19-2Jan Kaluza <jkaluza@redhat.com> - 5.19-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.14-22Kalev Lember <kalevlember@gmail.com> - 5.14-21Jan Kaluza <jkaluza@redhat.com> - 5.14-20Jan Kaluza <jkaluza@redhat.com> - 5.14-19Jan Kaluza <jkaluza@redhat.com> - 5.14-18Jan Kaluza <jkaluza@redhat.com> - 5.14-17Jan Kaluza <jkaluza@redhat.com> - 5.14-16Jan Kaluza <jkaluza@redhat.com> - 5.14-15Jan Kaluza <jkaluza@redhat.com> - 5.14-14Jan Kaluza <jkaluza@redhat.com> - 5.14-13Jan Kaluza <jkaluza@redhat.com> - 5.14-12Ville Skyttä <ville.skytta@iki.fi> - 5.14-11Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.14-10Jan Kaluza <jkaluza@redhat.com> - 5.14-9Jan Kaluza <jkaluza@redhat.com> - 5.14-8Jan Kaluza <jkaluza@redhat.com> - 5.14-7Jan Kaluza <jkaluza@redhat.com> - 5.14-6Jan Kaluza <jkaluza@redhat.com> - 5.14-5Jan Kaluza <jkaluza@redhat.com> - 5.14-4Jan Kaluza <jkaluza@redhat.com> - 5.14-3Jan Kaluza <jkaluza@redhat.com> - 5.14-2Jan Kaluza <jkaluza@redhat.com> - 5.14-1Jan Kaluza <jkaluza@redhat.com> - 5.11-9Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.11-8Jan Kaluza <jkaluza@redhat.com> - 5.11-7Jan Kaluza <jkaluza@redhat.com> - 5.11-6Jan Kaluza <jkaluza@redhat.com> - 5.11-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.11-4Jan Kaluza <jkaluza@redhat.com> - 5.11-3Jan Kaluza <jkaluza@redhat.com> - 5.11-2Jan Kaluza <jkaluza@redhat.com> - 5.11-1Jan Kaluza <jkaluza@redhat.com> - 5.10-5Jan Kaluza <jkaluza@redhat.com> - 5.10-4Jan Kaluza <jkaluza@redhat.com> - 5.10-3Jan Kaluza <jkaluza@redhat.com> - 5.10-2Jan Kalu�x�������������?�������Xxm������8W�������m�$P�����������������m�D�-�ne <nicolas.rochelemagne@cpanel.net> - 82.0-1.cp1182Todd Rinaldo <toddr@cpanel.net> - 80.0-1.cp1180Todd Rinaldo <toddr@cpanel.net> - 78.0-1.cp1178brian m. carlson <brian.carlson@cpanel.net> - 74.0-1.cp1174- Update geoipfree database using 20260320 database- Update geoipfree database using 20251209 database- Update geoipfree database using 20250909 database- Update geoipfree database using 20250722 database.- Add AlmaLinux 10 & Ubuntu 24 support.- Update geoipfree database using 20250307 database.- Update geoipfree database using 20241210 database.- Update geoipfree database using 20241210 database.- Update geoipfree database using 20240910 database.- Update geoipfree database using 20240614 database.- Update geoipfree database using 20240614 database.- Update geoipfree database using 20240312 database.- Update geoipfree database using 20231205 database.- Update geoipfree database using 20230908 database.- Update geoipfree database using 20230609 database.- Update geoipfree database using 20230310 database.- Rebuild blocked countries IPs after updating.- Update geoipfree database using 20221206 database.- Update geoipfree database using 20220909 database.- Update geoipfree database using 20220705 database.
- Rebuild with RedHat 9 and Ubuntu 22 support and Perl 536.- Update geoipfree database using 20220607 database- Update geoipfree database for 106- Update geoipfree database for 104- Update geoipfree database for 102- Update geoipfree database for 100- Rebuild with Ubuntu support- Refresh geoipfree database- Update geoipfree database for 96- Update geoipfree database for 94- Patched database to include private IP ranges- Update geoipfree database for 92- Update geoipfree database for 90- Update geoipfree database for 88- Re-build against C8 with perl 5.30- Update ipfree for 84- Add country-cidrs- Update ipfree for 84- Update ipfree for 82- Update ipfree for 80- Update ipfree for 78- Convert to an RPM./bin/sh	

�x��������������.�������Xy�l�-�������D������X��$H����������������X�W�Y��55a75a25ac81fc5f9c1de4a7852da3986135059d72f23b2e82a6c77e791a4a6ac73d7f694f01b545049e32de51f47d7ca799333ebb9c8440cfe63c87139aaa9e1f9ec694f97517ffa5fd5797b340b44177bd5f04b97defb7bbb6d92daa2dfa3352b79ff1481432e61865d3723d4c5234c83253019bb489d919aef956cbc65a457c5082fc10196208f22d54dacac1df24c29af7bc8848cd8d285594d45a072396afc0a069f64d80521dc403129b48bd1374af664c000326038a55ec9fbc6789d3b150454f7f142d4f70a903129b48bd1374af664c000326038a55ec9fbc6789d3b150454f7f142d4f70a9d59c5383278cb6bc0d935d720666eb2ad32893c311b0050d3b0757c441d7ea562ec9ed40f66d3aa0a06826091392da164aae42c7c588714b9cff9818496ecc8746f08f8b308d1910856666d48b055a0fe71c8f555e43184902377735ef6e718aeffd78a7ce9cbda0e05ee73ba2acc2808b9879570cb6615702c1c8273a3e5e1bfc15cdf1c876b8deba5f33b5c8b3c8d346eac2f3e7c844691df2c1865e983060996ba1a4be2c8a4d3cb462bcdfd9681a80d224b48d8bb08e77ac3e6fd6489ee1684ebf696a2387a34cd1f5a32f2d4f729cf9f17c06e71e515559089cb09ddda93aec2a0e8944c55568e87609b6c1d01d70fc9a299c243ea575f6717a7a118b31bc0a5c580b900e2451717d8d54514d2239d23da0970960e01cfd304a5d80e0b7fb838a3c7eea1f7117a2c932039143b8b968587156cec670bbc54755af0390412e2efd9a17712a44319bd864c829870fba1092fd9ef38b9d851e342b1d7c71eb442c56b9eddcf95e78dd73a278c11d11b531103f07a9448b28e56f60fefe507a53518bb18d056de58a5315b1f84e683ddb5d978d9cd7eafa1354e6c8bfdeddd5831bf4623b576d2fda32e929fa3ed65a18848711c4dc79cae966a67cf2bf12a9d8cc2d7afd3b23f0940431bb8c274440adb71e67067bb4f278df47ea3e95d71f2d8bdc77204a38bcd6ea31764cf9aef77a40da140d54852b5fb9ac758084a98fdabc92230e44ed386ec45693687c4db0f36bf52b05357ce55704994a1789a4e7dabc92230e44ed386ec45693687c4db0f36bf52b05357ce55704994a1789a4e7f3283cf99c31c386bf5c2c20e62fb332cb2cfeae14a43b0b052f02897724d458f3283cf99c31c386bf5c2c20e62fb332cb2cfeae14a43b0b052f02897724d458569db52d8808c02d2b7f90f70cd50856984c496685ead49f5a31b31a7c310f2e710b7be340f58f84af86d30d60b5cc64357d3ebfe7dc77b62cd2d7ca0e6af82b02fe5c05d33a3a753f4ab36992848944a2be92d5cabf4b7b40c029f4d95878ff2ebd022fd559d18d9ce4234bd39cec050154fc990db2fc3d2d6a5964133abf5de70d884baf15224132a29a7f9c883af550caca5795edf86c9b99710114650880b736f6eadb5a123c0e4fd2f08663905abd82cb6f06ce7bfc73eba70cd1bc0799752a621555f71eba680dead72e66cc20b34a6dae0b80c95b49d676c484a6e1eacc128a2671dcffdfb6c6c48891a1b5138df65c2467bb1f162450a618f242b577276f5d60567dd1394c9c7dd934f52d38678374e2df113947348f2fc4969781d899b723022bbc611c105e4192d1e09b13340574c07c42e682703e9d685855549a6cd893c6f7759d73a700970f12471e0f89abae3c77b3f2ae35d09d2ac062885412e5808f7c3185fb1bb7b23d61eba294fbf6e50d1da187c51f27d70093815dfdcae46cf5746b2a04b4ccf3dde27bf4a96973743d98e87b88dce12bbc230e5b3ccae46cf5746b2a04b4ccf3dde27bf4a96973743d98e87b88dce12bbc230e5b3c5761bd66e05389a90f645ad302cf25c859b303afcc5669f097c982d6e6f4c27d5761bd66e05389a90f645ad302cf25c859b303afcc5669f097c982d6e6f4c27d05c90840fb70ab7526298b7aa803ddcbb9c5e94d38c3b4dd1602d44b74f287e405c90840fb70ab7526298b7aa803ddcbb9c5e94d38c3b4dd1602d44b74f287e4c3edaaffec093ae7e3d77e1572aa54f47643af3b1038af47fae03f678ca15802c3edaaffec093ae7e3d77e1572aa54f47643af3b1038af47fae03f678ca15802964ac5ed645a219d4cfafa0356e7ff3435f54a46e5ef20ba8bdb098b72f7a500964ac5ed645a219d4cfafa0356e7ff3435f54a46e5ef20ba8bdb098b72f7a50026228b3ffc3879bd7bf5dca4a705f0e46a4f5a496a3edfcf66c49ea0bf8ed4bd6c3d96dc347791af5c3725c722823ae5fc15b27899e6670ec156d43472f3941bf026e191a487ec9040dfc38bdc4bd6fb8acabb984897e948b805814e878fd078093104f907145f4a8beeabff3320beb73fc4e3141a452e66b6a671efacb9730533a137f4ee582352e9d5e49e066398bc295f11fdf223f92d75f81ab38c63b646e38e8340f97a4e1d5d7a9b9dab20645609dff1ffc342ae79fe9c644e7a45ace8c9db675229698f8c0191cca4628e51da4b1ec01e58923200803c0bd65c7406c68258c37e12ba5202bb4d9d7ca388c926894dc24219bb4a79e7d349853aa6714f91bab5efe5d9f33900cad7e4849d211719b2e0608e55fe1b18f4bdfd6a144f145df8e5d213f6f0cffea0ff1ad891558ce7255e670c8b7b8ae34b1be6c9660b6daca948bb2d589edee3dc1f913fafd2a6849132399d1d29c0685eb904080e2560bf8e65921f630a981929278bb798bad6646f5c0df4800170beaf857fff7343d1bf8e65921f630a981929278bb798bad6646f5c0df4800170beaf857fff7343d14815481d3f0�x��������������������Xz.mD�K!��$1����������������!�B�"��inux.2Darya Malyavkina <dmalyavkina@cloudlinux.com> - 5.6.40-15.cloudlinux.1Tim Mullin <tim@cpanel.net> - 5.6.40-15Darya Malyavkina <dmalyavkina@cloudlinux.com> - 5.6.40-14.cloudlinux.3Nikolai Mikhno <nmikhno@cloudlinux.com> - 5.6.40-14.cloudlinux.2Nikolai Mikhno <nmikhno@cloudlinix.com> - 5.6.40-14.cloudlinux.1.1Nikolai Mikhno <nmikhno@cloudlinux.com> - 5.6.40-14.cloudlinux.1Tim Mullin <tim@cpanel.net> - 5.6.40-14Ivan Danilov <idanilov@cloudlinux.com> - 5.6.40-11.cloudlinux.4Ivan Danilov <idanilov@cloudlinux.com> - 5.6.40-11.cloudlinux.3Daniel Muey <dan@cpanel.net> - 5.6.40-13Julian Brown <julian.brown@cpanel.net> - 5.6.40-12Darya Malyavkina <dmalyavkina@cloudlinux.com> - 5.6.40-11.cloudlinux.2Ivan Danilov <idanilov@cloudlinux.com> - 5.6.40-11.cloudlinux.1Tim Mullin <tim@cpanel.net> - 5.6.40-11Ivan Danilov <idanilov@cloudlinux.com> - 5.6.40-9.cloudlinux.3Daniel Muey <dan@cpanel.net> - 5.6.40-10Ivan Danilov <idanilov@cloudlinux.com> - 5.6.40-9.cloudlinux.1Darya Malyavkina <dmalyavkina@cloudlinux.com> - 5.6.40-9.cloudlinux.2Tim Mullin <tim@cpanel.net> - 5.6.40-9Darya Malyavkina <dmalyavkina@cloudlinux.com> - 5.6.40-8.cloudlinux.3Ivan Danilov <idanilov@cloudlinux.com> - 5.6.40-8.cloudlinux.2Ivan Danilov <idanilov@cloudlinux.com> - 5.6.40-8.cloudlinux.1Cory McIntire <cory@cpanel.net> - 5.6.40-8Cory McIntire <cory@cpanel.net> - 5.6.40-7Darya Malyavkina <dmalyavkina@cloudlinux.com> - 5.6.40-6.cloudlinux.1Tim Mullin <tim@cpanel.net> - 5.6.40-6Ivan Danilov <idanilov@cloudlinux.com> - 5.6.40-5.cloudlinux.2Ivan Danilov <idanilov@cloudlinux.com> - 5.6.40-5.cloudlinux.1Daniel Muey <dan@cpanel.net> - 5.6.40-5Tim Mullin <tim@cpanel.net> - 5.6.40-4Tim Mullin <tim@cpanel.net> - 5.6.40-3Darya Malyavkina <dmalyavkina@cloudlinux.com> - 5.6.40-2.cloudlinux.4Ivan Danilov <idanilov@cloudlinux.com> - 5.6.40-2.cloudlinux.3Ivan Danilov <idanilov@cloudlinux.com> - 5.6.40-2.cloudlinux.2Darya Malyavkina <dmalyavkina@cloudlinux.com> - 5.6.40-2.cloudlinux.1Cory McIntire <cory@cpanel.net> - 5.6.40-2Darya Malyavkina <dmalyavkina@cloudlinux.com> - 5.6.40-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 5.6.40-1Cory McIntire <cory@cpanel.net> - 5.6.39-1Darya Malyavkina <dmalyavkina@cloudlinux.com> - 5.6.38-2.cloudlinux.2Ivan Danilov <idanilov@cloudlinux.com> - 5.6.38-2.cloudlinux.1Tim Mullin <tim@cpanel.net> - 5.6.38-2Cory McIntire <cory@cpanel.net> - 5.6.38-1Sergey Fokin <sfokin@cloudlinux.com> - 5.6.37-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 5.6.37-1Tim Mullin <tim@cpanel.net> - 5.6.36-3Vasiliy Kleschov <vkleschov@cloudlinux.com> - 5.6.36-2.cloudlinux.2Vasiliy Kleschov <vkleschov@cloudlinux.com> - 5.6.36-2.cloudlinux.1Vasiliy Kleschov <vkleschov@cloudlinux.com> - 5.6.36-1.cloudlinux.2Rishwanth Yeddula <rish@cpanel.net> - 5.6.36-2Ivan Danilov <idanilov@cloudlinux.com> - 5.6.36-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 5.6.36-1Ivan Danilov <idanilov@cloudlinux.com> - 5.6.35-3.cloudlinuxRishwanth Yeddula <rish@cpanel.net> - 5.6.35-3Rishwanth Yeddula <rish@cpanel.net> - 5.6.35-2Ivan Danilov <idanilov@cloudlinux.com> - 5.6.35-1.cloudlinux.1Daniel Muey <dan@cpanel.net> - 5.6.35-1Ivan Danilov <idanilov@cloudlinux.com> - 5.6.34-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 5.6.34-3Daniel Muey <dan@cpanel.net> - 5.6.34-2Daniel Muey <dan@cpanel.net> - 5.6.34-1<dan@cpanel.net> - 5.6.33-6<darren@cpanel.net> - 5.6.33-5Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.6.33-4.cloudlinux.1<darren@cpanel.net> - 5.6.33-4Cory McIntire <cory@cpanel.net> - 5.6.33-3<julian.brown@cpanel.net> - 5.6.33-2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.6.33-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 5.6.33-1<dan@cpanel.net> - 5.6.32-3<dan@cpanel.net> - 5.6.32-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.32-1<cory@cpanel.net> - 5.6.31-6Tim Mullin <tim@cpanel.net> - 5.6.31-5Dan Muey <dan@cpanel.net> - 5.6.31-4Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.6.31-3.cloudlinux.1Dan Muey <dan@cpanel.net> - 5.6.31-3Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5�x�������������8
�������X�AlH�������@�	#������$3����������������#�$�"��.patch [bz#2072049]
- kvm-QIOChannelSocket-Introduce-assert-and-reduce-ifdefs-.patch [bz#2072049]
- kvm-QIOChannelSocket-Fix-zero-copy-send-so-socket-flush-.patch [bz#2072049]
- kvm-migration-Change-zero_copy_send-from-migration-param.patch [bz#2072049]
- kvm-migration-Add-migration_incoming_transport_cleanup.patch [bz#2097652]
- kvm-migration-Allow-migrate-recover-to-run-multiple-time.patch [bz#2097652]
- kvm-pc-bios-s390-ccw-virtio-Introduce-a-macro-for-the-DA.patch [bz#2098076]
- kvm-pc-bios-s390-ccw-bootmap-Improve-the-guessing-logic-.patch [bz#2098076]
- kvm-pc-bios-s390-ccw-virtio-blkdev-Simplify-fix-virtio_i.patch [bz#2098076]
- kvm-pc-bios-s390-ccw-virtio-blkdev-Remove-virtio_assume_.patch [bz#2098076]
- kvm-pc-bios-s390-ccw-virtio-Set-missing-status-bits-whil.patch [bz#2098076]
- kvm-pc-bios-s390-ccw-virtio-Read-device-config-after-fea.patch [bz#2098076]
- kvm-pc-bios-s390-ccw-virtio-Beautify-the-code-for-readin.patch [bz#2098076]
- kvm-pc-bios-s390-ccw-Split-virtio-scsi-code-from-virtio_.patch [bz#2098076]
- kvm-pc-bios-s390-ccw-virtio-blkdev-Request-the-right-fea.patch [bz#2098076]
- Resolves: bz#2072049
  (Pull  MSG_ZEROCOPY on QEMU Live Migration Patches into RHEL 8)
- Resolves: bz#2097652
  (The migration port is not released if use it again for recovering postcopy migration)
- Resolves: bz#2098076
  (virtio-blk: Can't boot fresh installation from used virtio-blk dasd disk under certain conditions)- kvm-virtiofsd-Fix-breakage-due-to-fuse_init_in-size-chan.patch [bz#2097209]
- kvm-hw-block-fdc-Prevent-end-of-track-overrun-CVE-2021-3.patch [bz#1951521]
- kvm-tests-qtest-fdc-test-Add-a-regression-test-for-CVE-2.patch [bz#1951521]
- Resolves: bz#2097209
  ([virtiofs] mount virtiofs failed: SELinux: (dev virtiofs, type virtiofs) getxattr errno 111)
- Resolves: bz#1951521
  (CVE-2021-3507 virt:rhel/qemu-kvm: QEMU: fdc: heap buffer overflow in DMA read data transfers [rhel-8])- kvm-virtio-gpu-do-not-byteswap-padding.patch [bz#1916415]
- kvm-linux-headers-update-to-5.16-rc1.patch [bz#1916415]
- kvm-linux-headers-Update-headers-to-v5.17-rc1.patch [bz#1916415]
- kvm-linux-headers-include-missing-changes-from-5.17.patch [bz#1916415]
- kvm-x86-Fix-the-64-byte-boundary-enumeration-for-extende.patch [bz#1916415]
- kvm-x86-Add-AMX-XTILECFG-and-XTILEDATA-components.patch [bz#1916415]
- kvm-x86-Grant-AMX-permission-for-guest.patch [bz#1916415]
- kvm-x86-Add-XFD-faulting-bit-for-state-components.patch [bz#1916415]
- kvm-x86-Add-AMX-CPUIDs-enumeration.patch [bz#1916415]
- kvm-x86-add-support-for-KVM_CAP_XSAVE2-and-AMX-state-mig.patch [bz#1916415]
- kvm-x86-Support-XFD-and-AMX-xsave-data-migration.patch [bz#1916415]
- kvm-target-i386-kvm-do-not-access-uninitialized-variable.patch [bz#1916415]
- kvm-KVM-x86-workaround-invalid-CPUID-0xD-9-info-on-some-.patch [bz#1916415]
- kvm-virtio-net-setup-vhost_dev-and-notifiers-for-cvq-onl.patch [bz#2069946]
- kvm-virtio-net-align-ctrl_vq-index-for-non-mq-guest-for-.patch [bz#2069946]
- kvm-vhost-vdpa-fix-improper-cleanup-in-net_init_vhost_vd.patch [bz#2069946]
- kvm-vhost-net-fix-improper-cleanup-in-vhost_net_start.patch [bz#2069946]
- kvm-vhost-vdpa-backend-feature-should-set-only-once.patch [bz#2069946]
- kvm-vhost-vdpa-change-name-and-polarity-for-vhost_vdpa_o.patch [bz#2069946]
- kvm-virtio-net-don-t-handle-mq-request-in-userspace-hand.patch [bz#2069946]
- kvm-ide-Increment-BB-in-flight-counter-for-TRIM-BH.patch [bz#2029980]
- kvm-block-Make-bdrv_refresh_limits-non-recursive.patch [bz#2072932]
- kvm-iotests-Allow-using-QMP-with-the-QSD.patch [bz#2072932]
- kvm-iotests-graph-changes-while-io-New-test.patch [bz#2072932]
- Resolves: bz#1916415
  ([Intel 8.7 FEAT] qemu-kvm Sapphire Rapids (SPR) AMX Instructions)
- Resolves: bz#2069946
  (PXE boot crash qemu when using multiqueue vDPA)
- Resolves: bz#2029980
  (Failed assertion in IDE emulation with Ceph backend)
- Resolves: bz#2072932
  (Qemu coredump when refreshing block limits on an actively used iothread block device [rhel.8.7])- kvm-Revert-redhat-Add-some-devices-for-exporting-upstrea.patch [bz#2065043]
-�x�������������������X|l���[���$�����������������������db7868bd0fc84fccbc9effd76f5f637c06db5c77cf14e148f008c51770d4d3a51d456a4e8746681eb6192711ffdf78652a14130d4dd8ccc44fa8187ca974c0608274c58e9b8b956efea0624c1c8a5d1b18d499866792949055b0a6459aacdfc3da30c180fe983c51ebadc569c6fddaf476485a11367ea972efc9bfea16969a91e095f1fb7736909779fba101aa4963a2fd17c03185694f5c656229b3c2f2165bf4b817df04e0507795f68b5f22a8ca792bab045ebde9b73e2ad8604e6afc42fbb487790b08cba40183eb7f7cfa0b43e0e8fee87c684060d79e66dbb7824a3b8db1d83dde9c7cce1da8b8dca1fa8e46bae9f90438f0adada56fadfc08db0325547ca5b0001de029501de7b622892fa1256ab9a12266f3633dffbbdf04919d46bfd6fce88970b8284f535687d86f380f7b49b156f5db5d8b295c458b2659dc3e1786f074440eee277727de98be14c1d33a82268d2fbbb357a818c3d91f863aa5c26d9027d60abb3b3a15b20e85bbd3af89fe0008b2ccd9296e6a1b00a9da9069b265c233ff2ebac9afc9f2f31831c8e31eaed4e76b7817deb05732c5efd022d1b943f0cd2cb8ad193cefe938c7fc347946c9ccd5c49921f2f0226f4ba144c578b63b2fea18b79bbc308f237282e7f21b3a39c31c7ebd1487d97f595f031c809b362b0a60521e7eb41774156df72a16d2e90350212131da31aa6ecb7b2d9bfa3c29459ef120ec3ff39a4e337ab130efe875aab10bebef45ba7afcddc731342626c3e46da6506a3b902ab60c4c26d6aad5ce333698539e50f06df7ed1d14dcd15caabf7ff9328b80b0eb57da5e3cfefec15e2af3dbbc46a95ddd11f39489c7431fdac388c921afa52000e1d3f73826074845e2d1b712501e302f02a48b1e979eee86cbfcdc395706ae3ac7b68e9512fc5aca2ac00190fc778b84211bb8bee305d95281c664de14bc8b268b1a2170cc7519c1667bb1fe21e0aa4520487b58a877c4cde814f489a2160078b99f61335e5516b9a0b3270be02e5d3a1f86819debe727c303d3d6ce10a7bcc44a65873a04077dc89d5c2cff69e8325899f16069adb8ddf9c03886834076f5e3f3282067da61339f4e9ac9be237112c1e8c29d38bc91a656616ea9586ef1fcdb3328a1ae1b8f4777a99b352943d304fd10375062f371489f778c10c2e9fafa92cf8647dc611ebcd307ab4d7acbe08a52968507cb4eaa1bdaf918ed44ae9cd1d0c19825765611d27d7c725863c13ecd7a4030b7764ebd7f7aebffd042f68f87fadb28f4b3327353ee0a1ccf327e8a3c1539ef9341b354137884a41f6a9f96ff3dcf9cd8e0ff63e7ca117795e88ede20ffaaaa1a67488708abb9d187ca2084c689078b71928e886a1ac17bad6e8c223f12bef3d5dda801029c40146a8a312d9ecfcc4f709f4315c72a4b0e00ba87ed61557633ff868512e575d4637a6dacc730de6e60f9bcd2842b75d0d1db94cc6a2f3be32ceeffffc2faf47a7550edd5eebf2a2313667a7152e9c35978037b344715e3d0742dc81402d1fcf59922fc341d34bee30c3aec7b998155d0cd762ce2b9881ebc19cddee3a98890dee0fc91feceda46ef6a5abca350630f1b906a19aee512151df51930c0f76939769441a10ba4dc18a09f4e48d49542856c7ee7ae859f0bbc8fc4bcb25d3bb172acbd8741ec8299e73f95fc4416947f43b7408ba1dc173aad059eb6cf8b22fb9c799651366ed9f3fa72efa5d9590e0e1513341890b4ba91aff3cd2296c5a00287da6f9e9e459edb7f6c6c2ecbb8dfc4378ccf55f2d8c3bf4510bd9f4002509772f5db4636b441c50aed5e6d6edce950a9b2a6eede55af780d014ecbb9fbfd1f7a98b256dc4ecd299c928186c143b74b678cb920b51ad8b3f77a22f57098de09777261aad85a56635c192c089a1813aa25e9c8e995cff7354aba5f56d2c15526b34cae6903afb38b947b04bdae097bf21e9fa02206300ab844984faf0532184b5b7425a4ed9cae99d02ca35e9efdd339e1e3ef07aed75f9b2036998eb387fcca2ecbe0e0d40c7f947e979f77ba23a5fae29003de98bbe18757bb3fe8eeb7ff0068b23437646ffbbc6714eabf6e87fba4a28758e1f34b726f65d5b7adcf1dab1434c962903acdb449a58595c6eec2c6d77d7f3eb88ead4d6d5679e86b405a3d206e58c3c51f638a2427e5d93ce4c23bee5a7ec6ad4979fee6f093243766292abd6bb5739cd9d2dd7d88fc503c1bc12799b0c42f3cdfaf0acfb4b531d86dd81106b72f7bd0ca23b8aff06532e3264743e9deeebdf76b568c9ab8058e893da96ab6209f3079dfc4c2950f1be29388894962854f90478f44b4616fee3d5485d76189b127d875b53cc0f46f88f08f455c9177fe13b538d23dfa7f2cf5f7359b2cb85fe84fa5a9343b77af327d6a1a0a8a6e58bd8cb60cfafb1a972fd9d47d6ec0d0ae63e37a46d7761f69e3a08ab801fdb9e504a600bd3e0cd287fc33449a5f317add27487cf4df574f2713ad0a6f96bd2042394c788f8ac29d2bf8110b5e3fef67990493cdba15a7e52db6143f0d00fd478908cab051f25218ab685ff20a26ff981af144867891caa5c5ac5711be7616c23c0a3095f09a663abea64783e61d70cffb48ade66ac886cf4216d99470f1324aa2db1fad5bfdad1e8d94b71808b506847abe8a08d99c4dcda0bc703c0a894d4c8ab74d45533dd037adbe281a28a40c43aadbb29c9186fbeb65f6a679b152983ed25a5bce84c78ecb814982877328b841d49a8df3f2f1664573b4205128f295e8e085801703ba230783990c09b58b12796fb05e4e0d28ba4cf5082dfb0698fda0a2406�x�������������h������X}�lx������������p��$`����������������p�o�q��ibed after @ sign works (RhBug:1156084) (Jan Silhan)
- own /etc/dnf/protected.d (RhBug:1175098) (Jan Silhan)
- i18n: computing width of char right (RhBug:1174136) (Jan Silhan)
- cosmetic: renamed _splitArg -> _split_arg (Jan Silhan)
- conf: removed include name conflict (RhBug:1055910) (Jan Silhan)
- output: removed unpredictable decision based on probability introduced in ab4d2c5 (Jan Silhan)
- output: history list is not limited to 20 records (RhBug:1155918) (Jan Silhan)
- doc: referenced forgotten bug fix to release notes (Jan Silhan)
- cosmetic: doc: removed duplicated word (Jan Silhan)
- doc: described unavailable package corner case with skip_if_unavailable option (RhBug:1119030) (Jan Silhan)
- log: replaced size with maxsize directive (RhBug:1177394) (Jan Silhan)
- spec: fixed %ghost log file names (Jan Silhan)- logging: reverted naming from a6dde81- transifex update (Jan Silhan)
- bash-completion: don't query if we trying to use local file (RhBug:1153543) (Igor Gnatenko)
- bash-completion: fix local completion (RhBug:1151231) (Igor Gnatenko)
- bash-completion: use sqlite cache from dnf-plugins-core (Igor Gnatenko)
- base: output a whole list of installed packages with glob pattern (RhBug:1163063) (Michal Luscon)
- cli: _process_demands() does not respect --caheonly (RhBug:1151854) (Michal Luscon)
- new authors added (Jan Silhan)
- install: allow installation of provides with glob (Related:RhBug:1148353) (Michal Luscon)
- tests: removed mock patch for _, P_ (Jan Silhan)
- fixed error summary traceback (RhBug:1151740) (Jan Silhan)
- doc: swap command alternative mentioned (RhBug:1110780) (Jan Silhan)
- base: package_reinstall works only with the same package versions (Jan Silhan)
- base: package_install allows install different arch of installed package (Jan Silhan)
- base: package_downgrade prints message on failure (Jan Silhan)
- base: package_upgrade does not reinstall or downgrade (RhBug:1149972) (Jan Silhan)
- groups: searches also within localized names (RhBug:1150474) (Jan Silhan)
- Run tests with C locales. (Daniel Mach)
- Adds new motd emitter for dnf-automatic (RhBug:995537) (Kushal Das)
- Fix wrong cache directory path used to clean up binary cache (Satoshi Matsumoto)
- fix: traceback in history info <name> (RhBug: 1149952) (Tim Lauridsen)
- logging: added logrotate script for hawkey.log (RhBug:1149350) (Jan Silhan)
- output: renamed displayPkgsInGroups (Jan Silhan)
- logging: renamed log files (RhBug:1074715)" (Jan Silhan)
- comps: Environment differentiates optional and mandatory groups (Jan Silhan)
- group info handles environments (RhBug:1147523) (Jan Silhan)
- deltarpm enabled by default (RhBug:1148208) (Jan Silhan)
- doc: deplist command (Jan Silhan)
- doc: minor fixes + repo references changed (Jan Silhan)
- spec: requires rpm-plugin-systemd-inhibit (RhBug:1109927) (Jan Silhan)- transifex update (Jan Silhan)
- refactor: move MakeCacheCommand out into its own file. (Ales Kozumplik)
- api: add dnf.cli.CliError. (Ales Kozumplik)
- Update user_faq.rst (Stef Krie)
- Make --refresh play nice with lazy commands. (Ales Kozumplik)
- bash-completion: more faster completing install/remove (Igor Gnatenko)
- bash-completion: complete 'clean|groups|repolist' using help (Igor Gnatenko)
- Allow some commands to use stale metadata. (RhBug:909856) (Ales Kozumplik)
- does not install new pkgs when updating from local pkgs (RhBug:1134893) (Jan Silhan)
- doesn't upgrade packages by installing local packages (Related:RhBug:1138700) (Jan Silhan)
- refactor: repo: separate concepts of 'expiry' and 'sync strategy'. (Ales Kozumplik)
- fix: dnf.cli.util.* leaks file handles. (Ales Kozumplik)
- remove: YumRPMTransError. (Ales Kozumplik)
- rename: Base's runTransaction -> _run_transaction(). (Ales Kozumplik)
- drop unused parameter of Base.verify_transaction(). (Ales Kozumplik)
- bash-completion: new completion from scratch (RhBug:1070902) (Igor Gnatenko)
- py3: add queue.Queue to pycomp. (Ales Kozumplik)
- locking: store lockfiles with the resource they are locking. (RhBug:1124316) (Ales Kozumpli�x���������������������X~5mp������������(��$8����������������(�'�)��per)
- Fix bug #77677: WCOREDUMP not available on all systems
- Fixed bug #77697 (Crash on Big_Endian platform)
- Fix #77700: Writing truecolor images as GIF ignores interlace flag
- Fixed bug #77722
- Fixed bug #77742
- Fixed bug #77765
- Fix #77767: phpdbg break command help message shows incorrect aliases
- Fix #77921: static.php.net doesn't work anymore
- Fix bug #77934 (php-fpm kill -USR2 not working)
- Fix #77943: imageantialias($image, false); does not work
- Fix #77944: Wrong meta pdo_type for bigint on LLP64
- Fixed bug #77945- ZC-5036: Add find-latest-version (assumes PHP is checked out next ro ea-tools)- EA-8342: Update litespeed to new upstream update of 7.3- EA-8342: Update litespeed to 7.3- Apply graceful_stop patch to ea-php- Fix bug #51068 (glob:// do not support current path relative)
- Fix bug #77390 (feof might hang on TLS streams in case of fragmented TLS records)
- Fix bug #77396 - Null Pointer Dereference in phar_create_or_parse_filename
- Fix #77431 SplFileInfo::__construct() accepts NUL bytes
- Fixed bug #77494 (Disabling class causes segfault on member access)
- Fix bug #77540 - Invalid Read on exif_process_SOFn
- Fix #77546 iptcembed broken function
- Fix bug #77563 - Uninitialized read in exif_process_IFD_in_MAKERNOTE
- Fix bug #77586 - phar_tar_writeheaders_int() buffer overflow
- Fix bug #77630 - safer rename() procedure
- LSAPI sem_timedwait synchronization fixed- ALTPHP-698: Add patch with the ability change url in Wordpress to Hardened php- MODLS-627: Fix php_value priority issue
- MODLS-626: Update LiteSpeed patches for V 7.2- EA-8170: Update litespeed to latest version (7.2)- EA4D-129: Apply mod_lsapi_mode patch- Updated to version 5.6.40 via update_pkg.pl (EA-8158)- Updated to version 5.6.39 via update_pkg.pl (EA-8056)- EA4D-116: Update SIGTERM cleanup patch- Ported multiple fixes from upstream versions- EA-7957: Added ea-apache24-mod_proxy_fcgi as a dependency of php-fpm.- Updated to version 5.6.38 via update_pkg.pl (EA-7842)- MODLS-545: KeepListener behavior disabled to prevent lsphp DoS- Updated to version 5.6.37 via update_pkg.pl (EA-7732)- Fixed php-fpm installing directories it does not own (EA-7526)- ALTPHP-539: Improved Litespeed SIGTERM cleanup handling patch- ALTPHP-526: Updated patch for Litespeed SIGTERM cleanup handling- ALTPHP-511: added patches to avoid creating zombies when using lsphp- EA-7359: Ensure ea-libxml2 is listed as a requirement for the php-xml package.- EA4D-65: Added patch for LiteSpeed SIGTERM cleanup- Updated to version 5.6.36 via update_pkg.pl (EA-7435)- EA4D-53: Update LSAPI to 7.1
- ALTPHP-491: add use_reject to LSPHP- ZC-3602: Update litespeed to the latest version (7.1).- EA-7382: Update dependency on ea-openssl to require the latest version with versioned symbols.- Duplications in cli and litespeed were removed- EA-7355: Update to v5.6.35, drop v5.6.34- EA4D-50: Change ea-openssl directory to /opt/cpanel/ea-openssl* Mon Mar 20 2018 Cory McIntire <cory@cpanel.net> - 5.6.34-3
- ZC-3552: Added versioning to ea-openssl and ea-libcurl requirements.- ZC-3475: Update for ea-openssl shared object- Updated to version 5.6.34 via update_pkg.pl (EA-7268)- EA-6990: Fix opcache.blacklist_filename value- HB-3287: Increase open file limit for php-fpm by default- Filter libxml2.so from requires- HB-3263: Ensure securetmp is done before starting FPM- EA-7044: Adjust PHPs to use ea-libxml2- HB-3061: Fix epoll bug.- ALTPHP-424: Add timestamps to LSPHP log messages- Updated to version 5.6.33 via update_pkg.pl (EA-7082)- EA-7008: init openssl for FTP like 7.x does- EA-6812: build PHP against ea-openssl like Apache- Updated to version 5.6.32 via update_pkg.pl (EA-6931)- EA-4653: Update mail header patch for PHP 5.6- HB-2873: Added network-online.target to "After" in the service file- EA-6819: Patch to support libtidy 5.4.0- ALTPHP-380: added user.ini lookup in home dir
- ALTPHP-380: changed CRIU messaging- EA-4197: make php.ini directives consistent w/ other versions- ALTPHP-364: Added сorrect exi�x�������������X�������XTl���������������$���������������������tions-during-polling.patch [bz#1789301]
- kvm-usbredir-Prevent-recursion-in-usbredir_write.patch [bz#1790844]
- kvm-xhci-recheck-slot-status.patch [bz#1790844]
- Resolves: bz#1733893
  (Boot a guest with "-prom-env 'auto-boot?=false'", SLOF failed to enter the boot entry after input "boot" followed by "0 > " on VNC)
- Resolves: bz#1782678
  (qemu core dump after hot-unplugging the   XXV710/XL710 PF)
- Resolves: bz#1789301
  (virtio-blk/scsi: fix notification suppression during AioContext polling)
- Resolves: bz#1790844
  (USB related fixes)- kvm-i386-Remove-cpu64-rhel6-CPU-model.patch [bz#1741345]
- kvm-Reallocate-dirty_bmap-when-we-change-a-slot.patch [bz#1772774]
- Resolves: bz#1741345
  (Remove the "cpu64-rhel6" CPU from qemu-kvm)
- Resolves: bz#1772774
  (qemu-kvm core dump during migration+reboot ( Assertion `mem->dirty_bmap' failed ))- Rebase to qemu-4.2
- Resolves: bz#1783250
  (rebase qemu-kvm to 4.2)- kvm-LUKS-support-preallocation.patch [bz#1534951]
- kvm-nbd-add-empty-.bdrv_reopen_prepare.patch [bz#1718727]
- kvm-qdev-qbus-add-hidden-device-support.patch [bz#1757796]
- kvm-pci-add-option-for-net-failover.patch [bz#1757796]
- kvm-pci-mark-devices-partially-unplugged.patch [bz#1757796]
- kvm-pci-mark-device-having-guest-unplug-request-pending.patch [bz#1757796]
- kvm-qapi-add-unplug-primary-event.patch [bz#1757796]
- kvm-qapi-add-failover-negotiated-event.patch [bz#1757796]
- kvm-migration-allow-unplug-during-migration-for-failover.patch [bz#1757796]
- kvm-migration-add-new-migration-state-wait-unplug.patch [bz#1757796]
- kvm-libqos-tolerate-wait-unplug-migration-state.patch [bz#1757796]
- kvm-net-virtio-add-failover-support.patch [bz#1757796]
- kvm-vfio-unplug-failover-primary-device-before-migration.patch [bz#1757796]
- kvm-net-virtio-fix-dev_unplug_pending.patch [bz#1757796]
- kvm-net-virtio-return-early-when-failover-primary-alread.patch [bz#1757796]
- kvm-net-virtio-fix-re-plugging-of-primary-device.patch [bz#1757796]
- kvm-net-virtio-return-error-when-device_opts-arg-is-NULL.patch [bz#1757796]
- kvm-vfio-don-t-ignore-return-value-of-migrate_add_blocke.patch [bz#1757796]
- kvm-hw-vfio-pci-Fix-double-free-of-migration_blocker.patch [bz#1757796]
- Resolves: bz#1534951
  (RFE: Support preallocation mode for luks format)
- Resolves: bz#1718727
  (Committing changes to the backing file over NBD fails with reopening files not supported)
- Resolves: bz#1757796
  (RFE: support for net failover devices in qemu)- kvm-qemu-pr-helper-fix-crash-in-mpath_reconstruct_sense.patch [bz#1772322]
- Resolves: bz#1772322
  (qemu-pr-helper: fix crash in mpath_reconstruct_sense)- kvm-curl-Keep-pointer-to-the-CURLState-in-CURLSocket.patch [bz#1745209]
- kvm-curl-Keep-socket-until-the-end-of-curl_sock_cb.patch [bz#1745209]
- kvm-curl-Check-completion-in-curl_multi_do.patch [bz#1745209]
- kvm-curl-Pass-CURLSocket-to-curl_multi_do.patch [bz#1745209]
- kvm-curl-Report-only-ready-sockets.patch [bz#1745209]
- kvm-curl-Handle-success-in-multi_check_completion.patch [bz#1745209]
- kvm-curl-Check-curl_multi_add_handle-s-return-code.patch [bz#1745209]
- kvm-vhost-user-save-features-if-the-char-dev-is-closed.patch [bz#1738768]
- kvm-block-snapshot-Restrict-set-of-snapshot-nodes.patch [bz#1658981]
- kvm-iotests-Test-internal-snapshots-with-blockdev.patch [bz#1658981]
- kvm-qapi-Add-feature-flags-to-commands-in-qapi-introspec.patch [bz#1658981]
- kvm-qapi-Allow-introspecting-fix-for-savevm-s-cooperatio.patch [bz#1658981]
- kvm-block-Remove-backing-null-from-bs-explicit_-options.patch [bz#1773925]
- kvm-iotests-Test-multiple-blockdev-snapshot-calls.patch [bz#1773925]
- Resolves: bz#1658981
  (qemu failed to create internal snapshot via 'savevm' when using blockdev)
- Resolves: bz#1738768
  (Guest fails to recover receiving packets after vhost-user reconnect)
- Resolves: bz#1745209
  (qemu-img gets stuck when stream-converting from http)
- Resolves: bz#1773925
  (Fail to do blockcommit with more than one snapshots)- kvm-virtio-blk-Add-blk_drain-to-virtio_blk_device_unreal.patch [bz#1706759]
- kvm-Revert-qcow2-skip-�x�������������������X�Pl�}X��������$��������������������[bz#1797064]
- kvm-virtiofsd-do_read-missing-NULL-check.patch [bz#1797064]
- kvm-tools-virtiofsd-fuse_lowlevel-Fix-fuse_out_header-er.patch [bz#1797064]
- kvm-virtiofsd-passthrough_ll-cleanup-getxattr-listxattr.patch [bz#1797064]
- kvm-virtiofsd-Fix-xattr-operations.patch [bz#1797064]
- Resolves: bz#1738451
  (qemu on src host core dump after set multifd-channels and do migration twice (first migration execute migrate_cancel))
- Resolves: bz#1782529
  (Windows Update Enablement with default smbios strings in qemu)
- Resolves: bz#1797064
  (virtiofsd: Fixes)- kvm-target-i386-kvm-initialize-feature-MSRs-very-early.patch [bz#1791648]
- kvm-target-i386-add-a-ucode-rev-property.patch [bz#1791648]
- kvm-target-i386-kvm-initialize-microcode-revision-from-K.patch [bz#1791648]
- kvm-target-i386-fix-TCG-UCODE_REV-access.patch [bz#1791648]
- kvm-target-i386-check-for-availability-of-MSR_IA32_UCODE.patch [bz#1791648]
- kvm-target-i386-enable-monitor-and-ucode-revision-with-c.patch [bz#1791648]
- kvm-qcow2-Fix-qcow2_alloc_cluster_abort-for-external-dat.patch [bz#1703907]
- kvm-mirror-Store-MirrorOp.co-for-debuggability.patch [bz#1794692]
- kvm-mirror-Don-t-let-an-operation-wait-for-itself.patch [bz#1794692]
- Resolves: bz#1703907
  ([upstream]QEMU coredump when converting to qcow2: external data file images on block devices with copy_offloading)
- Resolves: bz#1791648
  ([RFE] Passthrough host CPU microcode version to KVM guest if using CPU passthrough)
- Resolves: bz#1794692
  (Mirror block job stops making progress)- kvm-vhost-user-gpu-Drop-trailing-json-comma.patch [bz#1805334]
- Resolves: bz#1805334
  (vhost-user/50-qemu-gpu.json is not valid JSON)- kvm-spapr-Enable-DD2.3-accelerated-count-cache-flush-in-.patch [bz#1796240]
- kvm-util-add-slirp_fmt-helpers.patch [bz#1798994]
- kvm-tcp_emu-fix-unsafe-snprintf-usages.patch [bz#1798994]
- kvm-virtio-add-ability-to-delete-vq-through-a-pointer.patch [bz#1791590]
- kvm-virtio-make-virtio_delete_queue-idempotent.patch [bz#1791590]
- kvm-virtio-reset-region-cache-when-on-queue-deletion.patch [bz#1791590]
- kvm-virtio-net-delete-also-control-queue-when-TX-RX-dele.patch [bz#1791590]
- Resolves: bz#1791590
  ([Q35] No "DEVICE_DELETED" event in qmp after unplug virtio-net-pci device)
- Resolves: bz#1796240
  (Enable hw accelerated cache-count-flush by default for POWER9 DD2.3 cpus)
- Resolves: bz#1798994
  (CVE-2020-8608 qemu-kvm: QEMU: Slirp: potential OOB access due to unsafe snprintf() usages [rhel-av-8.2.0])- kvm-i386-Resolve-CPU-models-to-v1-by-default.patch [bz#1779078 bz#1787291 bz#1779078 bz#1779078]
- kvm-iotests-Support-job-complete-in-run_job.patch [bz#1781637]
- kvm-iotests-Create-VM.blockdev_create.patch [bz#1781637]
- kvm-block-Activate-recursively-even-for-already-active-n.patch [bz#1781637]
- kvm-hmp-Allow-using-qdev-ID-for-qemu-io-command.patch [bz#1781637]
- kvm-iotests-Test-external-snapshot-with-VM-state.patch [bz#1781637]
- kvm-iotests.py-Let-wait_migration-wait-even-more.patch [bz#1781637]
- kvm-blockdev-fix-coding-style-issues-in-drive_backup_pre.patch [bz#1745606 bz#1746217 bz#1773517 bz#1779036 bz#1782111 bz#1782175 bz#1783965]
- kvm-blockdev-unify-qmp_drive_backup-and-drive-backup-tra.patch [bz#1745606 bz#1746217 bz#1773517 bz#1779036 bz#1782111 bz#1782175 bz#1783965]
- kvm-blockdev-unify-qmp_blockdev_backup-and-blockdev-back.patch [bz#1745606 bz#1746217 bz#1773517 bz#1779036 bz#1782111 bz#1782175 bz#1783965]
- kvm-blockdev-honor-bdrv_try_set_aio_context-context-requ.patch [bz#1745606 bz#1746217 bz#1773517 bz#1779036 bz#1782111 bz#1782175 bz#1783965]
- kvm-backup-top-Begin-drain-earlier.patch [bz#1745606 bz#1746217 bz#1773517 bz#1779036 bz#1782111 bz#1782175 bz#1783965]
- kvm-block-backup-top-Don-t-acquire-context-while-droppin.patch [bz#1745606 bz#1746217 bz#1773517 bz#1779036 bz#1782111 bz#1782175 bz#1783965]
- kvm-blockdev-Acquire-AioContext-on-dirty-bitmap-function.patch [bz#1745606 bz#1746217 bz#1773517 bz#1779036 bz#1782111 bz#1782175 bz#1783965]
- kvm-blockdev-Return-bs-to-the-proper-context-on-snapshot.patch [bz#1745606 bz#17462�x�������������H��������X��l��������(�������1��$!����������������1�2�0��, non-interlacedPNG image data, 850 x 425, 8-bit colormap, non-interlacedPNG image data, 775 x 468, 8-bit/color RGBA, non-interlacedPNG image data, 236 x 625, 8-bit grayscale, non-interlacedPNG image data, 236 x 628, 8-bit grayscale, non-interlacedPNG image data, 863 x 795, 8-bit colormap, non-interlacedPNG image data, 854 x 788, 8-bit colormap, non-interlacedPNG image data, 961 x 743, 8-bit colormap, non-interlacedPNG image data, 242 x 719, 8-bit grayscale, non-interlacedPNG image data, 839 x 177, 8-bit/color RGBA, non-interlacedPNG image data, 159 x 827, 8-bit/color RGB, non-interlacedPNG image data, 1064 x 295, 8-bit/color RGBA, non-interlacedPNG image data, 981 x 189, 8-bit/color RGBA, non-interlacedPNG image data, 448 x 1179, 8-bit/color RGB, non-interlacedPNG image data, 1089 x 183, 8-bit/color RGBA, non-interlacedPNG image data, 1091 x 100, 8-bit/color RGBA, non-interlacedPNG image data, 670 x 508, 8-bit gray+alpha, non-interlacedPNG image data, 672 x 510, 8-bit gray+alpha, non-interlacedPNG image data, 542 x 1137, 8-bit/color RGB, non-interlacedPNG image data, 729 x 471, 8-bit colormap, non-interlacedPNG image data, 1121 x 680, 8-bit colormap, non-interlacedPNG image data, 137 x 613, 8-bit/color RGBA, non-interlacedPNG image data, 1021 x 403, 8-bit colormap, non-interlacedPNG image data, 1008 x 309, 8-bit colormap, non-interlacedPNG image data, 1373 x 347, 8-bit colormap, non-interlacedPNG image data, 300 x 300, 8-bit/color RGB, non-interlacedPNG image data, 1486 x 274, 8-bit colormap, non-interlacedPNG image data, 96 x 90, 8-bit colormap, non-interlacedPNG image data, 430 x 396, 8-bit colormap, non-interlacedPNG image data, 574 x 135, 8-bit colormap, non-interlacedPNG image data, 240 x 133, 8-bit gray+alpha, non-interlacedPNG image data, 1395 x 288, 8-bit colormap, non-interlacedPNG image data, 963 x 227, 8-bit colormap, non-interlacedPNG image data, 1438 x 425, 8-bit/color RGBA, non-interlacedPNG image data, 1248 x 399, 8-bit colormap, non-interlacedPNG image data, 1363 x 637, 8-bit colormap, non-interlacedPNG image data, 239 x 65, 4-bit colormap, non-interlacedPNG image data, 20 x 43, 8-bit gray+alpha, non-interlacedPNG image data, 28 x 43, 4-bit colormap, non-interlacedPNG image data, 170 x 17, 4-bit colormap, non-interlacedPNG image data, 340 x 17, 8-bit gray+alpha, non-interlacedPNG image data, 393 x 17, 4-bit colormap, non-interlacedPNG image data, 1269 x 507, 8-bit/color RGBA, non-interlacedPNG image data, 1768 x 383, 8-bit colormap, non-interlacedPNG image data, 742 x 660, 8-bit colormap, non-interlacedPNG image data, 1248 x 383, 8-bit colormap, non-interlacedPNG image data, 971 x 1313, 8-bit/color RGB, non-interlacedPNG image data, 1163 x 2366, 8-bit colormap, non-interlacedPNG image data, 855 x 625, 8-bit colormap, non-interlacedPNG image data, 903 x 630, 8-bit colormap, non-interlacedPNG image data, 610 x 480, 8-bit/color RGB, non-interlacedPNG image data, 872 x 315, 8-bit/color RGB, non-interlacedPNG image data, 870 x 455, 8-bit/color RGB, non-interlacedPNG image data, 624 x 846, 8-bit/color RGB, non-interlacedPNG image data, 722 x 538, 8-bit colormap, non-interlacedPNG image data, 884 x 621, 8-bit/color RGB, non-interlacedPNG image data, 1223 x 770, 8-bit/color RGB, non-interlacedPNG image data, 1394 x 308, 8-bit/color RGBA, non-interlacedPNG image data, 1122 x 546, 8-bit colormap, non-interlacedPNG image data, 866 x 333, 8-bit/color RGB, non-interlacedPNG image data, 1064 x 533, 8-bit/color RGBA, non-interlacedPNG image data, 1060 x 278, 8-bit colormap, non-interlacedPNG image data, 1060 x 444, 8-bit colormap, non-interlacedPNG image data, 1098 x 744, 8-bit/color RGB, non-interlacedPNG image data, 1383 x 1559, 8-bit/color RGB, non-interlacedPNG image data, 406 x 256, 8-bit/color RGBA, non-interlacedPNG image data, 803 x 1195, 8-bit/color RGB, non-interlacedPNG image data, 1269 x 399, 8-bit/color RGBA, non-interlacedPNG image data, 1786 x 1089, 8-bit/color RGBA, non-interlacedPNG image data, 1153 x 426, 8-�x����������������������X�jlȥ���������$.�������������������MW�?R�d����	�	S�h�l�����������	�����$PdP	P
�P�P�P
PDP�Pd�P�2"�^$^+
^(+�8+� 9,4 :2> G:�PH< PI=`PX=�2Y>x2\?tP]@�P^D�bF�dG�eG�fG�lG�tHPuITPvJ�	wK�PxMPyN@��Q��Q��Q��Q��Q��R2�R4�R<�RB�R�R�R�6T�T�6
WWA�W�W�PW�gW�hW�Cperl-CPAN2.18402.el8_10Query, download and build perl modules from CPAN sitesThe CPAN module automates or at least simplifies the make and install of
perl modules and extensions. It includes some primitive searching
capabilities and knows how to use LWP, HTTP::Tiny, Net::FTP and certain
external download clients to fetch distributions from the net.h?~s390x-builder01.almalinux.org_>AlmaLinuxAlmaLinuxGPL+ or ArtisticAlmaLinux Packaging Team <packager@almalinux.org>Unspecifiedhttp://search.cpan.org/dist/CPAN/linuxnoarch ��L��
���+�3���~��K
1���y���	�#�u�l����(
+d�&b��6��.��.�����,"
I[V��
d�9�A7Wv��!,7�AKL.���A큤������������������������������������������������������A큤A큤A큤��������������������A큤������A큤����A큤��������A큤����A큤������A큤��������������h?uh?uh?{h?th?th?th?th?th?th?th?th?th?th?uh?uh?uh?uh?uh?uh?uh?uh?uh?uh?uh?uh?uh?uh?uh?uh?uh?uh?uh?th?uh?th?uh?th?th?th?th?th?th?th?th?th?th?th?uh?th?th?th?th?uh?th?th?th?uh?th?th?th?th?th?uh?th?th?th?uh?th?th?th?th?uh?th?th?th?th?th?th?th?t34943177cc5f72ce1c45621c6ef36994f7a1d964ad25e895d422de8ce0e967796ef668795730df67c467817c609188588a4741123acd6b5e58e5e1b9185b5ca3c895956dd9e7eee2d67a6440758953c9bbea7c0d174db8b499fb1400f0546a3921ee829b22a603552529e8f9eaea4161b839fc5c60766d505a01ac6d52a5c23a77b8c04bb078e184a5fc9fa4ee70e8a990ef71fbf4b46c3f28c633935885dc5a71403dba61c99d9ec5d1fa778ee121972f51bee0adcf926bc612a2688dda176859b4e29859e2f658a99cc994e8d7ae271c2c5e04554cc59a32b3145abb0a7a1c98c6ec5f93820498d69cd6cfa97762cd3837b31a664518f932f4127df9355cfa7c1c434b4ba0bc50088d6a3c6f2a884379d5f560b921da18f3ccd0f2e8d2a3ee57fe88a2c9a3498776dc12a9ae6bc4151028c84d3a48de6b0addf6c32e9dbb901b1a61add0d6f78134d9474ce6ea5bde85e9c1d38cbb82667392aabcc2f9874cb72b408ba23c21723de10ec8765c1807edef6c330e764e5bed952a81fa0f4560480ececbf6fe5834c5cd36a8106f995465f0e53fff05a6d18a065abafb52e03c0435e9310b09da8882ea94fdf349fb8b730826c709bb14cf739efe6de4305bf05a1e5e136d4f5fc73f4f0b6c3ba83091b64734d63bdeb3d444555266e6e0b12104fc3b168e5ea0577fc750800cc59a14edee2d14eb852e0ffa37a9766371889a05106757d5d7910c89445106cb51eedd5df728f533856b23de9a88a3535f803c217d49fd8b414d1c5a6b1fa2562404761b4f0909a57600abf3839bf1195f5c188c28b0bb7b9fac6b4b6cea9ed60a4a39ed369f016999282cd075787d3bf68ccbeb05f87a9f8c30a5e97c869a54b7a5a858b8abe94ebd0cdc75711817273e7c46df044f37a420ce58c3c07�x�������������(��������X��l���������m	�4�$}�����������������4�4��	�k����J��ͣ�q�� W�ǔ�4�t���*���Hc�i�ZĴ$P8b008c3f0b0ac62f359c83cb412aa86734091e68428a36e29c7a3617146b2da77c28cc344c53de243b93609ae8a1e83a2d5167a5i/'���i/&��	�	�	�	�	�	�	�	t	X	H	,	 			�$h
\
P
����������|p8
,


��������thTHXL<0`T�����dX���	�	������D8 �t���t�	�	`T8,�	�	 		D8�	�	���d	X	�	x	(t���README-LICENSE��`�|RAND_DRBG.7ssl.gz�{RAND.7ssl.gz�README.FIPS��"PatternGrammar3.6.8.final.0.pickle��PatternGrammar.txt��D
README.ctypes�2README.lat9�1README.lat7�0README.lat0�/README.eurlatgr.mappings�.README.eurlatgr�-README.drdos�,README.cybercafe�+
README.cp1250�*
README.Sun�)README.LatGrkCyr�(README.Lat2-Terminus16�'
README.Hebrew�&README.Greek�%README.Ethiopic�$README.Cyrillic�#
README.Arabic�"README.12x22a�PREADME.compiled�
MR700_rlc.bin�	MR600_uvd.bink�RR600_rlc.bin��JR600_pfp.bin���R600_me.binDM�
R520_cp.binR�lR420_cp.binR� R300_cp.binR�tR200_cp.bin�nR100_cp.bin?�\
MRB5ig�/QCN9074zi�).QCA6390R��cQCA99X0��QCA9984��+QCA988X��QCA9888���c876�clean.cpython-311.�b12��commit-m�cbqR{b53dobtarmbc.ijbloofce4f9bytdcrypto.h]config.cpython-36	@cmc.#ca.msg	baa.�cpuf�atkm�c31.�check.cpython-36.opt-2st�cgi.cpython-311.pycl�animation-0005	�codingstatemachine.p{auth.pyPucomparison_placement.pyP'?cs35l41-dsp1-spk-cali-10431463-spkid1-rn >cs35l41-dsp1-spk-cali-103c8c26.w!=cs35l41-dsp1-spk-cali-103c89c3-r1
%<cs35l41-dsp1-spk-cali-10280cc4-spkid1�';cs35l41-dsp1-spk-cali-10280b28-spkid1-r�crl4cpf-Pcp874.cpython-311.opt-2[�cp863.cpython-36.opt-2te�cp850.4�tcp1257.p�cp1250.pcourB14��copy.cpython-36.opt-2conVcontextvars.cpython-311.opt-2	�contacts.
�contacts-c	_console.p�configucompose�com.github.m	�color-whyas.
�color-nots	�color-canNycolor-calibrate-pico�cn-�clock.M�client.cpython-36ocirchm�chardetect.cpython-36.p
Tcentos-6.92cd-icase.py1�cachef�cPpk�c64e�bzless.
builtins.c�build-s�brcmfmac4356-sdio.v:brcmfmac43455-sdio.R9brcmfmac43340-sdio.b
�brain_numpy_rs35
�brain_date8c1bpg-dv	Cbonaire_r-10 bnZbluetooth-r
�bitObig5h41-�beige_goby_pKbdist_wininst.cpython-36.opt-2/bd8�
�battery-low-sb	xbattery-f|bash_�base64.cpython-36.opt-2e
nbamboo-16fg-s�backup-t�b7a-b38o�aycoaudio-volume-l�asynchat.cpython-36.pyc5"asianux-7.1�	array_like.pyip1
�arcturus_gappl�ansitowin32.cpython-36.piam-ob�x��������������x�������X��k���������������ʳ�$Z����������������ʳ˳ɳ�hanged
- Fix bug #79986: str_ireplace bug with diacritics characters
- Fix bug #80007: Potential type confusion in unixtojd() parameter parsing
- Fix bug #80049: Memleak when coercing integers to string via variadic argument- MODLS-815: override_ini processing patch added
- MODLS-818: Litespeed SAPI updated to 7.8- EA-9281: Update litespeed from upstream to 7.8- Fix bug #79787: mb_strimwidth does not trim string
- Fix bug #79797: Use of freed hash key in the phar_parse_zipfile function (CVE-2020-7068)
- Fix bug #70362: Can't copy() large 'data://' with open_basedir
- Fix bug #73527: Invalid memory access in php_filter_strip
- Fix bug #74267: segfault with streams and invalid data
- Fix bug #79783: Segfault in php_str_replace_common
- Fix bug #79877: getimagesize function silently truncates after a null byte
- Fix bug #62890: default_socket_timeout=-1 causes connection to timeout- MODLS-741: Make LSCRIU log messages with timestamps
- MODLS-804: Improve mod_lsapi & lsphp error reporting in case of php memory limit reached- EA-9189: Update litespeed from upstream to 7.7- EA4D-197: Fix ea-php specs for using our litespeed patches- Fix bug #78221: DOMNode::normalize() doesn't remove empty text nodes
- Fix bug #78875: Long variables cause OOM and temp files are not cleaned (CVE-2019-11048)
- Fix bug #78876: Long variables in multipart/form-data cause OOM and temp files are not cleaned (CVE-2019-11048)
- Fix bug #79497: stream_socket_client() throws an unknown error sometimes with <1s timeout
- Fix bug #79503: Memory leak on duplicate metadata
- Fix bug #79514: Memory leaks while including unexistent file
- Fix bug #79528: Different object of the same xml between 7.4.5 and 7.4.4- Fix bug #79468: SIGSEGV when closing stream handle with a stream filter appended- Fix bug #61597: SXE properties may lack attributes and content
- Fix bug #74940: DateTimeZone loose comparison always true
- Fix bug #75673: SplStack::unserialize() behavior
- Fix bug #79199: curl_copy_handle() memory leak
- Fix bug #79200: Some iconv functions cut Windows-1258
- Fix bug #79296: ZipArchive::open fails on empty file (libzip 1.6.0)
- Fix bug #79330: shell_exec() silently truncates after a null byte
- Fix bug #79364: When copy empty array, next key is unspecified
- Fix bug #79393: Null coalescing operator failing with SplFixedArray
- Fix bug #79396: setting Date/Time during a forward DST transition
- Fix bug #79410: system() swallows last chunk if it is exactly 4095 bytes without newline
- Fix bug #79413: session_create_id() fails for active sessions
- Fix bug #79424: php_zip_glob uses gl_pathc after call to globfree
- Fix bug #79465: OOB Read in urldecode() (CVE-2020-7067)
- Fix bug #79468: SIGSEGV when closing stream handle with a stream filter appended- EA-8928: Updated the required version for ea-libcurl- Fix bug #77569: Write Access Violation in DomImplementation
- Fix bug #79078: Hypothetical use-after-free in curl_multi_add_handle
- Fix bug #79282: Use-of-uninitialized-value in exif (CVE-2020-7064)
- Fix bug #79329: get_headers silently truncates after a null byte (CVE-2020-7066)- Fix bug #79099: OOB read in php_strip_tags_ex (CVE-2020-7059)
- Fix bug #79037: global buffer-overflow in `mbfl_filt_conv_big5_wchar` (CVE-2020-7060)
- Fix bug #79082: Files added to tar with Phar::buildFromIterator have all-access permissions (CVE-2020-7063)
- Fix bug #79091: heap use-after-free in session_create_id()
- Fix bug #79221: Null Pointer Dereference in PHP Session Upload Progress (CVE-2020-7062)- ZC-6247: Remove conflict between php-fpm and runtime.- MODLS-735: Delete criu images for host/user when lsapi_backend_pgrp_max_crashes triggered- EA-8854: Fix circular dependencies in our PHP packages- Fixed bug #78793 (Use-after-free in exif parsing under memory sanitizer)
- Fixed bug #78878 (Buffer underflow in bc_shift_addsub). (CVE-2019-11046)
- Fixed bug #78910 (Heap-buffer-overflow READ in exif). (CVE-2019-11047)
- Fixed bug #78863 (DirectoryIterator class silently truncates after a nullbyte). (CVE-2019-11045)
- Fixed bug #�x�������������h�������X��l���������A���������$:�����������������������nce counting in php_request_shutdown causes Use-After-Free). (CVE-2024-11235)- ZC-12495: Do gcc like newer PHPs so that the libicu update won’t break the build- EA-12576: Update ea-php81 from v8.1.30 to v8.1.31
- (Single byte overread with convert.quoted-printable-decode filter). (CVE-2024-11233)
- (Configuring a proxy in a stream context might allow for CRLF injection in URIs). (CVE-2024-11234)
- (Integer overflow in the dblib quoter causing OOB writes). (CVE-2024-11236)
- (Integer overflow in the firebird quoter causing OOB writes). (CVE-2024-11236)
- (Leak partial content of the heap through heap buffer over-read). (CVE-2024-8929)
- (OOB access in ldap_escape). (CVE-2024-8932)- ZC-12246: Correct conffiles for Ubuntu- EA-12428: Update ea-php81 from v8.1.29 to v8.1.30
- Fixed bug GHSA-865w-9rf3-2wh5 (Logs from childrens may be altered). (CVE-2024-9026)
- Fixed bug GHSA-9pqp-7h25-4f32 (Erroneous parsing of multipart form data). (CVE-2024-8925)
- Fixed bug GHSA-p99j-rfp4-xqvq (Bypass of CVE-2024-4577, Parameter Injection Vulnerability). (CVE-2024-8926)
- Fixed bug GHSA-94p6-54jq-9mwp (cgi.force_redirect configuration is bypassable due to the environment variable collision). (CVE-2024-8927)- ALTPHP-1839: Change lsapi naming- ZC-12153: make opcache INI a configfile for debs- ZC-12114: Apply fix for libxml2- EA-12192: Update ea-php81 from v8.1.28 to v8.1.29
- Fixed bug GHSA-3qgc-jrrr-25jv (Bypass of CVE-2012-1823, Argument Injection in PHP-CGI). (CVE-2024-4577)
- Fixed bug GHSA-w8qr-v226-r27w (Filter bypass in filter_var FILTER_VALIDATE_URL). (CVE-2024-5458)
- Fixed bug GHSA-9fcc-425m-g385 (Bypass of CVE-2024-1874). (CVE-2024-5585)
- The openssl_private_decrypt function in PHP, when using PKCS1 padding (OPENSSL_PKCS1_PADDING, which is the default), is vulnerable to the Marvin Attack- ZC-11730: Add GD support for AVIF format on Ubuntu 22 and higher- EA-12087: Update ea-php81 from v8.1.27 to v8.1.28
- Fixed bug GHSA-pc52-254m-w9w7 (Command injection via array-ish $command parameter of proc_open). (CVE-2024-1874)
- Fixed bug GHSA-wpj3-hf5j-x4v4 (__Host-/__Secure- cookie bypass due to partial CVE-2022-31629 fix). (CVE-2024-2756)
- Fixed bug GHSA-h746-cjrr-wfmr (password_verify can erroneously return true, opening ATO risk). (CVE-2024-3096)- ZC-11561: Add GD support for AVIF format on RHEL 8 and newer (RHEL only)- EA-11892: Update ea-php81 from v8.1.26 to v8.1.27- EA4D-470: build with system libicu for RHEL >= 9- EA-10753: Have snmp module require 'snmp-mibs-downloader' for deb- EA-11821: Patch to build with the latest ea-libxml2- ZC-11419: Correct Ubuntu build issues- EA-11824: Update ea-php81 from v8.1.25 to v8.1.26- EA-11776: Update ea-php81 from v8.1.24 to v8.1.25- EA-11716: Update ea-php81 from v8.1.23 to v8.1.24- EA-11664: Update ea-php81 from v8.1.22 to v8.1.23- EA-11589: Update ea-php81 from v8.1.21 to v8.1.22
	- Libxml:
		Fixed bug GHSA-3qrf-m4j2-pcrr (Security issue with external entity loading in XML without enabling it). (CVE-2023-3823)
	- Phar:
		Fixed bug GHSA-jqcx-ccgc-xwhv (Buffer mismanagement in phar_dir_read()). (CVE-2023-3824)- EA-11538: Update ea-php81 from v8.1.20 to v8.1.21- EA-11477: Update ea-php81 from v8.1.19 to v8.1.20
    - Fixed bug GHSA-76gg-c692-v2mw
        - (Missing error check and insufficient random bytes in HTTP Digest authentication for SOAP).- EA-11447: Increase default php memory_limit for new installs from 32M to 128M- ZC-10931: Statically link ea-libc-client- ZC-10950: Fix build problems- ZC-10936: Clean up Makefile and remove debug-package-nil- EA-11415: Update ea-php81 from v8.1.18 to v8.1.19- ZC-10873: Simplify the libidn deps, for building on Ubuntu 20 and 22- EA-11356: Update ea-php81 from v8.1.17 to v8.1.18- EA-11300: Update ea-php81 from v8.1.16 to v8.1.17- EA-11244: Update ea-php81 from v8.1.15 to v8.1.16
- Fixed bug #81744 (Password_verify() always return true with some hash). (CVE-2023-0567)
- Fixed bug #81746 (1-byte array overrun in common path resolve code). (CVE-2023-0568)
- Fixed bug GHSA-54hq-v5wp-fqgv (DOS vulne�x��������������W�������X��l��	�v������`��$p����������������`�a�r fixed some bugs- built against glibc�2:4.6-23.el8_102:4.6-23.el8_10getsubids.build-id88a6a39e38f493f9d1cfde682e84a8b067109b6810a1067a60bf6170f7e532569ddb622016dc50libsubid.so.3libsubid.so.3.0.0getsubids.1.gz/usr/bin//usr/lib//usr/lib/.build-id/0d//usr/lib/.build-id//usr/lib/.build-id/68//usr/lib64//usr/share/man/man1/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnuELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=6810a1067a60bf6170f7e532569ddb622016dc50, strippeddirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0d88a6a39e38f493f9d1cfde682e84a8b067109b, strippedtroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)

R	RR
RRRRRRR
RRRPRRRRRRRR
RRR	RRRRR
RRRRRutf-8a37db175e7547f43608b42ae81c02284bcf8f5dcf5e554cc394d575da160f32f?���0��3!�^���P,��*����%�iDi�
	*����%����"sM��u��)�QH���o.�7�Ԁ�jI��=�}T�v���֋��ɨ\:��7�^�F\�b���<%Z�������roG��i]⽷u�_�ˡ�����������&"+�N���A�46뎜Z��TaGU���n���]���Q��W쮍��p��md/S����*~�|x���-�m[�!}��'M���^�9Y:�cO�>@�^.ik���i
yS�ެ3c� ����̟ �jj��b���r-�t�	ష5l8cZw��T[�:�t���oN�y e�g(n��:��:
��}��m��fd�Ӌ�;149<��͛H�
�ț���TD™rJC�05�])o�=�n�u�Ҕ�Ǭ�q�{�[5ƒJ���?٬=�tG/銂�Z�Uv����|m)�ɪ"x��.$U}�:����N9
G���=�F�Z���M��G׈Z
j���c݃O��偼�$�u.�a7jnp��4��t>	�	�†��W����Z7���ԏ�I��NX?=�64Og��r>��I���3!�^���P,��*����%�iDi�
	*����%����7FOir�(��Tm�����@ŋҭF~X�S�uOa�L�N�D�ιagA��ģ9$	Kj(�W`yK�p:�LT�8�"�|Q
�ï+T!�?ݢSo�t�Z�z���Y���3����N�IB�<+f�'�n� >���0�S��/�h/x֨��=ҽ2���\��9w���{k�^�ٰ�4�.��B�ˍ��
*�~#�L��Q*�J�a�rr6� ��`b��ې�)��rb��_��j?�?O����6��S�6璮Ȧ�3��v��TKn�r�Cc0P��TV���s�v'^@l1N�x�����H�'��_��
��� ��}K�&�x�t��DS	z"(�F�ʨ���H[cBL�<�ω"�K0�;��L��+oe�K�3�q�NH�%R��Kŗۖ)����Up@�`$���K��+p^��n�Id�S�T����=��͛�D�h��y_�p�nw��7�Q��kW��ߡBHӞq⇻��3aecaad3778e4af3d8af11de59d7ccf62554641fa02f25ab8d08c6948898698894a0b3e18b60f4e4ace550967d9565c07c0aaa4eiJos8�iJoonetdrv] i40e: add AF_XDP zero-copy Tx support (Stefan Assmann) [1630760]
- [netdrv] i40e: move common Tx functions to i40e_txrx_common.h (Stefan Assmann) [1630760]
- [netdrv] xsk: i40e: get rid of useless struct xdp_umem_props (Stefan Assmann) [1630760]
- [netdrv] i40e: add AF_XDP zero-copy Rx support (Stefan Assmann) [1630760]
- [netdrv] i40e: move common Rx functions to i40e_txrx_common.h (Stefan Assmann) [1630760]
- [netdrv] i40e: refactor Rx path for re-use (Stefan Assmann) [1630760]
- [netdrv] i40e: added queue pair disable/enable functions (Stefan Assmann) [1630760]
- [netdrv] i40e: Prevent deleting MAC address from VF when set by PF (Stefan Assmann) [1630760]
- [netdrv] i40e: hold the rtnl lock on clearing interrupt scheme (Stefan Assmann) [1630760]
- [netdrv] i40e: Check and correct speed values for link on open (Stefan Assmann) [1630760]
- [netdrv] i40e: report correct statistics when XDP is enabled (Stefan Assmann) [1630760]
- [netdrv] i40e: static analysis report from community (Stefan Assmann) [1630760]
- [netdrv] i40e: use correct length for strncpy (Stefan Assmann) [1630760]
- [netdrv] i40evf: Change a VF mac�x�������������G�������X�1l���������w������3�$#����������������34�G ?d����	 �	8�X�\�t�x�������	��������			*	
<	`	i	
�	�	�	*P	t��L(r8|%9%:
�%G�	H	I(	X4YD\h	]�	^b�d�e�f�l�t�	u	v@w<	x`	y��������,0����
}����	�g�h Cxorg-x11-xkb-utils7.728.el8X.Org X11 xkb utilitiesX.Org X11 xkb core utilities._<XAbuild.cloudlinux.com�CloudLinuxCloudLinuxMITCloudLinux Packaging Team <packager@cloudlinux.com>Unspecifiedhttps://www.x.orglinuxx86_64td09"���A�A�A�����_<XA_<XA_<XA_<XA_<XA_<XA_<XA_<X3_<X6c6d521d88064e92ef7abd070761bf45272d938b2b20b87d19b680ce782295864434b25abc89629d7caf99e19bdd87c91a088321dc90de841fc2dcd3414c624b03fe74f8e2a80593af68dd5cad5b0067de542f05592d4052a42eec8860c6d93271d4980c2f9e6d1272373cc8ecc6307fbc6ece55cf7f3963174cf49ed09ea6718../../../../usr/bin/xkbcomp../../../../usr/bin/setxkbmaprootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootxorg-x11-xkb-utils-7.7-28.el8.src.rpm������������������������������������setxkbmapxkbcompxorg-x11-xkb-utilsxorg-x11-xkb-utils(x86-64)@@@@@@@@@



@libX11.so.6()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libxkbfile.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.2^�(@[�$@[,�[@Z��@Z��@Z}�@Y�@Yy�YK�@X���V���V�v�V;D�U�@UB@T�s@To)@T\�@S��S�P@Q�B@Q�a�Q�a�Q�@P�6@P<��P�@O�@On@N�@MU$�MQ0@M*�L�L��@L5��Peter Hutterer <peter.hutterer@redhat.com> 7.7-28Adam Jackson <ajax@redhat.com> - 7.7-27Peter Hutterer <peter.hutterer@redhat.com> 7.7-26Peter Hutterer <peter.hutterer@redhat.com> 7.7-25Adam Jackson <ajax@redhat.com> - 7.7-24Adam Jackson <ajax@redhat.com> - 7.7-23Fedora Release Engineering <releng@fedoraproject.org> - 7.7-22Fedora Release Engineering <releng@fedoraproject.org> - 7.7-21Fedora Release Engineering <releng@fedoraproject.org> - 7.7-20Peter Hutterer <peter.hutterer@redhat.com> 7.7-19Fedora Release Engineering <releng@fedoraproject.org> - 7.7-18Fedora Release Engineering <releng@fedoraproject.org> - 7.7-17Peter Hutterer <peter.hutterer@redhat.com>Peter Hutterer <peter.hutterer@redhat.com> 7.7-16Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 7.7-15Simone Caronni <negativo17@gmail.com> - 7.7-14Till Maas <opensource@till.name> - 7.7-13Peter Hutterer <peter.hutterer@redhat.com> 7.7-12Simone Caronni <negativo17@gmail.com> - 7.7-11Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 7.7-10Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 7.7-9Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 7.7-8Peter Hutterer <peter.hutterer@redhat.com> 7.7-7Peter Hutterer <peter.hutterer@redhat.com> 7.7-6Peter Hutterer <peter.hutterer@redhat.com> 7.7-5Peter Hutterer <peter.hutterer@redh�x��������������6�������X��k��������������=��$-����������������=�<�>��mode categories (vpodzime)
- Add missing items to particular sections in the documentation (vpodzime)
- Add a basic test for the runtime dependency checking (vpodzime)
- Simplify what WITH_BD_BCACHE changes in the KBD plugin (vpodzime)
- Add functions for querying available technologies (vpodzime)
- Dynamically check for the required utilities (vpodzime)
- Use shorter prefix for tempfiles (vtrefny)
- Try harder when waiting for lio device to show up (vtrefny)
- Better handle old and new zram sysfs api in tests (vtrefny)
- Skip btrfs tests on CentOS 7 aarch64 (vtrefny)
- Add new function for setting swap label (vtrefny)
- Use only one git tag for new releases (vtrefny)
- Fix source URL in spec file (vtrefny)
- Add NEWS.rst file (vtrefny)
- Do not include s390utils/vtoc.h in s390 plugin (vtrefny)
- Use "AC_CANONICAL_BUILD" to check architecture instead of "uname" (vtrefny)
- Bypass error proxy in s390 test (vtrefny)
- Fix zFCP LUN max length (vtrefny)
- Do not run g_clear_error after setting it (vtrefny)
- Allow compiling libblockdev without s390 plugin (vtrefny)
- Add a function for getting plugin name (vpodzime)- Cleanup spec file conditionals correctly- Cleanup spec file conditionals- Own directories /etc/libblockdev and /etc/libblockdev/conf.d (vtrefny)
- Wait for resized partition (kailueke)
- Make sure the device is opened for libparted (vpodzime)
- Fix label check in swap_test (vtrefny)
- Use "run_tests" script for running tests from Makefile (vtrefny)
- Add a script for running tests (vtrefny)
- Tests: Move library initialization to setUpClass method (vtrefny)
- Stop skipping FAT resize tests on rawhide (vtrefny)
- Close filesystem before closing the partition during FAT resize (vtrefny)
- Use mountpoint for "xfs_info" calls (vtrefny)
- Use libmount cache when parsing /proc/mounts (vtrefny)
- Add some space for the CI status (vpodzime)
- Confirm the force when creating PVs in FS tests (vpodzime)
- Skip vgremove tests on 32bit Debian (vtrefny)
- Fix names of backing files in tests (vtrefny)
-  Fix checking for available locales (vtrefny)
- Skip dependency checking in mpath tests on Debian (vtrefny)
- Skip zRAM tests on Debian (vtrefny)
- Skip the test for device escrow on Debian too (vtrefny)
- Skip free region tests on Debian too (vtrefny)
- Fix redirecting command output to /dev/null in tests (vtrefny)
- Try harder to unmount devices in test cleanup (vtrefny)
- Require only plugins that are needed for given test (vtrefny)
- Try to get distribution info from "PrettyName" if "CPEName" isn't available (vtrefny)
- Use -ff when creating PVs in FS tests (vpodzime)
- Sync spec with downstream (vpodzime)- Make the KbdZRAMDevicesTestCase inherit from KbdZRAMTestCase (vpodzime)
- Allow non-source directory builds (kailueke)
- Add a way to disable runtime dependency checks (vpodzime)
- Link to GObject even if no plugin is activated (kailueke)
- Skip zram tests on Rawhide (vpodzime)
- Keep most utilities available for tests (vpodzime)
- Use new libmount function to get (un)mount error message (vtrefny)
- Update the documentation URL (vpodzime)- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Only enable partition size tolerance with alignment (vpodzime)
- Limit the requested partition size to maximum possible (vpodzime)
- Do not verify vfat FS' size after generic resize (vpodzime)
- Specify tolerance for partition size (kailueke)
- Only use the exact constraint if not using any other (vpodzime)
- Check resulting FS size in tests for generic FS resize (vpodzime)
- Query setting FS label support and generic relabeling (kailueke)
- Do not strictly require all FS utilities (vpodzime)
- Compile everything with the C99 standard (vpodzime)
- Add partition resize function (kailueke)
- Generic Check and Repair Functions (kailueke)
- Query functions for FS resize and repair support (kailueke)
- Update the project/source URL in the spec file (vpodzime)
- Add functions for opening/closing TrueCrypt/VeraCrypt volumes (vpodzime)
- Adapt to a change in behaviour in new libmount (vpodzime)
-�x�����:�%�������XTLmPr������00���������$��������������������
C
vTCgbEKtAkXHx/jFDJCYbnJkzrecCSd+a3yQ4Ehp6TCxnywXdseX4WGyNT3E6Ppu
JRIXLKrVwP/5pZxqgBS9EDsQpaqxmkS8iJe9j8Bkzm4mL0K4Y8B5vApIyxRO0i0C
8Eb8UgLSoOwWsZjWpDcYtLgCTNT1CCaOe5lG6qy3HD6Y7LiXinnMgq5uXbfTEKxZ
rUyQ9Jepxe5hk5GJ1mTbQ6vEj0oYOWYWCwLZKOHucRh8BmvYEbhMBGsgBGcMruql
Na+gw1eVIMTknGCdGGwceb3DLNHXGolU3GDTKd8d6lEaXkFx9zXWBicOIDyG72tU
vZMj2RVzmgEhxcw1vKxoJIUOegjpdqBqTJRnM/tnimm4eE65hHhuqRYIngwHWqL0
K+Daxt+J+4l5Xo56AEYc+2i8JA1nGT/nw13KE/7S79wRVaJPzDccI7/mefDKcF3R
EGWG7f9jWqoCB+wvXD+0FpHDcp0TPgDcWTObUs3yBoySbgj8IXL3z2R64wARAQAB
tCJBbG1hTGludXggPHBhY2thZ2VyQGFsbWFsaW51eC5vcmc+iQI+BBMBAgAoBQJf
/YkOAhsBBQkFo5qABgsJCAcDAgYVCAIJCgsEFgIDAQIeAQIXgAAKCRBIj898Ors0
+IsjD/9/F/PIu7kSn4P8Ud9j/iyoO8hH53qXKMimarg920ugt2uUyl6SzaJqV0dK
ACrczvC0VmxrNaJ1jB31TGPpdJZpey5AJbefofu/RgAlxHN6o3QX0Br4bEHahF20
21q2eIjoMrq8eiz8X5D2wfx6CyOA6RZY96MVQ2whXjQHV+hwo65xyMUyjTuFx5Pb
nl7gdYr9EkH3EafdNrpuVurp+Zrgur+973nUrzKq8c2rlDiEQz/ZG+bgasTDYkcz
q6NUPP5OQ5BVpFCkuE9YuziZD+37hxN07P2gyz9NRrfAOZqBXj8er4vqNhpR/lLA
h5QF1erb0mjcMFEhkV8ETN0ceJzL/t829BlQ7MB7LdQ5v9kc5p5cwcsBly54ouI0
l9LjSN95Al0VPoWE8zgjnytecu2UN5+0k12bfcj0zjKdAxEVD3y9Id1MJIze7/PA
6v3LOk+SSs8M0ASmZEnDBTCbDRpXlDDUKEEmMIBRdvpTxjiUnwD2tHwhXR8m6vw6
749i+mdc8fgljTey8sJLKxTabbYNgTHLi9lCMdmPlKU2QJYsIwIBpqF2/eenNyZT
LvlW/aBUU7Li3etUnJeP9ig+V2LuDhyT6TlVPsFKCCruoy7faSjW2/2wlVcasGQp
YqqqqtQJyVDRud6ig7oH3EWSvUySEmywjBp5zfwrMw3jeWkwHbkBjQRf/YnGAQwA
tk5NBR7SCwYwEsmPDUX/SJ98eGHb1nux/cRaX+K2KgX7Yi3hhlFs/InkiiNKs+Au
0N5ZBIXltypguo5jE3MwXQxLr2MfJ74bdDXR7z3BmBB92BMaS+tHNJWroYnqiSQ7
2PXfWRF9PtlChF12NyK6SVrQg58IqJjf5MQ8hodgIk0t21qCvxe/IotktjKHy2Vn
gvKPjtT05qXpAK0CP8N5wtOc4WnFCxvNTI7e1KkYS4dvXHL6V+WvqL3saGIXY5Iy
0jYZW5xMxh691C+HvHQ8/Lof3Enenz3hDJR0X9wvzusxBJWwg/vqRIR8+YYKSHj1
VEFycTabqGLlnPpYpFqDOdqS2gDtdrD6FEsrSpy9pBd98XAzjkn6BW4Rf0PTaJ/z
b3paHsqxEnWbamANs5GYs1Y/1rEIl66jOhZB9Sua22/wfGd3PvfM6nxi825l4coO
bbivRY6U4/WtxQUcK8zdoF97zUlvbNNN0LsluZ0tBF44o5vt7f4aCGXZ8XMVIef1
ABEBAAGJA8QEGAECAA8FAl/9icYCGwIFCQWjmoABqQkQSI/PfDq7NPjA3SAEGQEC
AAYFAl/9icYACgkQUdZkfsIa1upqtQv/R9oLsG3g4Rg2MKDrXYSa94n1CBY5ESDL
1N0mZTWQ5nVdfIWWifnpe72VDBR3Y+r5ootnCHq09DbK+K3q82q2UmGEq968mR96
LKGjWuTS1rY/MCbQbW+jcrnju0T3bCcImggMJoYCzuUnBfIkexObwi/YidqgL92+
nw3NzqeWnq+gu/1Q2ngzhN8Ft4mwOcFr9H0px0476LLvR+7lrSu2HqGeHk+fUA4c
ZNwvsgGYgCAJhz8fPwKCoLrxsE82bkZ86JgUJEcMu0ki4UFo3rg6NmkDwnrYO61l
MOrBCxt/lPJz7d8L9oCLu9pJSBsKH9RNqO10NAoEMppKwnQSz6RQFRJj7WNW+OEs
mjZt7sNrTr0Y+udx58Sqd0C5k7lGUtYWKKGpLfdz0RLnBTTFmjnB3Y2uyOJFc4FS
g251yjk9ds1AFjdRThQ2kFpZzQAo5ei6zMBaZATg0E2uk4HAfpQ58CPGj4f1k3py
1N2hYUA+qksZIVxjFfwYr5LCv4tMZumZl6UP/je7EHh5IGkB1+Bpeyj3dudZblvM
lE6kdGridxInbiJvgqBSdprIksR8wm1Vy/Z1/lHEM6QnUODGyRAbjQHL3kPKloPj
lKr8TNAELbmVTZjBRJowsGw27rhYAaji/qEet/0ALfu2l3QuOQ38dyuPpxlDSTLY
WnajVIgvSJUU3Yl38Lp3UTuHdtdiNWgyHkLOA/11GK14RSWYsjZAamstlSpl24Op
yKLN5z+q4tNAs+tfQrWNRi3SMG7UDroxztJVkHGvuJ2DT/Q6tANigPzipLzSgOIO
8Wa2aQmqtQ4V0eB2S4DxcMckHti3+4fbrzBzeN/PFaIVLwUtdsUdBs+TtSZFdN9e
i0oLUChIYKDvVBGqgmIor6YgenNSSZni3rj+RRA3gQom7jyVrQPgUv7lsv/MLCmg
Ogpibxs3+SDbbZ6tP0D8uxdRnB4NVeENewlqw/ImacgjLtjBHaq+BebjWErIAkdX
VnjWoLdZoV3B4ComKsjFNf7sfbzV/T2Xpg/r/u1WkiSjvD0mkSZ+3seDjd6oL20s
p7jGLnSGZqGsUksJym0tWRvuyspgTELZlcjuMfHKuKmYudYFi+Y48+YsdJ7UetNT
kAIBinjtZwEEAP4GumNNy7f4l4tt1CBy1EgoYtYCcJC5SGyhWMee3L3hLhHe7Iwd
72EHtteVBoVn0eg6
=rEWJ
-----END PGP PUBLIC KEY BLOCK-----
_��localhostpubkeyAlmaLinux <packager@almalinux.org>Public Keys(none)gpg(AlmaLinux <packager@almalinux.org>)gpg(3abb34f8)gpg(c21ad6ea)4.14.34:488fcf7c3abb34f8-5ffd890e4:488fcf7c3abb34f8-5ffd890e4:51d6647ec21ad6ea-5ffd89c6?����7249db0c399640f27958cf967d3b25568bf71a76i0\i0\560)
- tests: add a fuzzer for journald streams (#1764560)
- tests: add a fuzzer for server_process_native_file (#1764560)
- fuzz-journal-stream: avoid assertion failure on samples which don't fit in pipe (#1764560)
- journald: take leading spaces into account in syslog_parse_identifier (#1764560)
- Add a warning about the difference in permissions between existing directories and unit settings. (#1778384)
- execute: remove one redundant comparison check (#1778384)
- core: change ownership/mode of t�x�����`�@�������Xk���������������'�$�����������������'�'�'�_socket.3mysql_get_ssl_cipher.3mysql_hex_string.3mysql_info.3mysql_init.3mysql_kill.3mysql_more_results.3mysql_next_result.3mysql_num_fields.3mysql_num_rows.3mysql_options.3mysql_options4.3mysql_optionsv.3mysql_ping.3mysql_query.3mysql_read_query_result.3mysql_real_connect.3mysql_real_escape_string.3mysql_real_query.3mysql_refresh.3mysql_reset_connection.3mysql_rollback.3mysql_row_seek.3mysql_row_tell.3mysql_select_db.3mysql_send_query.3mysql_server_end.3mysql_server_init.3mysql_session_track_get_first.3mysql_session_track_get_next.3mysql_set_character_set.3mysql_set_server_option.3mysql_shutdown.3mysql_sqlstate.3mysql_ssl_set.3mysql_stat.3mysql_stmt_affected_rows.3mysql_stmt_attr_get.3mysql_stmt_attr_set.3mysql_stmt_bind_param.3mysql_stmt_bind_result.3mysql_stmt_close.3mysql_stmt_data_seek.3mysql_stmt_errno.3mysql_stmt_error.3mysql_stmt_execute.3mysql_stmt_fetch.3mysql_stmt_fetch_column.3mysql_stmt_field_count.3mysql_stmt_free_result.3mysql_stmt_init.3mysql_stmt_insert_id.3mysql_stmt_more_results.3mysql_stmt_next_result.3mysql_stmt_num_rows.3mysql_stmt_param_count.3mysql_stmt_param_metadata.3mysql_stmt_prepare.3mysql_stmt_reset.3mysql_stmt_result_metadata.3mysql_stmt_row_seek.3mysql_stmt_row_tell.3mysql_stmt_send_long_data.3mysql_stmt_sqlstate.3mysql_stmt_store_result.3mysql_stmt_warning_count.3mysql_store_result.3mysql_thread_end.3mysql_thread_id.3mysql_thread_init.3mysql_use_result.3mysql_warning_count.3/usr/local/cpanel/3rdparty/bin//usr/local/cpanel/3rdparty/include/mariadb//usr/local/cpanel/3rdparty/include/mariadb/mariadb//usr/local/cpanel/3rdparty/include/mariadb/mysql//usr/local/cpanel/3rdparty/lib/mariadb//usr/local/cpanel/3rdparty/lib/pkgconfig//usr/local/cpanel/3rdparty//usr/local/cpanel/3rdparty/man//usr/local/cpanel/3rdparty/man/man3/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnuELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3bfe83052af2d52e8ad85c38c87276cf33dd1728, not strippedC source, ASCII textC source, UTF-8 Unicode textcurrent ar archivepkgconfig filedirectorytroff or preprocessor input, ASCII textutf-8557a6d1f5ff7af43ad99cd8b522da01a81a8626ec429f3af4781f5e913853b8d?���@0ܟoqr�t���{l��\10377a95b94d75557f2a0a4943416493308162e526b68a7bf3b7ed8446ce54b45d3ea5292191a398508879f99460ba13a63bfd5ai?��x���������������������X�l�	�����������$�����������������������rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootea-php54-php-5.4.45-82.el8.cloudlinux.3.src.rpm��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������ea-php54-php-develea-php54-php-devel(x86-64)@



/bin/shautoconfautomakeea-php54-php-cli(x86-64)pcre-devel(x86-64)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)1:5.4.45-82.el8.cloudlinux.38.103.0.4-14.6.0-14.0-15.2-14.14.3i��i�5�iM'@i)��h�;@h�C�h�C�ht�@h$��h#4@h#4@g�x@g�x@g�g���g��@g
d�f�X@f`S@f;i@ee�@e\��ej�d�]@d�g�dd��d[�@dJ�c�G�c[�@cMC�bγ�b\@a�@a��a;H�`�]�`�i@`�i@`ٹ�`��`[)�`B@`7�@`�@`��_��_�]@_���_�P�_Wr@_R,@_3�_*�@_�@^��^��^�U@^��@^|�@^{G�^`�^`�^^F�^Y�^��]��]�)�]��]�@]�@]z3@]z3@]o�@]S��]5�@]#0@];�]�]�@\�P�\��@\���\��\�r@\��\^��\Z�@\J�@\J�@\@n@\&@[ٙ@[^��[O+�[D��[3|@[�[{@Z�@Z؄�Z�3@ZԐ@Z�J@Z�&�Z�&�Z���Z��Z���Za�Z`�@ZX�@ZWQ�ZV@ZT��ZT��Z)-@ZN�Y��Y�@Y�Y�A@Y�o@Y�o@Y�3�Y�J�Yw2�YoI�Ycl@YS�@YK�@YJ_�Y;@Y�Y�@Yi@X�:@X��X�C�X��@X��@X��@X�	@X�e@X�@X�@X�@X�6@X[�@X.�@X.�@X-��X)�@X$a@X�@W�W�_@W�v@W��@W�@W��@W��Wu	�Wg�W_�W^�@WYZ@WM|�WE��W3�W�@V��V�&@V��V��@V��@V��@Vr��Vr��Vj��Vh�VE�V��U�U�@U�L@U�n�U�n�U�@Um��Ud`@U:�U@TH�TD�@T3�R��@R��@REs@R8D@R�Q��Q��Q��@Q��@Q��Qy�Qf��Q@j@P��@PѬ@P��P�@P�@P�*�P��@P��@P�)�P�)�P���P���P���P���P���P�5@P{��Px@Pl(�Pj�@Pi��Pi��Pe�@P`K@PY��PY��PY��PXb@PW�PS@P2&�P.2@P	H@O�@O�@O��O��@O�\@O�s@O��@O��@Ov�OtN�OpZ@OpZ@OP�@O?��O-�O�O�@O	�@N��N��N��@N��@N�@NoE�NS�@NL��N7@M���M��M���MT�Mt�Mk�@MfH@MR��M'@M�@M�@Mg�L�8�LΫ�Lʷ@L���LH2�K��@K��@K�C�K�@K
@K��K�@J��@JlE@J_@J_@J\s@JY�@J> �I�'@I��@I��I��@I��@I}��I|T@Iy�@IC��I>]�I:i@I9�I*�@I9@H˫@H�(�H{?�Hv@G��G�Z@Gt�@GV��GV��GV@F��Fڥ�F�@F�S@F�S@F�]�F��Fw�@FiD�FA��F@f@F; @F�@F@Eّ@E�K@E��E�3@Eu_@El$�El$�Ej�@E[@E[@EG:�E#�@D�,@D��@D�b�D�b�D�(@DtJ�Dla�D_2�DX�@D;@C�@C�C�Q@Cˊ�Cǖ@C�
@C��C�f@C�q�C� @C��@C�7@C��@Cs6@CoA�CgX�C(�B�i�B{\@Bwg�Bl�B]	�B]	�B]	�B[�@BZf�BQ,@BM7�BJ��BB��B��x�������������0�����X6�j��������`�EE�����$U����������������EEDEFE�fi: add Bz/gl FW for core93-123 release
- iwlwifi: update ty/So/Ma firmwares for core93-123 release
- iwlwifi: update cc/Qu/QuZ firmwares for core93-82 release
- ASoC: tas2781: Add dsp firmware for new projects
- amdgpu: DMCUB update for DCN401
- ath12k: WCN7850 hw2.0: update board-2.bin
- ath12k: QCN9274 hw2.0: update to WLAN.WBE.1.4.1-00199-QCAHKSWPL_SILICONZ-1
- ath12k: QCN9274 hw2.0: update board-2.bin
- ath11k: WCN6750 hw1.0: update board-2.bin
- ath11k: QCN9074 hw1.0: update to WLAN.HK.2.9.0.1-02146-QCAHKSWPL_SILICONZ-1
- ath11k: QCA6698AQ hw2.1: add to WLAN.HSP.1.1-04479-QCAHSPSWPL_V1_V2_SILICONZ_IOE-1
- ath11k: QCA6698AQ hw2.1: add board-2.bin
- ath11k: QCA6390 hw2.0: update board-2.bin
- ath11k: QCA2066 hw2.1: update to WLAN.HSP.1.1-03926.13-QCAHSPSWPL_V2_SILICONZ_CE-2.52297.6
- ath11k: QCA2066 hw2.1: update board-2.bin
- ath11k: IPQ8074 hw2.0: update to WLAN.HK.2.9.0.1-02146-QCAHKSWPL_SILICONZ-1
- ath11k: IPQ6018 hw1.0: update to WLAN.HK.2.7.0.1-02409-QCAHKSWPL_SILICONZ-1
- copy-firmware: Fix 'No such file or directory' error.
- ath11k: add device-specific firmware for QCM6490 boards
- qca: add more WCN3950 1.3 NVM files
- qca: add firmware for WCN3950 chips
- qca: move QCA6390 firmware to separate section
- qca: restore licence information for WCN399x firmware
- amdgpu: DMCUB updates for various ASICs
- amdgpu: DMCUB updates forvarious AMDGPU ASICs
- Merge https://github.com/quicjathot/bt_msl_fw_1.1.3_00069 into wcn6750
- qca: Update Bluetooth WCN6750 1.1.0-00476 firmware to 1.1.3-00069
- qcom:x1e80100: Support for Lenovo T14s G6 Qualcomm platform
- qcom:x1e80100: Support for Lenovo T14s G6 Qualcomm platform
- linux-firmware: Update FW files for MRVL SD8997 chips
- i915: Update Xe2LPD DMC to v2.27
- Merge https://github.com/vivesahu-qcom/bt_hsp_fw650 into wcn6856
- qca: Update Bluetooth WCN6856 firmware 2.1.0-00642 to 2.1.0-00650
- rtl_bt: Update RTL8852B BT USB FW to 0x049B_5037
- amdgpu: Update ISP FW for isp v4.1.1
- trivial: contrib: wrap the process in try/except to catch server issues
- trivial: contrib: use python-magic to detect encoding of emails
- Merge https://github.com/che-jiang/qca_btfw into qca
- QCA: Add Bluetooth firmware for QCA6698
- amdgpu: revert DMCUB 3.1.4 firmware
- amlogic: update firmware for w265s2
- mediatek MT7925: update bluetooth firmware to 20250113153307
- linux-firmware: update firmware for MT7925 WiFi device
- amdgpu: update psp 13.0.10 firmware
- amdgpu: update gc 11.0.3 firmware
- amdgpu: update psp 13.0.8 firmware
- amdgpu: update psp 13.0.5 firmware
- amdgpu: update vcn 4.0.0 firmware
- amdgpu: update psp 13.0.0 firmware
- amdgpu: update gc 11.0.0 firmware
- amdgpu: update beige goby firmware
- amdgpu: update dimgrey cavefish firmware
- amdgpu: update navy flounder firmware
- amdgpu: update sienna cichlid firmware
- amdgpu: update navi14 firmware
- amdgpu: update smu 14.0.3 firmware
- amdgpu: update psp 14.0.3 firmware
- amdgpu: update gc 12.0.1 firmware
- amdgpu: update navi12 firmware
- amdgpu: update smu 14.0.2 firmware
- amdgpu: update psp 14.0.2 firmware
- amdgpu: update gc 12.0.0 firmware
- amdgpu: update gc 9.4.3 firmware
- amdgpu: update navi10 firmware
- amdgpu: update vcn 4.0.4 firmware
- amdgpu: update psp 13.0.7 firmware
- amdgpu: update gc 11.0.2 firmware
- amdgpu: update yellow carp firmware
- qcom: correct licence information for SA8775P binaries
- qcom: update SLPI firmware for RB5 board
- amdgpu: DMCUB updates for various AMDGPU ASICs
- qcom: add DSP firmware for SA8775p platform
- qcom: correct venus firmware versions
- qcom: add missing version information
- linux-firmware: Update firmware (v10) for mt7988 internal
- iwlwifi: add Bz FW for core90-93 release
- linux-firmware: wilc3000: add firmware for WILC3000 WiFi device
- rtw89: 8852b: update fw to v0.29.29.8
- rtw89: 8852c: update fw to v0.27.122.0
- rtw89: 8922a: update fw to v0.35.54.0
- rtw89: 8922a: update fw to v0.35.52.1 and stuffs
- rtw89: 8852bt: update fw to v0.29.110.0
- rtw89: 8852b: update fw to v0.29.29.7
- amdgpu: DMCUB updates for various AMDGPU ASICs
- amdgpu�x��������������������X��l@��������<L�$,����������������<L;L=L���P���P�5@P{��Px@Pl(�Pj�@Pi��Pi��Pe�@P`K@PY��PY��PY��PXb@PW�PS@P2&�P.2@P	H@O�@O�@O��O��@O�\@O�s@O��@O��@Ov�OtN�OpZ@OpZ@OP�@O?��O-�O�O�@O	�@N��N��N��@N��@N�@NoE�NS�@NL��N7@M���M��M���MT�Mt�Mk�@MfH@MR��M'@M�@M�@Mg�L�8�LΫ�Lʷ@L���LH2�K��@K��@K�C�K�@K
@K��K�@J��@JlE@J_@J_@J\s@JY�@J> �I�'@I��@I��I��@I��@I}��I|T@Iy�@IC��I>]�I:i@I9�I*�@I9@H˫@H�(�H{?�Hv@G��G�Z@Gt�@GV��GV��GV@F��Fڥ�F�@F�S@F�S@F�]�F��Fw�@FiD�FA��F@f@F; @F�@F@Eّ@E�K@E��E�3@Eu_@El$�El$�Ej�@E[@E[@EG:�E#�@D�,@D��@D�b�D�b�D�(@DtJ�Dla�D_2�DX�@D;@C�@C�C�Q@Cˊ�Cǖ@C�
@C��C�f@C�q�C� @C��@C�7@C��@Cs6@CoA�CgX�C(�B�i�B{\@Bwg�Bl�B]	�B]	�B]	�B[�@BZf�BQ,@BM7�BJ��BB��B�B	�@A�@A��A��A�_�A�_�A�_�AJ�AJ�AJ�A@E�A
@Ag@Sergey Fokin <sfokin@cloudlinux.com> - 7.0.33-29.cloudlinux.9Razmik Manvelyan <rmanvelyan@cloudlinux.com> - 1:7.0.33-29.cloudlinux.8Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 1:7.0.33-29.cloudlinux.7Levon Matshkalyan <lmatshkalyan@cloudlinux.com> - 1:7.0.33-29.cloudlinux.6Sergey Fokin <sfokin@cloudlinux.com> - 1:7.0.33-29.cloudlinux.5Razmik Manvelyan <rmanvelyan@cloudlinux.com> - 1:7.0.33-29.cloudlinux.4Arseniy Zolotarev <azolotarev@cloudlinux.com> - 1:7.0.33-29.cloudlinux.3Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 1:7.0.33-29.cloudlinux.2Sergey Fokin <sfokin@cloudlinux.com> - 1:7.0.33-29.cloudlinux.1Levon Matshkalyan <lmatshkalyan@cloudlinux.com> - 7.0.33-29Chris Castillo <chris.castillo@webpros.com> - 7.0.33-28Julian Brown <julian.brown@cpanel.net> - 7.0.33-27Vladimir D. Seleznev <vseleznev@cloudlinux.com> - 7.0.33-26.cloudlinux.13Sergey Fokin <sfokin@cloudlinux.com> - 7.0.33-26.cloudlinux.12Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 7.0.33-26.cloudlinux.11Vladimir D. Seleznev <vseleznev@cloudlinux.com> - 7.0.33-26.cloudlinux.10Azat Nurgaliev <anurgaliev@cloudlinux.com> - 7.0.33-26.cloudlinux.9Azat Nurgaliev <anurgaliev@cloudlinux.com> - 7.0.33-26.cloudlinux.8Lizi Ekseulidze <lekseulidze@cloudlinux.com> - 7.0.33-26.cloudlinux.7Lizi Ekseulidze <lekseulidze@cloudlinux.com> - 7.0.33-26.cloudlinux.6Vladimir D. Seleznev <vseleznev@cloudlinux.com> - 7.0.33-26.cloudlinux.5Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 7.0.33-26.cloudlinux.4Vladimir D. Seleznev <vseleznev@cloudlinux.com> - 7.0.33-26.cloudlinux.3Dmitriy Popov <dpopov@cloudlinux.com> - 7.0.33-26.cloudlinux.2Sergey Fokin <sfokin@cloudlinux.com> - 1:7.0.33-26.cloudlinux.1Tim Mullin <tim@cpanel.net> - 7.0.33-26Dmitriy Popov <dpopov@cloudlinux.com> - 7.0.33-23.cloudlinux.7Nikita Ivanov <nivanov@cloudlinux.com> - 7.0.33-23.cloudlinux.6Nikita Ivanov <nivanov@cloudlinux.com> - 7.0.33-23.cloudlinux.5Pavel Mayorov <pmayorov@cloudlinux.com> - 7.0.33-23.cloudlinux.4Pavel Mayorov <pmayorov@cloudlinux.com> - 7.0.33-23.cloudlinux.3Nikita Ivanov <nivanov@cloudlinux.com> - 7.0.33-23.cloudlinux.2Nikita Ivanov <nivanov@cloudlinux.com> - 7.0.33-23.cloudlinux.1Travis Holloway <t.holloway@cpanel.net> - 7.0.33-23Dan Muey <dan@cpanel.net> - 7.0.33-22Nikita Ivanov <nivanov@cloudlinux.com> - 7.0.33-21.cloudlinux.3Eduard Abdullin <eabdullin@cloudlinux.com> - 7.0.33-21.cloudlinux.2Eduard Abdullin <eabdullin@cloudlinux.com> - 7.0.33-21.cloudlinux.1Travis Holloway <t.holloway@cpanel.net> - 7.0.33-21Eduard Abdullin <eabdullin@cloudlinux.com> - 7.0.33-20.cloudlinux.3Anatholy Scryabin <ascryabin@cloudlinux.com> - 7.0.33-20.cloudlinux.2Cory McIntire <cory@cpanel.net> - 7.0.33-20Eduard Abdullin <eabdullin@cloudlinux.com> - 7.0.33-19.cloudlinux.3Daniil Leonov <dleonov@cloudlinux.com> - 7.0.33-19.cloudlinux.2Eduard Abdullin <eabdullin@cloudlinux.con> - 7.0.33-19.cloudlinux.1Ivan Danilov <idanilov@cloudlinux.com> - 7.0.33-19Ivan Danilov <idanilov@cloudlinux.com> - 7.0.33-16.cloudlinux.7Ivan Danilov <idanilov@cloudlinux.com> - 7.0.33-16.cloudlinux.6Daniel Muey <dan@cpanel.net> - 7.0.33-19Tim Mullin <tim@cpanel.net> - 7.0.33-18Ivan Danilov <idanilov@cloudlinux.com> - 7.0.33-16.cloudlinux.5Nikolai Mikhno <nmikhno@cloudlinux.com> - 7.0.33-16.cloudlinux.4Ivan Danilov <idanilov@cloudlinux.com> - 7.0.33-�x�������������@�������X��l��������������k��${����������������k�j�l��687) (Michal Luscon)
- group: CompsQuery now returns group ids (RhBug:1261656) (Michal Luscon)- fix access to demands (RhBug:1259194) (Jan Silhan)
- make clean_requiremets_on_remove=True (RhBug:1260280) (Jan Silhan)- Fixed typo (RhBug:1249319) (Adam Salih)
- fixed downgrade with wildcard (RhBug:1234763) (Adam Salih)
- reorganize logic of get_best_selector(s) and query (RhBug:1242946) (Adam
  Salih)
- completion_helper: don't crash if exception occurred (RhBug:1225225) (Igor
  Gnatenko)
- base: expire cache if repo is not available (Michal Luscon)
- Don't suggest --allowerasing if it is enabled (Christian Stadelmann)
- translation works in python3 (RhBug:1254687) (Jan Silhan)
- logrotate less often (RhBug:1247766) (Jan Silhan)
- implement dnf mark command (RhBug:1125925) (Michal Luscon)
- groups: use comps data to migrate persistor (Michal Luscon)
- groups: preserve api compatibility (Michal Luscon)
- groups: use persistor data for removing env/group (Michal Luscon)
- persistor: add migration and bump version (Michal Luscon)
- persistor: store name and ui_name of group (Michal Luscon)
- show real metadata timestamp on the server in verbose mode (Jan Silhan)
- lock: make rpmdb lock blocking (RhBug:1210289) (Michal Luscon)- update: installonly pkgs are not shown in both install and skipped section
  (RhBug:1252415) (Jan Silhan)
- output: sort skipped packages (Jan Silhan)
- output: skipped conflicts are set (RhBug:1252032) (Jan Silhan)
- keep the dwongrading package installed if transaction fails (RhBug:1249379)
  (Jan Silhan)
- don't store empty attributes (RhBug:1246928) (Michael Mraka)
- doc: correct dnf.conf man section (RhBug:1245349) (Michal Luscon)- print skipped pkg with broken deps too (Related:RhBug:1210445) (Jan Silhan)
- history: set commands output as default (RhBug:1218401) (Michal Luscon)
- Update es.po. save:guardar -> save:ahorrar (Máximo Castañeda)
- cosmetic: option arg in Base.*install is replaced with strict (Jan Silhan)
- group: don't fail on first non-existing group (Jan Silhan)
- install: skips local pkgs of lower version when strict=0
  (Related:RhBug:1227952) (Jan Silhan)
- install: skip broken/conflicting packages in groups when strict=0 (Jan
  Silhan)
- install: skip broken/conflicting packages when strict=0 (Jan Silhan)
- implemented `strict` config option working in install cmd (RhBug:1197456)
  (Jan Silhan)
- fixed 'dnf --quiet repolist' lack of output (RhBug:1236310) (Nick Coghlan)
- Add support for MIPS architecture (Michal Toman)
- package: respect baseurl attribute in localPkg() (RhBug:1219638) (Michal
  Luscon)
- Download error message is not written on the same line as progress bar
  anymore (RhBug: 1224248) (Adam Salih)
- dnf downgrade does not try to downgrade not installed packages (RhBug:
  1243501) (max9631)
- pkgs not installed due to rpm error are reported (RhBug:1207981) (Adam Salih)
- dnf install checks availability of all given packages (RhBug:1208918) (Adam
  Salih)
- implemented install_weak_deps config option (RhBug:1221635) (Jan Silhan)
- ignore SIGPIPE (RhBug:1236306) (Michael Mraka)
- always add LoggingTransactionDisplay to the list of transaction displays
  (RhBug:1234639) (Radek Holy)
- Add missing FILES section (RhBug: 1225237) (Adam Salih)
- doc: Add yum vs dnf hook information (RhBug:1244486) (Parag Nemade)
- doc: clarify the expected type of the do_transactions's display parameter
  (Radek Holy)
- apichange: add dnf.cli.demand.DemandSheet.transaction_display (Radek Holy)
- apichange: add dnf.callback.TransactionProgress (Radek Holy)
- move the error output from TransactionDisplay into a separate class (Radek
  Holy)
- rename TransactionDisplay.errorlog to TransactionDisplay.error (Radek Holy)
- report package verification as a regular RPM transaction event (Radek Holy)
- rename TransactionDisplay.event to TransactionDisplay.progress (Radek Holy)
- apichange: deprecate dnf.callback.LoggingTransactionDisplay (Radek Holy)
- use both CliTransactionDisplay and demands.transaction_display (Radek Holy)
- apichange: accept multiple displays i�x���������������������X�dl�w������8��������$���������������������- kvm-Disable-AT24Cx-i2c-eeprom.patch [bz#1586357]
- kvm-Disable-CAN-bus-devices.patch [bz#1586357]
- kvm-Disable-new-superio-devices.patch [bz#1586357]
- kvm-Disable-new-pvrdma-device.patch [bz#1586357]
- kvm-qdev-add-HotplugHandler-post_plug-callback.patch [bz#1607891]
- kvm-virtio-scsi-fix-hotplug-reset-vs-event-race.patch [bz#1607891]
- kvm-e1000-Fix-tso_props-compat-for-82540em.patch [bz#1608778]
- kvm-slirp-correct-size-computation-while-concatenating-m.patch [bz#1586255]
- kvm-s390x-sclp-fix-maxram-calculation.patch [bz#1595740]
- kvm-redhat-Make-gitpublish-profile-the-default-one.patch [bz#1425820]
- Resolves: bz#1168213
  (main-loop: WARNING: I/O thread spun for 1000 iterations while doing stream block device.)
- Resolves: bz#1207657
  (RFE: QEMU Incremental live backup - push and pull modes)
- Resolves: bz#1416180
  (QEMU VFIO based block driver for NVMe devices)
- Resolves: bz#1425820
  (Improve QEMU packaging layout with modularization of the block layer)
- Resolves: bz#1482537
  ([RFE] qemu-img copy-offloading (convert command))
- Resolves: bz#1505664
  ("qemu-kvm: System page size 0x1000000 is not enabled in page_size_mask (0x11000). Performance may be slow" show up while using hugepage as guest's memory)
- Resolves: bz#1513543
  ([RFE] Add block job to create format on a storage device)
- Resolves: bz#1518738
  (Add 'copy-on-read' filter driver for use with blockdev-add)
- Resolves: bz#1519144
  (qemu-img: image locking doesn't cover image creation)
- Resolves: bz#1519617
  (The exit code should be non-zero when qemu-io reports an error)
- Resolves: bz#1523065
  ("qemu-img resize" should fail to decrease the size of logical partition/lvm/iSCSI image with raw format)
- Resolves: bz#1525829
  (can not boot up a scsi-block passthrough disk via -blockdev with error "cannot get SG_IO version number: Operation not supported.  Is this a SCSI device?")
- Resolves: bz#1526645
  ([Intel 7.6 FEAT] vHost Data Plane Acceleration (vDPA) - vhost user client - qemu-kvm-rhev)
- Resolves: bz#1527085
  (The copied flag should be updated during  '-r leaks')
- Resolves: bz#1527898
  ([RFE] qemu-img should leave cluster unallocated if it's read as zero throughout the backing chain)
- Resolves: bz#1528541
  (qemu-img check reports tons of leaked clusters after re-start nfs service to resume writing data in guest)
- Resolves: bz#1533158
  (QEMU support for libvirtd restarting qemu-pr-helper)
- Resolves: bz#1535914
  (Disable io throttling for one member disk of a group during io will induce the other one hang with io)
- Resolves: bz#1537956
  (RFE: qemu-img amend should list the true supported options)
- Resolves: bz#1542080
  (Qemu core dump at cirrus_invalidate_region)
- Resolves: bz#1549654
  (Reject node-names which would be truncated by the block layer commands)
- Resolves: bz#1556678
  (Hot plug usb-ccid for the 2nd time with the same ID as the 1st time failed)
- Resolves: bz#1557995
  (QAPI schema for RBD storage misses the 'password-secret' option)
- Resolves: bz#1558723
  (Create RHEL-7.6 QEMU machine type for AArch64)
- Resolves: bz#1560847
  ([Power8][FW b0320a_1812.861][rhel7.5rc2 3.10.0-861.el7.ppc64le][qemu-kvm-{ma,rhev}-2.10.0-21.el7_5.1.ppc64le] KVM guest does not default to ori type flush even with pseries-rhel7.5.0-sxxm)
- Resolves: bz#1564576
  (Pegas 1.1 - Require to backport qemu-kvm patch that fixes expected_downtime calculation during migration)
- Resolves: bz#1566153
  (IOERROR pause code lost after resuming a VM while I/O error is still present)
- Resolves: bz#1567733
  (qemu abort when migrate during guest reboot)
- Resolves: bz#1569835
  (qemu-img get wrong backing file path after rebasing image with relative path)
- Resolves: bz#1572851
  (Core dumped after migration when with usb-host)
- Resolves: bz#1572856
  ('block-job-cancel' can not cancel a "drive-mirror" job)
- Resolves: bz#1574216
  (CVE-2018-3639 qemu-kvm-rhev: hw: cpu: speculative store bypass [rhel-7.6])
- Resolves: bz#1575541
  (qemu core dump while installing win10 guest)
- Resolves: bz#1576598
  (Segfault in qem�x������������� ��������X�Bl��HR������"��$2����������������"�#�!�� kvm-target-i386-properly-reset-TSC-on-reset.patch [bz#2070417]
- kvm-ui-cursor-fix-integer-overflow-in-cursor_alloc-CVE-2.patch [bz#2040734]
- Resolves: bz#2065043
  (Remove upstream-only devices from the qemu-kvm binary)
- Resolves: bz#2070417
  (Windows guest hangs after updating and restarting from the guest OS [rhel-8.7.0])
- Resolves: bz#2040734
  (CVE-2021-4206 virt:rhel/qemu-kvm: QEMU: QXL: integer overflow in cursor_alloc() can lead to heap buffer overflow [rhel-8.7])- kvm-s390x-ipl-support-extended-kernel-command-line-size.patch [bz#2043830]
- kvm-virtio-net-fix-map-leaking-on-error-during-receive.patch [bz#2063206]
- kvm-qcow2-Improve-refcount-structure-rebuilding.patch [bz#1519071]
- kvm-iotests-108-Test-new-refcount-rebuild-algorithm.patch [bz#1519071]
- kvm-qcow2-Add-errp-to-rebuild_refcount_structure.patch [bz#1519071]
- kvm-iotests-108-Fix-when-missing-user_allow_other.patch [bz#1519071]
- Resolves: bz#2043830
  ([IBM 8.7 FEAT] KVM: Allow long kernel command lines for QEMU)
- Resolves: bz#2063206
  (CVE-2022-26353 virt:rhel/qemu-kvm: QEMU: virtio-net: map leaking on error during receive [rhel-8])
- Resolves: bz#1519071
  (Fail to rebuild the reference count tables of qcow2 image on host block devices (e.g. LVs))- kvm-display-qxl-render-fix-race-condition-in-qxl_cursor-.patch [bz#2040738]
- kvm-vhost-vsock-detach-the-virqueue-element-in-case-of-e.patch [bz#2063262]
- Resolves: bz#2040738
  (CVE-2021-4207 virt:rhel/qemu-kvm: QEMU: QXL: double fetch in qxl_cursor() can lead to heap buffer overflow [rhel-8])
- Resolves: bz#2063262
  (CVE-2022-26354 virt:rhel/qemu-kvm: QEMU: vhost-vsock: missing virtqueue detach on error can lead to memory leak [rhel-8])- kvm-hw-intc-arm_gicv3-Check-for-MEMTX_OK-instead-of-MEMT.patch [bz#1999236]
- kvm-softmmu-physmem-Simplify-flatview_write-and-address_.patch [bz#1999236]
- kvm-softmmu-physmem-Introduce-MemTxAttrs-memory-field-an.patch [bz#1999236]
- Resolves: bz#1999236
  (CVE-2021-3750 virt:rhel/qemu-kvm: QEMU: hcd-ehci: DMA reentrancy issue leads to use-after-free [rhel-8])- kvm-RHEL-disable-seqpacket-for-vhost-vsock-device-in-rhe.patch [bz#2068202]
- kvm-block-Lock-AioContext-for-drain_end-in-blockdev-reop.patch [bz#2067118]
- kvm-iotests-Test-blockdev-reopen-with-iothreads-and-thro.patch [bz#2067118]
- kvm-s390x-css-fix-PMCW-invalid-mask.patch [bz#2071070]
- kvm-Set-permission-on-installing-files.patch [bz#2072377]
- Resolves: bz#2068202
  (RHEL 9.0 guest with vsock device migration failed from RHEL 9.0 > RHEL 8.6 [rhel-8.7.0])
- Resolves: bz#2067118
  (qemu crash after execute blockdev-reopen with  iothread)
- Resolves: bz#2071070
  (s390x/css: fix PMCW invalid mask)
- Resolves: bz#2072377
  (Fix build warnings that occur when installing the keymap files)- kvm-Revert-redhat-Add-hw_compat_4_2_extra-and-apply-to-u.patch [bz#2062613]
- kvm-Revert-redhat-Enable-FDC-device-for-upstream-machine.patch [bz#2062613]
- kvm-Revert-redhat-Expose-upstream-machines-pc-4.2-and-pc.patch [bz#2062613]
- kvm-hw-virtio-vdpa-Fix-leak-of-host-notifier-memory-regi.patch [bz#2060843]
- kvm-pci-expose-TYPE_XIO3130_DOWNSTREAM-name.patch [bz#2062610]
- kvm-acpi-pcihp-pcie-set-power-on-cap-on-parent-slot.patch [bz#2062610]
- kvm-vmxcap-Add-5-level-EPT-bit.patch [bz#2065207]
- kvm-i386-Add-Icelake-Server-v6-CPU-model-with-5-level-EP.patch [bz#2065207]
- kvm-acpi-fix-QEMU-crash-when-started-with-SLIC-table.patch [bz#2062611]
- kvm-tests-acpi-whitelist-expected-blobs-before-changing-.patch [bz#2062611]
- kvm-tests-acpi-add-SLIC-table-test.patch [bz#2062611]
- kvm-tests-acpi-SLIC-update-expected-blobs.patch [bz#2062611]
- kvm-tests-acpi-manually-pad-OEM_ID-OEM_TABLE_ID-for-test.patch [bz#2062611]
- kvm-tests-acpi-whitelist-nvdimm-s-SSDT-and-FACP.slic-exp.patch [bz#2062611]
- kvm-acpi-fix-OEM-ID-OEM-Table-ID-padding.patch [bz#2062611]
- kvm-tests-acpi-update-expected-blobs.patch [bz#2062611]
- kvm-tests-acpi-test-short-OEM_ID-OEM_TABLE_ID-values-in-.patch [bz#2062611]
- kvm-rhel-workaround-for-lack-of-binary-patches-in-SRPM.patch [bz#2062611]
- Resolves: bz#2062613
  (Rev�x����������������������X��k��������X�"�$2����������������"#r from upstream: HTML-Form 6.04- Update from upstream: HTML-Form 6.03	6.126.126.126.126.126.126.126.126.126.12-1.cp130~el86.126.126.126.126.126.126.126.126.126.126.126.126.126.126.126.126.12Form.pmFileInput.pmIgnoreInput.pmImageInput.pmInput.pmKeygenInput.pmListInput.pmSubmitInput.pmTextInput.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/HTML//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/HTML/Form/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-81185d60974d6ed5b7040ef7dcd339d7f71e30e6ae58c6b777bc2876e7ce92f4a?����E��<Rq	���+��k��7c525d03c2f6ba5d5361e3d53ba0774661bfe41a4438e22c6b6b35008623686f8952945e425665836f3899e1f63dc7fefb7c7da1i?�w˴i?�slx5e: Alloc flow spec using kvzalloc instead of kzalloc (Alaa Hleihel) [1915308]
- net/mlx5: Avoid unnecessary operation (Alaa Hleihel) [1915308]
- net/mlx5e: rep: Improve reg_cX conditions (Alaa Hleihel) [1915308]
- net/mlx5: SF, Fix return type (Alaa Hleihel) [1915308]
- net/mlx5e: mlx5_tc_ct_init does not fail (Alaa Hleihel) [1915308]
- net/mlx5: Fix indir stable stubs (Alaa Hleihel) [1915308]
- net/mlx5e: Add missing include (Alaa Hleihel) [1915308]
- net/mlx5e: fix mlx5e_tc_tun_update_header_ipv6 dummy definition (Alaa Hleihel) [1915308]
- net/mlx5e: CT, Avoid false lock dependency warning (Alaa Hleihel) [1915308]
- net/mlx5: Check returned value from health recover sequence (Alaa Hleihel) [1915308]
- net/mlx5: Don't rely on interface state bit (Alaa Hleihel) [1915308]
- net/mlx5: Remove second FW tracer check (Alaa Hleihel) [1915308]
- net/mlx5: Separate probe vs. reload flows (Alaa Hleihel) [1915308]
- net/mlx5: Remove impossible checks of interface state (Alaa Hleihel) [1915308]
- net/mlx5: Don't skip vport check (Alaa Hleihel) [1915308]
- net/mlx5e: Register nic devlink port for SF ports (Alaa Hleihel) [1915308]
- vdpa/mlx5: Retrieve BAR address suitable any function (Alaa Hleihel) [1915308]
- vdpa/mlx5: Use the correct dma device when registering memory (Alaa Hleihel) [1915308]
- net/mlx5: SF, Extend SF table for additional SF id range (Alaa Hleihel) [1915308]
- net/mlx5: SF, Split mlx5_sf_hw_table into two parts (Alaa Hleihel) [1915308]
- net/mlx5: SF, Use helpers for allocation and free (Alaa Hleihel) [1915308]
- net/mlx5: SF, Consider own vhca events of SF devices (Alaa Hleihel) [1915308]
- net/mlx5: SF, Store and use start function id (Alaa Hleihel) [1915308]
- net/mlx5: SF, Rely on hw table for SF devlink port allocation (Alaa Hleihel) [1915308]
- net/mlx5: E-Switch, Consider SF ports of host PF (Alaa Hleihel) [1915308]
- net/mlx5: E-Switch, Use xarray for vport number to vport and rep mapping (Alaa Hleihel) [1915308]
- net/mlx5: E-Switch, Prepare to return total vports from eswitch struct (Alaa Hleihel) [1915308]
- net/mlx5: E-Switch, Return eswitch max ports when eswitch is supported (Alaa Hleihel) [1915308]
- net/mlx5: SF, Reuse stored hardware function id (Alaa Hleihel) [1915308]
- net/mlx5: SF, Use device pointer directly (Alaa Hleihel) [1915308]
- net/mlx5: E-Switch, Initialize eswitch acls ns when eswitch is enabled (Alaa Hleihel) [1915308]
- net/mlx5: E-Switch, Move legacy code to a individual file (Alaa Hleihel) [1915308]
- net/mlx5: E-Switch, Convert a macro to a helper routine (Alaa Hleihel) [1915308]
- net/mlx5: E-Switch Make cleanup sequence mirror of init (Alaa Hleihel) [1915308]
- net/mlx5: E-Switch�x�������������p��������X��k��������������ѧ�$A����������������ѧ50ҧ�at.com> - 1.25.92-2Kalev Lember <klember@redhat.com> - 1.25.92-1Kalev Lember <klember@redhat.com> - 1.25.91-1Ondrej Holy <oholy@redhat.com> - 1.25.90-3Ondrej Holy <oholy@redhat.com> - 1.25.90-2Kalev Lember <klember@redhat.com> - 1.25.90-1Ondrej Holy <oholy@redhat.com> - 1.25.4.1-1Ondrej Holy <oholy@redhat.com> - 1.25.4-1Kalev Lember <klember@redhat.com> - 1.25.3-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.25.2-3Ondrej Holy <oholy@redhat.com> - 1.25.2-2Kalev Lember <kalevlember@gmail.com> - 1.25.2-1Kalev Lember <kalevlember@gmail.com> - 1.25.1-1Kalev Lember <kalevlember@gmail.com> - 1.24.1-1Kalev Lember <kalevlember@gmail.com> - 1.24.0-1Kalev Lember <kalevlember@gmail.com> - 1.23.92-1Till Maas <opensource@till.name> - 1.23.90-2Richard Hughes <rhughes@redhat.com> - 1.23.90-1Peter Robinson <pbrobinson@fedoraproject.org> 1.23.4-5Peter Robinson <pbrobinson@fedoraproject.org> 1.23.4-4Richard Hughes <rhughes@redhat.com> - 1.23.4-1Richard Hughes <rhughes@redhat.com> - 1.23.3-1Kalev Lember <kalevlember@gmail.com> - 1.23.2-1Vadim Rutkovsky <vrutkovs@redhat.com> - 1.22.2-3Adrian Reber <adrian@lisas.de> - 1.22.2-2Kalev Lember <kalevlember@gmail.com> - 1.22.2-1Peter Robinson <pbrobinson@fedoraproject.org> 1.22.1-2Kalev Lember <kalevlember@gmail.com> - 1.22.1-1Kalev Lember <kalevlember@gmail.com> - 1.22.0-1Kalev Lember <kalevlember@gmail.com> - 1.21.92-1Kalev Lember <kalevlember@gmail.com> - 1.21.91-1Kalev Lember <kalevlember@gmail.com> - 1.21.90-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.21.4-2Kalev Lember <kalevlember@gmail.com> - 1.21.4-1Richard Hughes <rhughes@redhat.com> - 1.21.3-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.21.2-2Kalev Lember <kalevlember@gmail.com> - 1.21.2-1Peter Robinson <pbrobinson@fedoraproject.org> 1.21.1-2Richard Hughes <rhughes@redhat.com> - 1.21.1-1Richard Hughes <rhughes@redhat.com> - 1.20.1-1Kalev Lember <kalevlember@gmail.com> - 1.20.0-1Richard Hughes <rhughes@redhat.com> - 1.19.90-1Ondrej Holy <oholy@redhat.com> - 1.19.5-2Richard Hughes <rhughes@redhat.com> - 1.19.5-1Dan Horák <dan[at]danny.cz> - 1.19.4-2Richard Hughes <rhughes@redhat.com> - 1.19.4-1Richard Hughes <rhughes@redhat.com> - 1.19.3-1Adrian Reber <adrian@lisas.de> - 1.19.2-2Richard Hughes <rhughes@redhat.com> - 1.19.2-1Richard Hughes <rhughes@redhat.com> - 1.19.1-1Ondrej Holy <oholy@redhat.com> - 1.18.2-1Kalev Lember <kalevlember@gmail.com> - 1.18.1-1Rex Dieter <rdieter@fedoraproject.org> 1.18.0-2Kalev Lember <kalevlember@gmail.com> - 1.18.0-1Kalev Lember <kalevlember@gmail.com> - 1.17.91-3Matthias Clasen<mclasen@redhat.com> - 1.17.91-2Kalev Lember <kalevlember@gmail.com> - 1.17.91-1Kalev Lember <kalevlember@gmail.com> - 1.17.90-1Kalev Lember <kalevlember@gmail.com> - 1.17.3-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.17.2-3Bastien Nocera <bnocera@redhat.com> 1.17.2-2Kalev Lember <kalevlember@gmail.com> - 1.17.2-1Kalev Lember <kalevlember@gmail.com> - 1.17.1-1Kalev Lember <kalevlember@gmail.com> - 1.17.0-2Kalev Lember <kalevlember@gmail.com> - 1.17.0-1Richard Hughes <rhughes@redhat.com> - 1.16.1-1Tomas Bzatek <tbzatek@redhat.com> - 1.16.0-1Peter Robinson <pbrobinson@fedoraproject.org> 1.15.4-2Richard Hughes <rhughes@redhat.com> - 1.15.4-1Tomas Bzatek <tbzatek@redhat.com> - 1.15.3-2Tomas Bzatek <tbzatek@redhat.com> - 1.15.3-1Tomas Bzatek <tbzatek@redhat.com> - 1.15.2-1Adrian Reber <adrian@lisas.de> - 1.15.1-3Tomas Bzatek <tbzatek@redhat.com> - 1.15.1-2Tomas Bzatek <tbzatek@redhat.com> - 1.15.1-1Tomas Bzatek <tbzatek@redhat.com> - 1.15.0-3Tomas Bzatek <tbzatek@redhat.com> - 1.15.0-2Tomas Bzatek <tbzatek@redhat.com> - 1.15.0-1Tomas Bzatek <tbzatek@redhat.com> - 1.14.0-1Matthias Clasen <mclasen@redhat.com> - 1.13.9-1Tomas Bzatek <tbzatek@redhat.com> - 1.13.8-1Tomas Bzatek <tbzatek@redhat.com> - 1.13.7-3Cosimo Cecchi <cosimoc@redhat.com> - 1.13.7-2Richard Hughes <hughsient@gmail.com> - 1.13.7-1Richard Hughes <hughsient@gmail.com> - 1.13.4-1Jindrich�x����� Sx��������X��lX���������������$f������������������?�?d��"�&�	2�	n���������	����� $	&
(,m
pty~��4�(�89:�G�H�I�X�Y�\�]�^�b/de�f�l�t�u�v��������(,
<e����g�h�Ccpanel-perl-542-digest-perl-md51.91.cp130~el8CPAN module - Perl Implementation of Rivest's MD5 algorithmCpanel build perl module 'Digest::Perl::MD5'Perl Implementation of Rivest's MD5 algorithmh�bh-centos-8.dev.cpanel.net1�perlcpanel/perlhttps://metacpan.orglinuxnoarch1ځ$R��r2332e3500d52bca8536d5b80f7b1862f66d84bbd6f4d107a6c61db7ce2c64b1drootrootcpanel-perl-542-digest-perl-md5-1.9-1.cp130~el8.src.rpm����cpanel-perl(Digest::Perl::MD5)cpanel-perl-542-digest-perl-md5cpanel-perl-digest-perl-md5




cpanel-perl-542cpanel-perl-542-exporterrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h?�b�@`-@S>��Q+R@Busy Camels <bc@cpanel.net> - 1.9-1.cp130Busy Camels <bc@cpanel.net> - 1.9-1.cp108Busy Camels <bc@cpanel.net> - 1.9-1.cp1198Todd Rinaldo <toddr@cpanel.net> - 1.9-1.cp1146Todd Rinaldo <toddr@cpanel.net> - 1.8-1.cp1136- Bump to 1.cp130 for re-build- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Digest-Perl-MD5 1.9- Update from upstream: Digest-Perl-MD5 1.81.91.9-1.cp130~el81.9MD5.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Digest/Perl/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-898d9ea921bd76c1d0c8a09e2e911a55ea6889721078e6b8b863fe426ad3ecb1b?������lֲ���}m��M�0326512ae58ce1533e72fa560b890df2b1c635ee9597595922053e0d775e4efa33f4a23204a910484f142a087fc0a1f18779b6fei?�w3i?�soexist on Spectrum>=2 (Ivan Vecera) [1941938]
- mlxsw: Add struct mlxsw_sp_switchdev_ops per ASIC (Ivan Vecera) [1941938]
- mlxsw: spectrum: Add mlxsw_sp_port_egress_ethtype_set() (Ivan Vecera) [1941938]
- mlxsw: reg: Add Switch Port Egress VLAN EtherType Register (Ivan Vecera) [1941938]
- mlxsw: reg: Add egr_et_set field to SPVID (Ivan Vecera) [1941938]
- selftests: mlxsw: Test egress sampling limitation on Spectrum-1 only (Ivan Vecera) [1941938]
- selftests: mlxsw: Add tc sample tests for new triggers (Ivan Vecera) [1941938]
- mlxsw: spectrum_acl: Offload FLOW_ACTION_SAMPLE (Ivan Vecera) [1941938]
- mlxsw: core_acl_flex_actions: Add mirror sampler action (Ivan Vecera) [1941938]
- mlxsw: spectrum_matchall: Add support for egress sampling (Ivan Vecera) [1941938]
- mlxsw: spectrum: Start using sampling triggers hash table (Ivan Vecera) [1941938]
- mlxsw: spectrum: Track sampling triggers in a hash table (Ivan Vecera) [1941938]
- mlxsw: spectrum_matchall: Pass matchall entry to sampling operations (Ivan Vecera) [1941938]
- mlxsw: spectrum_matchall: Push sampli�x�������������`p�������X��l8I������`{�������-�$t�����������������-)�AT?�d����	*�	A�`�d�����	��������P�	<�	
2�
(���O�
�L��8�����8��$�<�X�(�'8�0)9��):�g)>�QG�\�H�H�I�4�X�0Y�4\�H�]�4�^�Fb��d�4e�9f�<l�>t�X�u�D�v0�h�l�r����
��HL�HgLhPCcpanel-geoipfree-data130.41.cp130~el8IP to country databaseIP to country lookup databasei£bh-centos-8.dev.cpanel.net��NcPanelApplications/Filehttps://cpanel.netlinuxnoarch/usr/local/cpanel/3rdparty/bin/perl -MWhostmgr::Exim::BlockedCountries -e 'Whostmgr::Exim::BlockedCountries::_rebuild_blocked_country_ips()' ||:@-�&D�����m#ۂ�,�'�p���(n������9�	���M�
t�
	E�5�eQ��PYmw'
|��M&l�y�T0��	����$��/$AN/�e�T��Iz�X���_�H��`
wc����b�� �
�8�v���4z�s���_��-�:��*�|t�]�0��7�
�!������>TU<	��4�{Mcnj�K�
��6I	_���}��j�|���o	p`��F	f��]G�i�6�_"���q#$�Hs�r��U��Z�G+R*{;v3�K�=^-��kyk���uaO�PB�WMr	�����9a��,B�)�{��o�E
�]�h
�����U�}\-�!�<
:�
s
����]��b�A�*�I�� �@�1�'�1@��	@J��  �8�%�`D �@%�! �@� 1�@``@@=�<@�@��&`+@�����J �@
@�`@�@
۠	`�
 J @\��@Z� `z���` �
��  s�@8�`
�*�  ���`�?��	@���-@f ��@ � � E@S��.��@ 6@��j�A�@
 ���< ����0�
�/��`
 ǀ�@�` <@�j@ 	@��  @6��� 
��(�+`�@#�9 � ��@���	`w9@�`&`'�G��
 �����ޠ`U`%��`:@<��� x�q���`��Π� �����@ 
��
�#��$�	� � �`��
�@�@� -�)`��``X� $A� �s����	�`	@� ��@�����A큤����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������A큤���������������������������������������������������������������������������������������������������������������������������������������������������x�������������h_�������X��l�|���������4�����$w�����������������4�4�VZ�?V�d��	��	�	[��������$�(�	Z�u�����d��&(&	t&
�&X&
�&
$&�&z&
8
T&
���(/)6*#++,4-88<Y9�Y:%<Y>H&?H.@H6BH>DHeGHp&HI&II�&XI�YI�ZI�[J\J&]J�&^L�bO#dPsePxfP{lP}tP�&uQ0&vQ�wT�&xUT&yU��VL�VP�VV�V�V�V��XfXv�
Z,ZU�Z�Z�&Z�gZ�hZ�Coddjob0.34.73.el8A D-Bus service which runs odd jobs on behalf of client applicationsoddjob is a D-Bus service which performs particular tasks for clients which
connect to it and issue requests using the system-wide message bus.d(y�x64-builder01.almalinux.org��AlmaLinuxAlmaLinuxBSDAlmaLinux Packaging Team <packager@almalinux.org>System Environment/Daemonshttps://pagure.io/oddjoblinuxx86_64if test $1 -eq 1 ; then
	killall -HUP dbus-daemon 2>&1 > /dev/null
fi

if [ $1 -eq 1 ] ; then 
        # Initial installation 
        systemctl --no-reload preset oddjobd.service &>/dev/null || : 
fi
if [ $1 -eq 0 ] ; then 
        # Package removal, not upgrade 
        systemctl --no-reload disable --now oddjobd.service &>/dev/null || : 
fi 

exit 0
if [ $1 -ge 1 ] ; then 
        # Package upgrade, not uninstall 
        systemctl try-restart oddjobd.service &>/dev/null || : 
fi 

exit 0	}:���""Q6��,l^�����P�K����A큤A큤��A�A�A���A���A큤����������A�A�A�A큤A큤A�A�A�큤��������d(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�_י_י_י_יd(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�d(y�a5c409ac60b4ec97dd713e986dec730a2fd3ef32577eaf4f3b99284c27b0231f263bbda0c8a5e0009fc8a114c7f583a75f6cb20c7df40d45d053063f383a72ed619e292279f79ef544514c6d871c8bf0c38c2474691cc03ee27351f315242e0d2ca72fd13bf64231f93d9df7484b076335333f200c4674f6260aeec360cecf27cff9a438ff5bf53ef42ba5253eab5b06591a0bd2ed0255e1d54ed33ea340da5aead4d699b92990097bec2ccc47c8e4e4985816eeb21c530b010b9d3f8538a3d3e352f11356ea2ad5645acf96d223b974fdfe6d76485418df9f0b4bf332f277923b7b49ce60085af463c4d84189b92010bb1aa7cf00384e51c5bff30aec7d0652dab319b7625c612b7234915a165e5df2cc6550de2ce779758b587110fc2773ef3fe17a914f89553b5fb9108f5b1551bd06aacf71c1cde5a04473e97cb45879f935981c3b633f1cbca6e51a1592e4a02d96b0682930f6f9f0c34a903e43d9078d7c91591923c949e2d1179c14db17446bd44a92730e524b12d76c3ed5f6de1cdf9f49b15d78a6ee5ff5d86e9e7e05743812323d7dab3c974e0a8d34952318a896c5d3b20bc030a8acad775822cb6ec24a7096e1099570b7416fc9612ba544d699587f11541a0f7ce15fd4da0834311035c531f56e5e05a07697637598d0839b73d847cbb3df8c14f11d27ffb8c40919b800b668081780ad0f3c2871809a2d9554a8f5ab3076d880e848e62a90f268503b4b5e9f7e55e34244d1cfeea4a3043a6fec142dcf94b966a9a4a3160e11e04f026a18e47be7fdcb26796a53ade99afc0133e1e3e58a7de26c464f81ca3ffe63c7a1d831187bcd1dfb36855a892fe6643309d1bbfa64f775388ccb721aacbb9f77f1bd1fe3abcdb32d75dc87e45a3d0e9eb�x������A�������N�������XTpm�/������X\���������$��������������������	
���������������xsgbVQE@4/#
���������������ythcWRFA50$�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
z
u
i
d
X
S
G
B
6
1
%
 



���������������{vjeYTHC72&!���������������|wkfZUID83'"�
�
�
�
�
�
�
�
�
�
�
�
�
�
}
x
l
g
[
V
J
E
9
4
(
#




�	�	�	�	�	�	�	�	�	�	�	�	�	�	~	y	m	h	\	W	K	F	:	5	)	$					��������������zni]XLG;6*%>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`�>[;�ph`��+}����A��|J����x�����q�����u��p��>[;h5$���맏��+}#0��+}�8��q�s�$6��+}������^��!�>[;4	R��q�M����u�T��$�`�$�f�o���4�O�w	�`-�� ���B��������+}N���+}��q���=��+}�
�>[;�)�>[;`<,����06�
�q�`M�^�>[;
3C��$�a��c�>[;n'�3�O�w
�4��+}6H��q�<��8�>[;}j�<���@<;���^'l��>[; ^�G��7pX�>[;�|��q�T�R�>[;�1�>��������oV�/��>[;��H��+}����+}c���q����]�����)z>[;M�(xG���/v>[; L/s>[;�0�Yn>[;�$�4i�+}��c�+}��
b�q����raE�17H`	>[;uO�_��h+Z�DttY>[;�|1XG���Dt"V���=�IPVg�d��8K�oV/�H�Â*��F�+}�<C�+}tB�q�AA��AE�1�%t@	���˪��:>[;$�;8&�)�6>[;�Ƞ3�f#����*>[;� �()�+}�
�(�q���K&�+}5�#�+}Y<"�q��?�!>[;�7�<���Ԩ�5�@����>[;}
����a�8>[;�D�����>[;+x;�+}�
��q��tD>[;�pPN�+}p��+}�T2�q�ۺ��x�����`�X>�������XC�k��������@S������P������$@����������������P�֧Q��g a question
- Enable tar+xz in the archive mounter- Fix gedit crashed with SEGV in strlen()
- Fix SMB protocol not handled when opening from a bookmark (#509832)- Update to 1.3.3- Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Update to 1.3.2
- Drop upstreamed patches- Bump version requirements
- Backport FTP and Computer backend patches from master- Update to 1.3.1
- Drop obsolete patches- Move bash-completion out of profile.d (#466883)- SFTP: Increase timeout (#504339)- Update to 1.2.3
- Prevent deadlocks in dnssd resolver (#497631)- Require separate libtalloc to fix libsmbclient
- Ref the infos in next_files_finish (gnome #582195)
- FTP: parse file sizes > 4GB correctly (#499286)
- CDDA: allow query well-formed filenames only (#499266)- Don't show drives that are supposed to be hidden (#498649)
- Only automount if media or drive was just inserted - this fixes
  a problem with spurious automounts when partitioning/formatting- Sync with the gdu-volume-monitor branch- Add ssh-auth-sock patch from svn- Update to 1.2.2
- Allow eject even on non-ejectable devices- Don't show drives in computer:/// if media is available but
  no volumes are recognized (#495152)- No need for bash completion to be executable- Clean up gdu patches and bump BR for gdu to 0.3
- Avoiding showing volume for ignored mounts (#495033)- Avoid automounting device-mapper devices and similar (#494144)- Update to 1.2.1- GNOME #575728 - crash in Open Folder: mounting a crypto volume- Update to 1.2.0- Fix 100% cpu usage when connecting to a ssh key and denying key access
- Fix monitors leak- Update to 1.1.8- Expose device file attribute for all items in computer://- Fix volume lists not filled correctly- Update GVfs gdu patch to fix mount detection confusion (#488399)- Port to DeviceKit-disks- Update to 1.1.7- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Update to 1.1.6- Update to 1.1.5- ObexFTP write support- Update to 1.1.4- Rebuild for libcdio-0.81- Fix dav+sd.mount- Support moving files in the burn backend- Update to 1.1.3- Update the smb-browse auth patch- Update to 1.1.2- FTP: Fix PASV connections- Add support for .tar.lzma archives in archive mounter- Added experimental smb-browse auth patch- Update file lists to include the dav+sd backend- Update to 1.1.1- Update to 1.0.3- SMB: timestamp setting support (#461505)- Return an empty array on success when no content type
  matches (#468946)- Don't return generic fallback icons for files,
  as this means custom mimetypes don't work (from svn)- Update to 1.0.2- Don't make warnings fatal (resolves #465693)- Add patch for reverse mapping FUSE paths (bgo #530654)- Fix mounting- Update obexftp patch from upstream- Update to 1.0.1- Update to 1.0.0- Update patch for missing file- Updated patch, fixed deadlock whilst mounting- Actually apply the kerberos patch- SMB: Fix kerberos authentication- Update to 0.99.8- Update for BlueZ and obex-data-server D-Bus API changes- Rebuild- Somebody made the build system be obnoxious and point out my
  errors in obvious ways- Update to 0.99.7.1- Update to 0.99.6- Add a comma- Update some descriptions- Update to 0.99.5- Update to 0.99.4- Use standard icon names- Update to 0.99.3- Update to 0.99.2
- Split out backends to separate packages- gvfsd-trash: Skip autofs mounts- Fix transfer of whole directories from FTP (#448560)- Update to 0.99.1- Update to 0.2.4- Add application/zip to the supported mime types for the archive
  backend (launchpad #211697)- Ensure archive mounts are read-only and turn on thumbnailing on them
- Update fuse threading patch- Fix thread-safety issues in gvfs-fuse-daemon
- Prevent dbus from shutting us down unexpectedly- Put X-Gnome-Vfs-System=gio into mount-archarive.desktop (See #442835)- Reenable gphoto automounting 
- Support unmounting all mounts for a scheme- Fix hangs when unmounting gphoto mounts- Only show mounts in /media and inside $HOME (#442189)- Fix a bug that causes application cr�x�������������@.�������X��l��������H�%L�$5����������������%L$L&L�php.conf to allow MultiViews managed by php scripts- update to 5.4.10
- remove patches merged upstream
- drop "Configure Command" from phpinfo output
- prevent php_config.h changes across (otherwise identical)
  rebuilds- update to 5.4.9- fix php.conf- filter private shared in _httpd_modir
- improve system libzip patch to use pkg-config
- use _httpd_contentdir macro and fix php.gif path
- switch back to upstream generated scanner/parser
- use system pcre only when recent enough- improves php.conf, no need to be relocated- clarify Licenses
- missing provides xmlreader and xmlwriter
- change php embedded library soname version to 5.4- fix mysql_sock macro definition- fix standard build (non scl)- fix installed headers- use libldap_r for ldap extension- add missing scl_prefix in some provides/requires- make php-enchant optionnal, not available on RHEL-5
- make php-recode optionnal, not available on RHEL-5
- disable t1lib on RHEL-5- enable tidy on RHEL-6 only
- re-enable unit tests- minor macro fixes for RHEL-5 build
- update autotools workaround for RHEL-5
- use readline when libedit not available (RHEL-5)- update to 5.4.8
- define both session.save_handler and session.save_path
- fix possible segfault in libxml (#828526)
- use SKIP_ONLINE_TEST during make test
- php-devel requires pcre-devel and php-cli (instead of php)
- provides php-phar
- update systzdata patch to v10, timezone are case insensitive- php-fpm: create apache user if needed
- php-cli: provides cli command in standard root (scl)- add configtest option to init script
- test configuration before service reload
- fix php-fpm service relocation
- fix php-fpm config relocation
- drop embdded subpackage for scl- missing requires on scl-runtime
- relocate /var/lib/session
- fix php-devel requires
- rename, but don't relocate macros.php- initial spec rewrite for scl build- fix typo in systemd macro- php-fpm: enable PrivateTmp
- php-fpm: new systemd macros (#850268)
- php-fpm: add upstream patch for startup issue (#846858)- systemd integration, https://bugs.php.net/63085
- no odbc call during timeout, https://bugs.php.net/63171
- check sqlite3_column_table_name, https://bugs.php.net/63149- most failed tests explained (i386, x86_64)- fix for http://bugs.php.net/63126 (#783967)- patch to ensure we use latest libdb (not libdb4)- really fix rhel tests (use libzip and libdb)- fix test to enable zip extension on RHEL-7- remove session.save_path from php.ini
  move it to apache and php-fpm configuration files- update to 5.4.7
  http://www.php.net/releases/5_4_7.php
- php-fpm: don't daemonize- enable php-fpm on secondary arch (#849490)- update to 5.4.6
- update to v9 of systzdata patch
- backport fix for new libxml- update to 5.4.5- also provide php(language)%{_isa}
- define %{php_version}- drop BR for libevent (#835671)
- provide php(language) to allow version check- add missing provides (core, ereg, filter, standard)- update to 5.4.4 (CVE-2012-2143, CVE-2012-2386)
- use /usr/lib/tmpfiles.d instead of /etc/tmpfiles.d
- use /run/php-fpm instead of /var/run/php-fpm- update to 5.4.3 (CVE-2012-2311, CVE-2012-2329)- update to 5.4.2 (CVE-2012-1823)- update to 5.4.1- rebuild for new icu
- switch (conditionally) to libdb-devel- fix Loadmodule with MPM event (use ZTS if not MPM worker)
- split conf.d/php.conf + conf.modules.d/10-php.conf with httpd 2.4- rebuild for missing automatic provides (#807889)- really use _httpd_mmn- rebuild against httpd 2.4
- use _httpd_mmn, _httpd_apxs macros- update to PHP 5.4.0 finale- update to PHP 5.4.0RC8- update to PHP 5.4.0RC7
- provides env file for php-fpm (#784770)
- add patch to use system libzip (thanks to spot)
- don't provide INSTALL file- all binaries in /usr/bin with zts prefix- update to PHP 5.4.0RC6
  https://fedoraproject.org/wiki/Features/Php54- fix systemd unit- switch to systemd- Rebuild for new libpng- rebuild with new gmp without compat lib- rebuild with new gmp- revert is_a() to php <= 5.3.6 behavior (from upstream)
  with new option (allow_string) fo�x�����((������H�������X��k��������������h�$W�����������������h�hBotectioncpioxz2noarch-redhat-linux-gnudirectoryASCII textPython script, ASCII text executablepython 3.6 byte-compiled	

PPRRRRRRRRRRRRRRRRRRRutf-8ae1bcc2addb33243facb9e6bd6433d5ab6e2a4ce6398a08d60948797b18cbb39?���@�Љ�!�<��ΰ��Q�d~���e,�
	Q�d~���NE��0yQ�K	%Lv�Պ��1FCW�6+3���v�659�4e���>>�)�x����A���^
��΂�����9+~�8����u�&Qt�5P�g�&*D�9�C���>w�����8��__��8�P�dnGY<h��B*��8�g1/�"����Lb^�K�����P�tP]�.2�@\`�f{[�F�X��/����X� ��8Q@'Ow��˾�X���3e=�v�D�.�p��\�-��DŽ�o�S���ѼU�s6�7����D?L�f���l~�m�9�1��4���ƥd���.�hb0)�|�ȣ|Z����@o�,^��
.W�/�\L�oN�O���9�vW����~D������+�9��/Tw.���nY>(̉�!�<��ΰ��Q�d~���e,�
	Q�d~����2�_���pP�s�c4�w9�$�c�_�
�B7z����8h_%ʅY��$i�Z��K�3�"�B-I���iV7֫d�r��>2t��:C���
�9JU.�0��2b�o��Q爂/�&��i'Y�*в
(��7?A�/aaK/�#
���	�LnQϔ�v+R��P����$�V�uuc���1��^h^���v�(�.��o	�z�ۤ�z���`i����~�$[���Ʌ���z{If��Q�2�+�f�Q7#hy�K��%z��S�N08Yeɉ�jT!�0g�G���f��\�z��E}�S<�vG����h�W�ى�<��h���/�5�L����Ō���`ig�u�)�0�.���fdd14452f55afc27313e77e97a9bac0d4bcd8aed50122ce45b66d57de419f8c76c53e1ee994c0e7df7c406d342eaa53006b5ad9ai/'��i/&��cfilesys.cpython-36.opt-1.pycf�[�files.cpython-311.opt-1.pycon8f	files.rst��cfilesystem_associate.py��f#filesystem_associate.cpython-36.pyc�e�)filesystem_associate.cpython-36.opt-1.pyc	3�filetypes.py-	�filetypes.cpython-311.pycqk filetype.vimWq�Pfiletype.txta��pfiletest.pm.p�a�filetest.3pm.gzcp��
�$�>�X�r������������(�B�^��fwfilesystems��P	2�!o
filesystem.py�=�sfilesystem.cpython-36.pyc�<�ifilesystem.cpython-36.opt-1.pycMa	�filesystem.cpython-311.pycedh	�@filesize.pyf	X_filesize.cpython-311.pycadh1files_write.txt_adgnfiles_write.png�dfffiles_exec.txtfdeyfiles_exec.pngxerdd�files_apps.txtutidc6files_apps.pngf(	�	
it�r�files.pyu(<�<�<<�<i<�<�
<B<<�<<�<h<�<�<<�<Y<�<q<2!<�"<J$<�%<b'<�(<z*<;,<�-<S/<�0<k2<�3<�5<D7<�8<\:.
files.pageit3files.cpython-36.pyceit�files.cpython-36.opt-1.pyc36.	�	�	�\qfiles.cpython-311.pyc(<�<�<<�<h<�<�
<A<<�<<�<g<�<<<�<X<�<p<1!<�"<I$<�%<a'<�(<y*<:,<�-<R/<�0<j2<�3<�5<C7<�8<[:1files-tilde.pageg(<�<�<<�<g<�<�
<@<<�<<�<f<�<~<
<�<W<�<o<0!<�"<H$<�%<`'<�(<x*<9,<�-<Q/<�0<i2<�3<�5<B7<�8<Z:1files-templates.pagef�x���������������������XS�mp��������������������$�������������������FL�
���������������xsgbVQE@4/#
���������������ythcWRFA50$�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
z
u
i
d
X
S
G
B
6
1
%
 



���������������{vjeYTHC72&!���������������|wkfZUID83'"�
�
�
�
�
�
�
�
�
�
�
�
�
�
}
x
l
g
[
V
J
E
9
4
(
#




�	�	�	�	�	�	�	�	�	�	�	�	�	�	~	y	m	h	\	W	K	F	:	5	)	$					��������������zni]XLG;6*%���������������{oj^YMH<7+&	���������������|pk_ZNI=8,'
���������������}ql`[OJ>9-(���������������~rma\PK?:.)���������������snb]QL@;/�q�����q�����q�����q�����q�����q�����q�����q�����q�����q�����q�����q�����q�����q�����q�����q�����q�����q�����q�����q�����q�����q�����q�����q�����q�����q�����q�����q������uv�\q�>[;|p,���A��P���ɥ�����뚦H�O�wUO���q�)��5�>[;�	���q�$�����u��̬�>[;)��Iq�'}��>[;�z��q�k��J���뙏9�>[;|	�3�>[;	54��q�L,���u�
�>[;�(4:�������5�`����>[;�����q����9�>[;*	xE��q�)Mh���up�x�>[;�l�h�} T$($�>[;R(���$���%��������>[;:�%�O�w<����q��p9�����X4�>[;����>[;�3g��q��,a���u<��v����9�>[;�'@��$�[~p.����&������*�\��>[;�;��q�L�\?���,�L
�
��몌��>[;[d�>[;3B��q���h^�>[;k�Y����&��$�-�dd����p���>[;;�%�O�w��a��q�3�tQ�>[;�|+�>[;�28C��q�!���>[;ejH�����x�������[�<��4��G��7�/��M�.L��oVn�
�>[;0��q���PJ�>[;���<�>[;�1����q��G�:�>[;6h�������"�>[;Y&@|�G��r�Y����V�4���oV�/@�>[;x���q����^�>[;��C�>[;j`*�>[;D10-��q��ܗ~>[;?gD�}����
|>[;�%�!{G��~<x�����uw�oV�'�v>[;D,Lv�q��oD_s>[;���+r>[;�,q>[;�0(9pJ�=�d>nE�14�n	>[;�O|m���lG��X0�#h>[;P�&f�q��&xrc>[;��2b>[;�/��`E�17�^	
�߃��@]��b�\�{w�[>[;Y$ U[>!�7��XG��+�X�oV�D4VO�wd��#U�q����sS>[;B�`R>[;]��QE�1.`#N	>[;�9��MVg�j��+I�Â��H�oV/�F>[;[ HF�q�RA�C>[;_�AE�1�%9>	>[;j9|=����|{<Vg��� ,9�Âs^8&��(� 8����t7>[;h!6�q��@p3>[;�}�>2>[;��71>[;�-��0�f#n��",���K��^,>[;� �+>[;�
3&�q��? #>[;�r���">[;I�P!>[;�,|E 0���>[;�7R�f#���]����,��@��<Vg�4��1���f�x1>[;x
�-O�wi2�S�q��>�>[;�p9���l����ק��>[;t9>[;
H3O�w��@�q�2���u\��E>[;�p<I�x�������������������X��kX�0KY��$I����������������Y�X�Z��.0-1Jindrich Novy <jnovy@redhat.com> - 1.3.0-1Jindrich Novy <jnovy@redhat.com> - 1.2.0-3Jindrich Novy <jnovy@redhat.com> - 1.2.0-2Jindrich Novy <jnovy@redhat.com> - 1.2.0-1Jindrich Novy <jnovy@redhat.com> - 1.1.2-3Jindrich Novy <jnovy@redhat.com> - 1.1.2-2Jindrich Novy <jnovy@redhat.com> - 1.1.2-1Jindrich Novy <jnovy@redhat.com> - 1.1.1-1Jindrich Novy <jnovy@redhat.com> - 1.1.0-1Jindrich Novy <jnovy@redhat.com> - 1.0.0-1Jindrich Novy <jnovy@redhat.com> - 0.7.8-1Jindrich Novy <jnovy@redhat.com> - 0.7.2-5Jindrich Novy <jnovy@redhat.com> - 0.7.2-4Jindrich Novy <jnovy@redhat.com> - 0.7.2-3Jindrich Novy <jnovy@redhat.com> - 0.7.2-2Jindrich Novy <jnovy@redhat.com> - 0.7.2-1Jindrich Novy <jnovy@redhat.com> - 0.7.1-1Jindrich Novy <jnovy@redhat.com> - 0.7-1Lokesh Mandvekar <lsm5@redhat.com> - 0.4.1-1Frantisek Kluknavsky <fkluknav@redhat.com> - 0.3-2Lokesh Mandvekar <lsm5@fedoraproject.org> - 0.1-7.dev.git50c7a50Lokesh Mandvekar <lsm5@fedoraproject.org> - 0.1-6.dev.git1c72a1aLokesh Mandvekar <lsm5@fedoraproject.org> - 0.1-5.dev.gitd40ac75Lokesh Mandvekar <lsm5@fedoraproject.org> - 0.1-4.dev.git79c70fdLokesh Mandvekar <lsm5@fedoraproject.org> - 0.1-3.dev.git79c70fdLokesh Mandvekar <lsm5@fedoraproject.org> - 0.1-2.dev.git79c70fdLokesh Mandvekar <lsm5@fedoraproject.org> - 0.1-1.dev.git13575b6- update to https://github.com/containers/fuse-overlayfs/releases/tag/v1.13
- Related: Jira:RHEL-2110- update to https://github.com/containers/fuse-overlayfs/releases/tag/v1.12
- Related: #2176055- update to https://github.com/containers/fuse-overlayfs/releases/tag/v1.11
- Related: #2176055- update to https://github.com/containers/fuse-overlayfs/releases/tag/v1.10
- Related: #2176055- update to https://github.com/containers/fuse-overlayfs/releases/tag/v1.10
- Related: #2123641- update to https://github.com/containers/fuse-overlayfs/releases/tag/v1.9
- Related: #2061390- BuildRequires: /usr/bin/go-md2man
- Related: #2061390- update to https://github.com/containers/fuse-overlayfs/releases/tag/v1.8.2
- Related: #2001445- update to https://github.com/containers/fuse-overlayfs/releases/tag/v1.8.1
- Related: #2001445- update to https://github.com/containers/fuse-overlayfs/releases/tag/v1.8
- Related: #2001445- update to https://github.com/containers/fuse-overlayfs/releases/tag/v1.7.1
- Related: #1934415- update to https://github.com/containers/fuse-overlayfs/releases/tag/v1.7
- Related: #1934415- update to https://github.com/containers/fuse-overlayfs/releases/tag/v1.6
- Related: #1934415- update to https://github.com/containers/fuse-overlayfs/releases/tag/v1.5.0
- Related: #1934415- disable openat2 syscall again - still unsupported in current RHEL8 kernel
- Related: #1883490- update to https://github.com/containers/fuse-overlayfs/releases/tag/v1.4.0
- Related: #1883490- update to https://github.com/containers/fuse-overlayfs/releases/tag/v1.3.0
- Related: #1883490- be sure to harden the linked binary
- Related: #1883490- ensure fuse module is loaded
- Related: #1883490- synchronize with stream-container-tools-rhel8
- Related: #1883490- fix "error bind mounting /dev from host into mount namespace"
  (the openat2 syscall is not yet supported by the RHEL8 kernel)
- Resolves: #1867447- use proper CFLAGS
- Related: #1821193- update to https://github.com/containers/fuse-overlayfs/releases/tag/v1.1.2
- Related: #1821193- update to https://github.com/containers/fuse-overlayfs/releases/tag/v1.1.1
- Related: #1821193- update to https://github.com/containers/fuse-overlayfs/releases/tag/v1.1.0
- Related: #1821193- synchronize containter-tools 8.3.0 with 8.2.1
- Related: #1821193- update to https://github.com/containers/fuse-overlayfs/releases/tag/v0.7.8
- Related: #1821193- latest iteration of segfault fix patch, thanks to Giuseppe Scrivano
- Resolves: #1805017- replace "fuse-overlayfs segfault" patch with improved one
  due to application to a different context
- Resolves: #1805017- fix "fuse-overlayfs segfault"
- Resolves: #1805017- fix "useradd and groupadd fail under rootless Bu�x�������������������XD�l��3L�����$����������������L>LL�ielson@cpanel.net> - 7.0.4-1Jacob Perkins <jacob.perkins@cpanel.net> - 7.0.3-1Jacob Perkins <jacob.perkins@cpanel.net> - 7.0.0-7S. Kurt Newman <kurt.newman@cpanel.net> - 7.0.0-6S. Kurt Newman <kurt.newman@cpanel.net> - 7.0.0-5S. Kurt Newman <kurt.newman@cpanel.net> - 7.0.0-4S. Kurt Newman <kurt.newman@cpanel.net> - 7.0.0-3Remi Collet <remi@fedoraproject.org> 7.0.0-2Remi Collet <remi@fedoraproject.org> 7.0.0-1Remi Collet <remi@fedoraproject.org> 7.0.0-0.26.RC8Remi Collet <remi@fedoraproject.org> 7.0.0-0.25.RC8Remi Collet <remi@fedoraproject.org> 7.0.0-0.24.RC7Remi Collet <remi@fedoraproject.org> 7.0.0-0.23.RC7Remi Collet <remi@fedoraproject.org> 7.0.0-0.22.RC6Remi Collet <remi@fedoraproject.org> 7.0.0-0.21.RC5Remi Collet <remi@fedoraproject.org> 7.0.0-0.20.RC5Remi Collet <remi@fedoraproject.org> 7.0.0-0.19.RC5Remi Collet <remi@fedoraproject.org> 7.0.0-0.18.RC4Remi Collet <remi@fedoraproject.org> 7.0.0-0.17.RC3Remi Collet <remi@fedoraproject.org> 7.0.0-0.16.RC3Remi Collet <remi@fedoraproject.org> 7.0.0-0.15.RC2Remi Collet <remi@fedoraproject.org> 7.0.0-0.14.RC1Remi Collet <remi@fedoraproject.org> 7.0.0-0.13.beta3Remi Collet <remi@fedoraproject.org> 7.0.0-0.12.beta2Remi Collet <remi@fedoraproject.org> 7.0.0-0.11.beta1Remi Collet <remi@fedoraproject.org> 7.0.0-0.10.alpha2Remi Collet <remi@fedoraproject.org> 7.0.0-0.9.20150617git3697f02Remi Collet <remi@fedoraproject.org> 7.0.0-0.9.20150611git8cfe282Remi Collet <remi@fedoraproject.org> 7.0.0-0.8.alpha1Remi Collet <remi@fedoraproject.org> 7.0.0-0.7.20150602git8a089e7Remi Collet <remi@fedoraproject.org> 7.0.0-0.7.20150525git6f46fa3Remi Collet <remi@fedoraproject.org> 7.0.0-0.6.20150525git404360fRemi Collet <remi@fedoraproject.org> 7.0.0-0.6.20150518gitcee8857Remi Collet <remi@fedoraproject.org> 7.0.0-0.6.20150515gitc9f27eeRemi Collet <remi@fedoraproject.org> 7.0.0-0.6.20150507gitdd0b602Remi Collet <remi@fedoraproject.org> 7.0.0-0.5.20150428git94f0b94Remi Collet <remi@fedoraproject.org> 7.0.0-0.5.20150427git1a4d3e4Remi Collet <remi@fedoraproject.org> 7.0.0-0.5.20150418git1f0a624Remi Collet <remi@fedoraproject.org> 7.0.0-0.5.20150416gitc77d97fRemi Collet <remi@fedoraproject.org> 7.0.0-0.5.20150403gitadcf0c6Remi Collet <remi@fedoraproject.org> 7.0.0-0.4.20150331git463ca30Remi Collet <remi@fedoraproject.org> 7.0.0-0.3.20150325git2fe6acdRemi Collet <remi@fedoraproject.org> 7.0.0-0.2.20150325git23336d7Remi Collet <remi@fedoraproject.org> 7.0.0-0.1.20150325git23336d7Remi Collet <remi@fedoraproject.org> 5.6.7-1Remi Collet <remi@fedoraproject.org> 5.6.7-0.1.RC1Remi Collet <remi@fedoraproject.org> 5.6.6-1Remi Collet <remi@fedoraproject.org> 5.6.5-1Remi Collet <rcollet@redhat.com> 5.6.5-0.2.RC1Remi Collet <remi@fedoraproject.org> 5.6.5-0.1.RC1Remi Collet <remi@fedoraproject.org> 5.6.4-2Remi Collet <remi@fedoraproject.org> 5.6.4-1Remi Collet <remi@fedoraproject.org> 5.6.4-0.1.RC1Remi Collet <remi@fedoraproject.org> 5.6.3-3Remi Collet <remi@fedoraproject.org> 5.6.3-2Remi Collet <remi@fedoraproject.org> 5.6.3-1Remi Collet <remi@fedoraproject.org> 5.6.3-0.1.RC1Remi Collet <remi@fedoraproject.org> 5.6.2-1Remi Collet <remi@fedoraproject.org> 5.6.1-1Remi Collet <remi@fedoraproject.org> 5.6.0-1.1Remi Collet <remi@fedoraproject.org> 5.6.0-1Remi Collet <rcollet@redhat.com> - 5.6.0-0.1.RC4Remi Collet <rcollet@redhat.com> - 5.5.6-10Remi Collet <rcollet@redhat.com> - 5.5.6-9Remi Collet <rcollet@redhat.com> - 5.5.6-8Remi Collet <rcollet@redhat.com> - 5.5.6-7Remi Collet <rcollet@redhat.com> - 5.5.6-6Remi Collet <rcollet@redhat.com> - 5.5.6-5Remi Collet <rcollet@redhat.com> - 5.5.6-4Remi Collet <rcollet@redhat.com> 5.5.6-2Remi Collet <rcollet@redhat.com> 5.5.6-0Remi Collet <rcollet@redhat.com> 5.5.5-1Remi Collet <rcollet@redhat.com> 5.5.4-1Remi Collet <rcollet@redhat.com> 5.5.3-1Remi Collet <rcollet@redhat.com> 5.5.1-1Remi Collet <rcollet@redhat.com> 5.4.16-6Remi Collet <rcollet@redhat.com> 5.4.16-5Remi Collet <rcollet@redhat.com> 5.4.16-4Remi Collet <rcollet@redhat.com> - 5.4.16-3Remi Collet <rcollet�x�������������������X�;m0t�������.��$>����������������.�-�/��rd-coded include_path (#174885)- rebuild for httpd 2.2- update to 5.1.1
- remove pear subpackage
- enable pdo extensions (php-pdo subpackage)
- remove non-standard conditional module builds
- enable xmlreader extension- rebuilt against new openssl- pear: update to XML_RPC 1.4.4, XML_Parser 1.2.7, Mail 1.1.9 (#172528)- rebuild for new libnetsnmp- update to 5.0.5
- add fix for upstream #34435
- devel: require autoconf, automake (#159283)
- pear: update to HTTP-1.3.6, Mail-1.1.8, Net_SMTP-1.2.7, XML_RPC-1.4.1
- fix imagettftext et al (upstream, #161001)- ldap: restore ldap_start_tls() function- disable RPATHs in shared extensions (#156974)- build simplexml_import_dom even with shared dom (#156434)
- prevent truncation of copied files to ~2Mb (#155916)
- install /usr/bin/php from CLI build alongside CGI
- enable sysvmsg extension (#142988)- prevent build of builtin dba as well as shared extension- split out dba and bcmath extensions into subpackages
- BuildRequire gcc-c++ to avoid AC_PROG_CXX{,CPP} failure (#155221)
- pear: update to DB-1.7.6
- enable FastCGI support in /usr/bin/php-cgi (#149596)- build /usr/bin/php with the CLI SAPI, and add /usr/bin/php-cgi,
  built with the CGI SAPI (thanks to Edward Rudd, #137704)
- add php(1) man page for CLI
- fix more test cases to use -n when invoking php- rebuild for new libpq soname- bundle from PEAR: HTTP, Mail, XML_Parser, Net_Socket, Net_SMTP
- snmp: disable MSHUTDOWN function to prevent error_log noise (#153988)
- mysqli: add fix for crash on x86_64 (Georg Richter, upstream #32282)- build shared objects as PIC (#154195)- fix PEAR installation and bundle PEAR DB-1.7.5 package- update to 5.0.4 (#153068)
- add .phps AddType to php.conf (#152973)
- better gcc4 fix for libxmlrpc- BuildRequire mysql-devel >= 4.1
- don't mark php.ini as noreplace to make upgrades work (#152171)
- fix subpackage descriptions (#152628)
- fix memset(,,0) in Zend (thanks to Dave Jones)
- fix various compiler warnings in Zend- package mysqli extension in php-mysql
- really enable pcntl (#142903)
- don't build with --enable-safe-mode (#148969)
- use "Instant Client" libraries for oci8 module (Kai Bolay, #149873)- fix build with GCC 4- install the ext/gd headers (#145891)
- enable pcntl extension in /usr/bin/php (#142903)
- add libmbfl array arithmetic fix (dcb314@hotmail.com, #143795)
- add BuildRequire for recent pcre-devel (#147448)- update to 5.0.3 (thanks to Robert Scheck et al, #143101)
- enable xsl extension (#142174)
- package both the xsl and dom extensions in php-xml
- enable soap extension, shared (php-soap package) (#142901)
- add patches from upstream 5.0 branch:
 * Zend_strtod.c compile fixes
 * correct php_sprintf return value usage- update for db4-4.3 (Robert Scheck, #140167)
- build against mysql-devel
- run tests in %check- truncate changelog at 4.3.1-1
- merge from 4.3.x package:
 - enable mime_magic extension and Require: file (#130276)- fix dom/sqlite enable/without confusion- fix phpize installation for lib64 platforms
- add fix for segfault in variable parsing introduced in 5.0.2- update to 5.0.2 (#127980)
- build against mysqlclient10-devel
- use new RTLD_DEEPBIND to load extension modules
- drop explicit requirement for elfutils-devel
- use AddHandler in default conf.d/php.conf (#135664)
- "fix" round() fudging for recent gcc on x86
- disable sqlite pending audit of warnings and subpackage split- don't build dom extension into 2.0 SAPI- ExclusiveArch: x86 ppc x86_64 for the moment- fix default extension_dir and conf.d/php.conf- update to 5.0.1
- only build shared modules once
- put dom extension in php-dom subpackage again
- move extension modules into %{_libdir}/php/modules
- don't use --with-regex=system, it's ignored for the apache* SAPIs- Merge in some spec file changes from Jeff Stern (jastern@uci.edu)- bump to 5.0.0
- add patch to prevent clobbering struct re_registers from regex.h
- remove domxml references, replaced with dom now built-in
- fix php.ini to refer to php5 not php41:5.6.40�x������������������X��l0���i��$y����������������i�h��H�?��d����$�	(�	[���������������	�)�N�T\|	�
���
�,Tx��H�("8,9�:<WG��H��I��X�Y�\�0]�P^��b�[d��e��f��l��t��u��v�w��x��y�#���������������6�6�F6
�|���������g��h��Cshadow-utils-subid4.623.el8_10A library to manage subordinate uid and gid rangesUtility library that provides a way to manage subid ranges.iD�x64-builder03.almalinux.org3�AlmaLinuxAlmaLinuxBSD and GPLv2+AlmaLinux Packaging Team <packager@almalinux.org>System Environment/Basehttp://pkg-shadow.alioth.debian.org/linuxx86_641`'�����A�A����큤iD�iD�iD�iD�iD�iD�iD�iD�c3a8af08c4aea3a167c49ac44453164e730c50a6aaf3d756feee3cab058287b38d118e8bd9636c9e8b476da1e35d76d4ea9c605ae10bbf6edffc9515516b3b725b30fb43c0b4f172e293b7017f6d894388a8b3d81ddcac6f94a8ab9d51b6d63f../../../../usr/lib64/libsubid.so.3.0.0../../../../usr/bin/getsubidslibsubid.so.3.0.0rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootshadow-utils-4.6-23.el8_10.src.rpm��������������������������������libsubid.so.3()(64bit)shadow-utils-subidshadow-utils-subid(x86-64)@@@@@@@@@@@@@@@@@@@@@



@libacl.so.1()(64bit)libacl.so.1(ACL_1.1)(64bit)libattr.so.1()(64bit)libattr.so.1(ATTR_1.1)(64bit)libaudit.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libc.so.6(GLIBC_2.8)(64bit)libcrypt.so.1()(64bit)libcrypt.so.1(XCRYPT_2.0)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libselinux.so.1()(64bit)libsemanage.so.1()(64bit)libsemanage.so.1(LIBSEMANAGE_1.0)(64bit)libsubid.so.3()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.3i�e\��eC�@d���dd��b�?�a��an�@a
@`��_��_-B@^�U@^��@\�Q�\�@\&@[�[���[`O@[`O@Zy��Zc/@ZN�Y��Y���Y���Y�@Yy�Yq�X���W��W�:�W_�WL+@WF�@V�@V��V��V���V<�@U��U�@Tu��Tto@TA�T=@T�Tk@S��S��@S��@S��@S�Q@S�Q@S�P@R�b@Ra"�Q�@Q�*@Q��QHS@Q$��Q��P�PY��P�P
��O�@Ok@Og�O1@On@N�x�Nå�N�k@N7�N7�N)f@N�N	�@Np�M�@M��@M�W�MR��MG��M$]@LE��L�K�t�K�#@K���K���K�J���J��@Jyt@JlE@J_@J_@J]�J7�@J
Y@I��I�o@I�z�I�z�I��@Itk@Ia�@IN/�H�+�H�@H�*�H�*�H���H�n�H��H:�@H2�@G��G�.@G��@G��G��G_�@GN��GJ�G
�F�%@F���Ff��Ff��F|@F��E���E�n�E�@E�w@E�<�Ev��En�EY��EL��EK/@EH�@E?Q�E#�@D�q@DԈ@D�6�D�6�D�{�D��@D���D��@D�n@D7��D2_�D1@Dj@D
u�D$@C�@C�C�[�C�q�C�B�C{@Cl��CX�@C3�@C/��CJ@CU�B��B���B�I@B�I@B�T�B��B��Br!�Bc�@BQ,@BIC@B5|�B,B@B%��B@B�@B��B	�@Aw��As�@Ao��Am�Ak�@A]F�AV�@A+-�A�@@��@@ч�@��@ia@@ia@@,�@@i�?��?��?�r@?�}�?��@?�q@?\o@?W)@?%@>��@>��@>܍�>J7@>H�>.��=�=��=��=��@=��=n�=f#�=@<��@<��<��@<v2�<QH�;�6@;`@; �@;
T�:��:�P�9��@9��@9��@9���9tF�9tF�9tF�9l]�9L��8��@8���8���8��8�@8�y@8��@8xx@7��7�s@7�7
�7�@7@6��@6�x�������������������X�m0�����-�$*�����������������-�m�-� !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~����������������������������������������������������������������������������������������������������������������������������130.4-1.cp130~el8�x������������������X�Xl�������Xb��������$�����������������
���enough-space-in-mbuf-to-null-t.patch [bz#1693076]
- kvm-slirp-don-t-manipulate-so_rcv-in-tcp_emu.patch [bz#1693076]
- Resolves: bz#1693076
  (CVE-2019-6778 qemu-kvm: QEMU: slirp: heap buffer overflow in tcp_emu() [rhel-av-8])
- Resolves: bz#1698711
  (Enable Spectre / Meltdown mitigations by default in pseries-rhel8.0.0 machine type)- kvm-redhat-enable-tpmdev-passthrough.patch [bz#1688312]
- kvm-exec-Only-count-mapped-memory-backends-for-qemu_getr.patch [bz#1680492]
- kvm-Enable-libpmem-to-support-nvdimm.patch [bz#1705149]
- Resolves: bz#1680492
  (Qemu quits suddenly while system_reset after hot-plugging unsupported memory by compatible guest on P9 with 1G huge page set)
- Resolves: bz#1688312
  ([RFE] enable TPM passthrough at compile time (qemu-kvm))
- Resolves: bz#1705149
  (libpmem support is not enabled in qemu-kvm)- kvm-x86-host-phys-bits-limit-option.patch [bz#1688915]
- kvm-rhel-Set-host-phys-bits-limit-48-on-rhel-machine-typ.patch [bz#1688915]
- Resolves: bz#1688915
  ([Intel 8.0 Alpha] physical bits should  <= 48  when host with 5level paging &EPT5 and qemu command with "-cpu qemu64" parameters.)- kvm-device_tree-Fix-integer-overflowing-in-load_device_t.patch [bz#1693173]
- Resolves: bz#1693173
  (CVE-2018-20815 qemu-kvm: QEMU: device_tree: heap buffer overflow while loading device tree blob [rhel-av-8])- kvm-i386-kvm-Disable-arch_capabilities-if-MSR-can-t-be-s.patch [bz#1687578]
- kvm-i386-Make-arch_capabilities-migratable.patch [bz#1687578]
- Resolves: bz#1687578
  (Incorrect CVE vulnerabilities reported on Cascade Lake cpus)- kvm-Remove-7-qcow2-and-luks-iotests-that-are-taking-25-s.patch [bz#1683473]
- kvm-spapr-fix-out-of-bounds-write-in-spapr_populate_drme.patch [bz#1674438]
- kvm-qcow2-include-LUKS-payload-overhead-in-qemu-img-meas.patch [bz#1655065]
- kvm-iotests-add-LUKS-payload-overhead-to-178-qemu-img-me.patch [bz#1655065]
- kvm-vnc-detect-and-optimize-pageflips.patch [bz#1666206]
- kvm-Load-kvm-module-during-boot.patch [bz#1676907 bz#1685995]
- kvm-hostmem-file-reject-invalid-pmem-file-sizes.patch [bz#1669053]
- kvm-iotests-Fix-test-200-on-s390x-without-virtio-pci.patch [bz#1687582]
- kvm-block-file-posix-do-not-fail-on-unlock-bytes.patch [bz#1652572]
- Resolves: bz#1652572
  (QEMU core dumped if stop nfs service during migration)
- Resolves: bz#1655065
  ([rhel.8.0][fast train]'qemu-img measure' size does not match the real allocated size for luks-inside-qcow2 image)
- Resolves: bz#1666206
  (vnc server should detect page-flips and avoid sending fullscreen updates then.)
- Resolves: bz#1669053
  (Guest call trace when boot with nvdimm device backed by /dev/dax)
- Resolves: bz#1674438
  (RHEL8.0 - Guest reboot fails after memory hotplug multiple times (kvm))
- Resolves: bz#1676907
  (/dev/kvm device exists but kernel module is not loaded on boot up causing VM start to fail in libvirt)
- Resolves: bz#1683473
  (Remove 7 qcow2 & luks iotests from rhel8 fast train build %check phase)
- Resolves: bz#1685995
  (/dev/kvm device exists but kernel module is not loaded on boot up causing VM start to fail in libvirt)
- Resolves: bz#1687582
  (QEMU IOTEST 200 fails with 'virtio-scsi-pci is not a valid device model name')- kvm-i386-Add-stibp-flag-name.patch [bz#1686260]
- Resolves: bz#1686260
  (stibp is missing on qemu 3.0 and qemu 3.1)- kvm-migration-Fix-cancel-state.patch [bz#1608649]
- kvm-migration-rdma-Fix-qemu_rdma_cleanup-null-check.patch [bz#1608649]
- Resolves: bz#1608649
  (Query-migrate get "failed" status after migrate-cancel)- kvm-target-i386-Disable-MPX-support-on-named-CPU-models.patch [bz#1661030]
- kvm-i386-remove-the-new-CPUID-PCONFIG-from-Icelake-Serve.patch [bz#1661515]
- kvm-i386-remove-the-INTEL_PT-CPUID-bit-from-named-CPU-mo.patch [bz#1661515]
- kvm-Revert-i386-Add-CPUID-bit-for-PCONFIG.patch [bz#1661515]
- Resolves: bz#1661030
  (Remove MPX support from 8.0 machine types)
- Resolves: bz#1661515
  (Remove PCONFIG and INTEL_PT from Icelake-* CPU models)- kvm-block-Apply-auto-read-only-for-ro-whitelist-drivers.patch [bz#1678968]
- Resolves: bz#1678968
  (�x�������������x�����X�m(����&�$�����������������&�&�D�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroo�x�������������������XH�j@�D������$T�����������������??pd���#�	/�	c���������	������	
U
X\af����(�8�9�:�GHIXY(\D]H^Sb�d�e�f�l�t�uv� �$�*�l��
���ghCcpanel-perl-542-set-crontab1.031.cp130~el8CPAN module - Expand crontab(5)-style integer listsCpanel build perl module 'Set::Crontab'Expand crontab(5)-style integer listsh��bh-centos-8.dev.cpanel.net
@perlcpanel/perlhttps://metacpan.orglinuxnoarch
@�$K�`2522511d7d1c24e08a925800502cbf9a49cbc6dd4e99fc4d71334b508b2eb9572rootrootcpanel-perl-542-set-crontab-1.03-1.cp130~el8.src.rpm����cpanel-perl(Set::Crontab)cpanel-perl-542-set-crontabcpanel-perl-set-crontab




cpanel-perl-542rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h?�b�@`-@Q+R@Busy Camels <bc@cpanel.net> - 1.03-1.cp130Busy Camels <bc@cpanel.net> - 1.03-1.cp108Busy Camels <bc@cpanel.net> - 1.03-1.cp1198Todd Rinaldo <toddr@cpanel.net> - 1.03-1.cp1136- Bump to 1.cp130 for re-build- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Set-Crontab 1.031.031.03-1.cp130~el81.03Crontab.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Set/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-893aa97fe1acefc32267112ccdb408312071fbc1e47aca7038c9109e5ecdf9cb3?�����������'�贻85a6f3e3a5942231f90b63568dc5b63614c427c74007374615aaa9edbb8ab52e0cbee622c435bc9a06bf1af91af473278c5c65a14i?�vli?�s) [1937825]
- mm/lru: introduce TestClearPageLRU() (Waiman Long) [1937825]
- mm/mlock: remove __munlock_isolate_lru_page() (Waiman Long) [1937825]
- mm/mlock: remove lru_lock on TestClearPageMlocked (Waiman Long) [1937825]
- mm/vmscan: remove lruvec reget in move_pages_to_lru (Waiman Long) [1937825]
- mm/swap.c: fold vm event PGROTATED into pagevec_move_tail_fn (Waiman Long) [1937825]
- mm/memcg: add debug checking in lock_page_memcg (Waiman Long) [1937825]
- mm: page_idle_get_page() does not need lru_lock (Waiman Long) [1937825]
- mm/rmap: stop store reordering issue on page->mapping (Waiman Long) [1937825]
- mm/vmscan: remove unnecessary lruvec adding (Waiman Long) [1937825]
- mm/thp: narrow lru locking (Waiman Long) [1937825]
- mm/thp: simplify lru_add_page_tail() (Waiman Long) [1937825]
- mm/thp: use head for head page in lru_add_page_tail() (Waiman Long) [1937825]
- mm/thp: move lru_add_page_tail() to huge_memory.c (Waiman Long) [1937825]
- mm: slub: convert sysfs sprintf family to sysfs_emit/sysfs_emit_at (Waiman Long) [1937825]
- mm: truncate_complete_page() does not exist any more (Waiman Long) [1937825]
- mm/vmscan: drop unneeded assignment in kswapd() (Waiman Long) [1937825]
- mm: memcontrol: account pagetables p�x������7�������w����X*�k�c����C3�$S����������������C3B3D3�s- Add systemd units- Rebuilt with new mysqlclient- set correct license tag
- add ghost to /var/run/saslauthd- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Add /etc/tmpfiles.d element (#662734)- Update init script to impeach pid file- Update pre post preun and postun scripts (#572399)- Rewrite spec file, make corect CFLAGS, CPPFLAGS and LDFLAGS- solve race condition (#566875)- improve m4 quoting to fix saslauthd/configure (#566088)
- call autotools in build, not in prep- Add man page to testtcpauthd (#526189)- Create the saslauth user according to fedora packaging guide- Repair initscript to make condrestart working properly (#522103)- Add possibility to run the saslauth without root privilegies (#185614)- rebuilt with new openssl- update to 2.1.23- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- repair sasl_encode64 nul termination (#487251)- Don't build the krb4 plugin as krb5 1.7 will drop it (#225974 #c6)- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- fix build with gcc-4.4- set LDAP_OPT_TIMEOUT (#326452)
- provide LSB compatible init script (#246900)- always use the current external db4 when linking,
  thanks to Dan Horak for the original patch (#464098)- fix most critical build warnings (#433583)
- use external db4- always link against the internal db4 (#459163)
- rediff patches for no fuzz- update internal db4 (#449737)- drop reload from initscript help (#448154)
- fix hang in rimap auth method (#438533)
- build the krb4 plugin (#154675)- make it so that bootstrap actually works- minor release bump for sparc rebuild- Autorebuild for GCC 4.3- rebuild for gcc4.3- Cleanup after merge review bz #225673
- no longer mark /etc/rc.d/init.d/saslauthd as config file
- removed -x permissions on include files
- added devel package dependency on cyrus-sasl
- removed some remaining .la files that were being delivered- Rebuild for deps- Fixed a typo in the spec file- Removed srp plugin source and added dist to NVR- use db4 version 4.6.19 bz#249737- install config files and init scripts using -p
- pull in patch to build with current automake (#229010, Jacek Konieczny
  and Robert Scheck)
- remove prereq on ldconfig, RPM should pick it up based on the -libs
  scriptlets
- pull in patch to correctly detect gsskrb5_register_acceptor_identity
  (#200892, Mirko Streckenbach)
- move sasldb auxprop modules into the -lib subpackage, so that we'll pick
  it up for multilib systems- pull CVS fix for not tripping over extra commas in digest-md5
  challenges (#229640)- remove static build, which is no longer a useful option because not all of
  our dependencies are available as static libraries
- drop patches which were needed to keep static builds going
- drop gssapi-generic patch due to lack of interest
- update the bundled copy of db to 4.5.20 (#229012)
- drop dbconverter-2, as we haven't bundled v1 libraries since FC4- rebuild
- add 'authentication' or 'auxprop' to summaries for plugin packages to
  better indicate what the plugin provides
- switch from automake 1.9 to automake 1.7- rebuild without 'dlcompat' bits (#206119)- rebuild- fix a typo in sasl_client_start(3) (#196066)- update to 2.1.22, adding pluginviewer to %{_sbindir}- add conditionalized build dependency on openldap-devel (#191855)
- patch md5global.h to be the same on all architectures- add unapplied patch which makes the DIGEST-MD5 plugin omit the realm
  argument when the environment has $CYRUS_SASL_DIGEST_MD5_OMIT_REALM set to a
  non-zero value, for testing purposes
- add missing buildrequires on zlib-devel (#190113)- add missing buildrequires on gdbm-devel (Karsten Hopp)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- use --as-needed to avoid linking dbconverter-2 with SQL libraries, which
  it doesn't use because it manipulates files directly (#173321)- rebuilt- rebuild with new OpenLDAP, overriding the version checks to assume that
  2.3.11 is acceptable
- remove a lingering patch f�x��������������g����X�Flx"0���������$�������������������� [bz#1897923]
- kvm-redhat-Add-hw_compat_4_2_extra-and-apply-to-upstream.patch [bz#1897923]
- kvm-ppc-pef.c-initialize-cgs-ready-in-kvmppc_svm_init.patch [bz#1789757]
- kvm-virtio-gpu-handle-partial-maps-properly.patch [bz#1932279]
- kvm-redhat-Fix-unversioned-Obsoletes-warning.patch [bz#1950405 bz#1967330]
- kvm-redhat-Move-qemu-kvm-docs-dependency-to-qemu-kvm.patch [bz#1950405 bz#1967330]
- kvm-redhat-introducting-qemu-kvm-hw-usbredir.patch [bz#1950405 bz#1967330]
- kvm-spapr-Fix-EEH-capability-issue-on-KVM-guest-for-PCI-.patch [bz#1976015]
- Resolves: bz#1897923
  (support Live Migration from Ubuntu 18.04 i440fx to RHEL)
- Resolves: bz#1789757
  ([IBM 8.5 FEAT] Add machine option to enable secure VM support)
- Resolves: bz#1932279
  ([aarch64] qemu core dumped when using smmuv3 and iommu_platform enabling at virtio-gpu-pci)
- Resolves: bz#1950405
  (review qemu-kvm-core dependencies)
- Resolves: bz#1967330
  (Make qemu-kvm use versioned obsoletes for qemu-kvm-ma and qemu-kvm-rhev)
- Resolves: bz#1976015
  (spapr: Fix EEH capability issue on KVM guest for PCI passthru)- kvm-block-backend-add-drained_poll.patch [bz#1960137]
- kvm-nbd-server-Use-drained-block-ops-to-quiesce-the-serv.patch [bz#1960137]
- kvm-disable-CONFIG_USB_STORAGE_BOT.patch [bz#1866133]
- kvm-doc-Fix-some-mistakes-in-the-SEV-documentation.patch [bz#1954750]
- kvm-docs-Add-SEV-ES-documentation-to-amd-memory-encrypti.patch [bz#1954750]
- kvm-docs-interop-firmware.json-Add-SEV-ES-support.patch [bz#1954750]
- Resolves: bz#1960137
  ([incremental backup] qemu-kvm hangs when Rebooting the VM during full backup)
- Resolves: bz#1866133
  (Disable usb-bot device in QEMU (unsupported))
- Resolves: bz#1954750
  (firmware scheme for sev-es)- kvm-x86-Add-x86-rhel8.5-machine-types.patch [bz#1957838]
- kvm-redhat-x86-Enable-kvm-asyncpf-int-by-default.patch [bz#1967603]
- kvm-yank-Unregister-function-when-using-TLS-migration.patch [bz#1964326]
- Resolves: bz#1957838
  (8.5 machine types for x86)
- Resolves: bz#1967603
  (Enable interrupt based asynchronous page fault mechanism by default)
- Resolves: bz#1964326
  (Qemu core dump when do tls migration via tcp protocol)- kvm-pc-bios-s390-ccw-don-t-try-to-read-the-next-block-if.patch [bz#1965626]
- kvm-redhat-Install-the-s390-netboot.img-that-we-ve-built.patch [bz#1966463]
- kvm-sockets-update-SOCKET_ADDRESS_TYPE_FD-listen-2-backl.patch [bz#1967177]
- kvm-target-i386-sev-add-support-to-query-the-attestation.patch [bz#1957022]
- kvm-spapr-Don-t-hijack-current_machine-boot_order.patch [bz#1960119]
- kvm-target-i386-Add-CPU-model-versions-supporting-xsaves.patch [bz#1942914]
- kvm-spapr-Remove-stale-comment-about-power-saving-LPCR-b.patch [bz#1940731]
- kvm-spapr-Set-LPCR-to-current-AIL-mode-when-starting-a-n.patch [bz#1940731]
- Resolves: bz#1965626
  (RHEL8.2 - QEMU BIOS fails to read stage2 loader (kvm))
- Resolves: bz#1966463
  (Rebuild the s390-netboot.img for downstream instead of shipping the upstream image)
- Resolves: bz#1967177
  (QEMU 6.0.0 socket_get_fd() fails with the error "socket_get_fd: too many connections")
- Resolves: bz#1957022
  (SEV: Add support to query the attestation report)
- Resolves: bz#1960119
  ([regression]Failed to reset guest)
- Resolves: bz#1942914
  ([Hyper-V][RHEL8.4]Nested Hyper-V on KVM: On Intel CPU L1 2016 can not start with cpu model Skylake-Server-noTSX-IBRS or Skylake-Client-noTSX-IBRS)
- Resolves: bz#1940731
  ([ppc64le] Hotplug vcpu device hit call trace:[qemu output] KVM: unknown exit, hardware reason 7fff9ce87ed8)- kvm-virtio-net-failover-add-missing-remove_migration_sta.patch [bz#1953045]
- kvm-hw-arm-virt-Add-8.5-machine-type.patch [bz#1957667]
- kvm-hw-arm-virt-Disable-PL011-clock-migration-through-hw.patch [bz#1957667]
- kvm-arm-virt-Register-highmem-and-gic-version-as-class-p.patch [bz#1957667]
- kvm-virtio-blk-Fix-rollback-path-in-virtio_blk_data_plan.patch [bz#1927108]
- kvm-virtio-blk-Configure-all-host-notifiers-in-a-single-.patch [bz#1927108]
- kvm-virtio-scsi-Set-host-notifiers-and-callbacks-separat.patch [bz#1927108]
- kvm-virtio-scsi�x����� S�V����X�Mk�b��������������Ź�$U����������������Ź��Ĺ�#2227097 - wall(1) fail when trying to use seat0- fix #2180413 - Backport hint about systemd daemon-reload- improve #2160321 - [last] ut->ut_user is not null terminated- fix #2121699 - fstrim -av fails to trim root filesystem on Red Hat Coreos 
- fix #2142496 - update upstream tests
- fix #2149394 - umount outputs inaccurate error message when umount() fails with EACCES
- fix #2159544 - lslogins "Password is locked" status changed in util-linux-2.32.1-38
- fix #2160321 - [last] ut->ut_user is not null terminated- fix #2141969 - Add --cont-clock feature for libuuid and uuidd- improve tmpfiles.d use in spec file (related to #2059241)- update atari partition tests (related to #2060030)- fix #2060030 - Please backport patches for atari partition detection to RHEL 8
- fix #2069187 - Internal testsuite for lscpu failed on aarch64
- fix #2093166 - lslogins reports incorrect "Password is locked" status
- fix #2059241 - rpm -V / --verify reports bad user/group/mtime for /run/uuidd
- fix #2044592 - Move /var/log/lastlog ownership to systemd- fix #2058176 - losetup Retry LOOP_SET_STATUS64 on EAGAIN- rebuild after revert- change bug number (#2016229 to #2041498)- improve #2026511 fix - blkid fails to complete when targeting non-block devices
- fix #1950187 - Ambient capabilities failed to applied to non-root user- update lib-sys-add-sysfs_chrdev_devno_to_devname.patch (#2026511)- fix #1988955 - script command continues without stopping.
- fix #2041498 - incorrect partition size calculation for BLKPG_* ioctls
- fix #2011602 - logger from util-linux incorrectly handles long messages
- fix #1916151 - [RFE] spread fstrim.timer across time
- fix #1894192 - Update or backport setpriv --pdeathsig
- fix #2026511 - blkid fails to complete when targeting  non-block devices- fix #1906157 - after su from root to a normal user mesg is unable to show current status
- fix #1917852 - findmnt: add option to list all fs-independent flags
- fix #1922299 - throws error using /sbin/nologin: invalid option -- 'c'
- fix #1940607 - lsblk sometimes returns block devices in wrong order with --pairs
- fix #1919529 - [RFE] RHEL-8: Support option flags with mount(8) --bind
- fix #1946921 - RHEL8: mount --rbind -o rprivate doesn't do recursive bind mount- update lscpu-show-physical-socket-on-aarch64-without-ACPI-P.patch (#1882740)- update regression tests (related to #1900498)- fix #1884194 - RHEL-8: chrt command does not support the -R option
- fix #1855759 - mount.8: clarify (no)suid behavior on file capabilities
- fix #1861670 - lsblk can not show serial information for virtio disk
- fix #1883783 - lscpu: avoid segfault on PowerPC systems with valid hardware configurations
- fix #1900498 - libfdisk/libmount: backport two patches for upstream systemd
- fix #1883056 - lscpu support for Fujitsu A64FX
- fix #1882740 - lscpu: use SMBIOS Type 4 strings for CPU vendor and model on ARM- fix #1848919 - Update losetup man page to fix "--direct-io" defaults- fix #1826251 - remove MD metadata 0.90 based tests from util-linux CI
- fix #1812576 - RFE: Bitlocker detection for RHEL 8.3
- fix #1817726 - add libblkid BLOCK_SIZE
- fix #1803753 - RHEL-8: col struct char_str c_column field should be of unsigned type and/or larger than 16 bit
- fix #1812118 - mount -a always tries to mount smb3 share subdir despite being already mounted
- fix #1824727 - util-linux: Include python3-libmount package in the release
- fix #1829245 - mount -a tries to mount already mounted cifs shares when we cannot query up to root dir- improve CI tests portability to rhel-8 kernel- add git to BuildRequires due to autosetup -Sgit- fix spec file typo- fix test for #1739443- fix #1739443 - lscpu reports wrong hypervisor in nested virt on s390x
- fix #1743555 - command chfn adds some useless commas with GECOS information into /etc/password- fix error path in mountinfo patch (#1751447)- cleanup mountinfo libmount patch (#1751447)- fix #1751447 - improve /proc/self/mountinfo reliability- fix #1739179 - partx failed on nvme devices with exit code 1- fix�x��������������F����X��k�������������E��$U����������������E�D�F��h 'master' into master-error_proxy (vpodzime)
- Merge pull request #5 from vpodzime/master-not_implemented_error (vpodzime)
- Add a simple test for unloaded/unavailable functions (vpodzime)
- Unload the plugins properly when reinit() is called (vpodzime)
- Raise error/exception when an unimplemented function is called (#1201475) (vpodzime)
- Do an ugly but necessary hack to make local GI overrides work (vpodzime)
- Add the __dir__ method to ErrorProxy (vpodzime)
- Add a rationale for the ErrorProxy to the overrides' docstring (vpodzime)
- Add some basic info about GI overrides to the documentation (vpodzime)
- Use pylint to check for errors in python overrides (vpodzime)
- Add the first small test for the ErrorProxy (vpodzime)
- Put the GI overrides in a special dir so that they are preferred (vpodzime)
- Add a cache for attributes already resolved by ErrorProxy (vpodzime)
- Implement the ErrorProxy python class and use it (vpodzime)- Merge pull request #7 from vpodzime/master-fw_raid_fixes (vpodzime)
- Try a bit harder when trying to determine MD RAID name (#1207317) (vpodzime)
- Don't be naïve about mdadm --detail telling us what we want (#1207317) (vpodzime)
- Ignore libblockdev tarballs (vpodzime)
- Implement a test of btrfs_list_subvolumes on data from bug report (vpodzime)
- Implement a context manager for running tests with fake utils (vpodzime)
- Do not try to cannonicalize MD UUIDs if we didn't get them (#1207317) (vpodzime)
- Fix the table in roadmap.rst (vpodzime)
- Enrich the roadmap.rst file and add info about new plans (vpodzime)
- Sync spec file with downstream (vpodzime)- Merge pull request #6 from vpodzime/master-sort_btrfs_subvolumes (vpodzime)
- Don't be naïve about mdadm providing us data we would like (#1206394) (vpodzime)
- Sort BTRFS subvolumes in a way that child never appears before parent (#1201120) (vpodzime)
- Let libcryptsetup handle LUKSname->/dev/mapper/LUKSname for us (vpodzime)
- Fix the crypto_luks_resize and create a test for it (vpodzime)
- Add targets to create the SRPM and RPM files easily (vpodzime)
- Don't round up to multiple of PE size bigger than max value of the rtype (vpodzime)
- Mark majority of MD RAID tests as slow (vpodzime)
- Merge pull request #1 from dashea/file-paths (vpodzime)
- Don't report error for no loop device associated with given file (vpodzime)
- Skip the detail_data.clean check when running tests in Jenkins (vpodzime)
- Make package file paths more specific (dshea)
- Implement and use MD RAID-specific wait for tests (vpodzime)
- Try to give MD RAID time to sync things before querying them (vpodzime)
- Fix the default value of the BDMDDetailData.clean field (vpodzime)
- Do cleanup after every single MD RAID tests (vpodzime)
- Do cleanup after every single LVM test (vpodzime)
- Do cleanup after every single BTRFS test (vpodzime)
- Make sure the LUKS device is closed and removed after tests (vpodzime)
- Make sure DM maps from tests are removed after tests (vpodzime)
- Make sure that loop devices are deactivated after tests (vpodzime)
- Make the tearDown method of the mpath test case better visible (vpodzime)
- Make sure that the swap is deactivated after tests (vpodzime)
- Fix docstrings in tests' utils helper functions (vpodzime)
- Improve the logging tests in utils_test.py (vpodzime)
- Update the features.rst file (vpodzime)
- Update the roadmap (vpodzime)
- Don't check if we get a mountpoint for BTRFS operations (vpodzime)- Ship license as per packaging guidelines
- plugins-all should depend on base library too
- Add dev docs- Be ready for mdadm --examine to not provide some of the values we want (vpodzime)
- Add exit code information to exec logging (vpodzime)
- Improve and add tests (vpodzime)
- Mark the test_force_plugin and test_reload as slow (vpodzime)
- Make sure we get some devices when creating btrfs volume (vpodzime)
- Add override for the lvremove function (vpodzime)
- Do not create LUKS format with no passphrase and no key file (vpodzime)
- Make sure we use the /dev/mapper/... path for luks_status (vpodzime)- Don'�x�������������H6����X��kp������� O���D3�$T����������������D3C3E3�or 1.x which we no longer use- Rebuild due to mysql update.- rebuilt with new openssl- add missing buildrequires: on groff (#163032)- move the ldapdb auxprop support into a subpackage (#167300)
  (note: the ldap password check support in saslauthd doesn't use auxprop)- correct a use of uninitialized memory in the bundled libdb (Arjan van de Ven)- move the ANONYMOUS mech plugin to the -lib subpackage so that multilib
  systems can use it without installing the main package
- build the static libraries without sql auxprop support- update to 2.1.21
- turn off compilation of libsasl v1 (finally)
- explicitly disable sqlite to avoid the build warning
- change the default mechanism which is set for saslauthd from "shadow" to
  "pam" (#159194)
- split the shared library up from saslauthd so that multilib systems don't
  have to pull in every dependency of saslauthd for the compat arch (#166749)- rebuild with new deps- rebuild with new deps- rebuild against db-4.3.21.- build with mysql-devel instead of mysqlclient10- build with mysqlclient10 instead of mysql-devel- update to 2.1.20, including the fix for CAN-2004-0884- use notting's fix for incorrect patch for CAN-2004-0884 for 1.5.28- don't trust the environment in setuid/setgid contexts (CAN-2004-0884, #134660)- rebuild (the 2.1.19 changelog for fixing a buffer overflow referred to a CVS
  revision between 2.1.18 and 2.1.19)- update to 2.1.19, maybe for update- rebuilt- enable sql auxprop support in a subpackage
- include LDAP_SASLAUTHD documentation file (#124830)- turn on ntlm in a subpackage- removed rpath- turn on building of libsasl v1 again- update to 2.1.18
- saslauthd's ldap code is no longer marked experimental, so we build it- rebuild- rebuilt- rebuilt- include default /etc/sysconfig/saslauthd configuration file for the init
  script (#114868)- drop saslauthd_version patch for libsasl2- add a saslauthd_version option to libsasl's saslauthd client and teach it to
  do the right thing
- enable the saslauthd client code in libsasl version 1 (it's still going away!)
- add saslauthd1-checkpass/saslauthd2-checkpass for testing the above change- forcibly disable otp and sql plugins at compile-time- update to 2.1.17, forcing the gssapi plugin to be shared now, as before
- use a bundled libdb (#112215)
- build static-with-all-plugins and normal-shared libsasl versions
- add sasl2-{shared,static}-mechlist for very basic sanity checking
- make inclusion of sasl1 stuffs conditional, because it's so going away- rebuild against db-4.2.52.- use /dev/urandom instead of /dev/random for SASL2 (docs indicate that this is
  safe if you aren't using OTP or SRP, and we build neither); SASL1 appears to
  use it to seed the libc RNG only (#103378)- obey RPM_OPT_FLAGS again when krb5_prefix != %{_prefix}- install saslauthd's mdoc page instead of the pre-formatted man page, which
  would get formatted again- rebuild against db-4.2.42.- include testsaslauthd
- note in the README that the saslauthd protocol is different for v1 and v2,
  so v1's clients can't talk to the v2 server- rebuild- add logic to build with gssapi libs in either /usr or /usr/kerberos- rebuild- update to 2.1.15- update to 2.1.14- rebuilt- change -m argument to saslauthd to be a directory instead of a path- link libsasl2 with -lpthread to ensure that the sasldb plug-in can always
  be loaded- update to 2.1.13- rebuilt- rebuild- consider either des_cbc_encrypt or DES_cbc_encrypt to be sufficient when
  searching for a DES implementation in libcrypto
- pull in CPPFLAGS and LDFLAGS from openssl's pkg-config data, if it exists- rebuild- update to 2.1.10, fixing buffer overflows in libsasl2 noted by Timo Sirainen- remove files from $RPM_BUILD_ROOT that we don't intend to include- update to SASLv1 to final 1.5.28- rebuild, overriding sasldir when running make so that on multilib systems
  applications will be able to load modules for the right arch- include dbconverter-2 (#68741)- update to 2.1.7, fixing a race condition in digest-md5- update to 2.�x��������������%����X��l�`������6���=��$-����������������=�<��G�?�d����	�	-�X�\�t�x�������	�����",%�%		
%
T%�%W�%
Y4%]�%c�%i:iX%m�nDn�pv(p�8p�9p�:t�Gw(%H{�%I�P%X�xY��\��%]�8%^��b��d��e��f��l��t�%u��%v�(�w�%x�%y�<�����������$_�_
�����L�P%�xg�|h�Csvt-av1-libs0.8.71.el8SVT-AV1 librariesThe Scalable Video Technology for AV1 Encoder (SVT-AV1 Encoder) is an
AV1-compliant encoder library core. The SVT-AV1 development is a
work-in-progress targeting performance levels applicable to both VOD and Live
encoding / transcoding video applications.

This package contains SVT-AV1 libraries.c���build.cloudlinux.com���CloudLinuxCloudLinuxBSD and MIT and ISC and Public DomainCloudLinux Packaging Team <packager@cloudlinux.com>Unspecifiedhttps://gitlab.com/AOMediaCodec/SVT-AV1linuxx86_64++P`>!�jj?�d�#7+X�d�1�p@��D�"�W���4"1�� �;�? <���yA�O�V��0�F�U�������:�J����
�����&+�C	�S^&�"�J�PJf#$~�3j��wN3}M8�nL(�C{P@sy�$�8+�~qNl�G�Q6�"%�3K'{J�C"��O��)�e
LMqi�	`(;��"BVl�Z0�0$'�����.�9�;�I��]i�"�K]��p��3�X�3b��&9�vpa,j�P��A
�,�
b?+w0�?����<����"����I�$D������r�����E�sg�����'cD��~��b*�e(	�	�	�$�>�!4�[�9�O�=���������������&ja�B���4�8��;�"F��)�5�7�7tY3k��� ErP!��$�A�A�A�������A큤��A큤����������������������������������A큤����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������A큤��c���c���c���c���c���c���c��x������������������XI"l����������������������$0�����������������������eanup handling patch- ALTPHP-526: Updated patch for Litespeed SIGTERM cleanup handling- ALTPHP-511: added patches to avoid creating zombies when using lsphp- EA-7359: Ensure ea-libxml2 is listed as a requirement for the php-xml package.- EA4D-65: Added patch for LiteSpeed SIGTERM cleanup- EA4D-53: Update LSAPI to 7.1
- ALTPHP-491: add use_reject to LSPHP- ZC-3600: Update litespeed to the latest version (7.1).- EA-7382: Update dependency on ea-openssl to require the latest version with versioned symbols.- EA4D-4: Duplications in cli and litespeed were removed- EA4D-50: Change ea-openssl directory to /opt/cpanel/ea-openssl- ALTPHP-482: Fix for bug 75605 Dumpable FPM child processes allow bypassing opcache access controls* Mon Mar 20 2018 Cory McIntire <cory@cpanel.net> - 5.4.45-52
- ZC-3552: Added versioning to ea-openssl and libcurl requirements.- rebuild with ea-libnghttp2- ZC-3475: Update for ea-openssl shared object- HB-3287: Increase open file limit for php-fpm by default- Filter libxml2.so from requires- HB-3263: Ensure securetmp is done before starting FPM- EA-7044: Adjust PHPs to use ea-libxml2- ALTPHP-424: Add timestamps to LSPHP log messages- bug 75571: Potential infinite loop in gdImageCreateFromGifCtx
- bug 74782: Reflected XSS in .phar 404 page- HB-3061: Fix epoll bug.- EA-7008: init openssl for FTP like 7.x does- EA-6812: build PHP against ea-openssl like Apache- bug 75055 Out-Of-Bounds Read in timelib_meridian()
- bug 72535 arcfour encryption stream filter crashes php* Tue Oct 14 2017 <cory@cpanel.net> - 5.4.45-44
- EA-4653: Update mail header patch for PHP 5.4- HB-2873: Added network-online.target to "After" in the service file- EA-6819: Patch to support libtidy 5.4.0- EA-6805: Apply PHP_INI_SCAN_DIR patch to PHP 5.4- ALTPHP-380: added user.ini lookup in home dir
- ALTPHP-380: changed CRIU messaging- EA-4197: make php.ini directives consistent w/ other versions- ALTPHP-364: Added сorrect exit from lve if the nproc limit is reached- EA-6574: Make permissions on FPM socket dir more secure- add HardenedPHP patches:
- CVE-2017-11143: wddx parsing empty boolean tag leads to SIGSEGV
- CVE-2017-11144: negative-size-param (-1) in memcpy in zif_openssl_seal()
- CVE-2017-11145: wddx_deserialize() heap out-of-bound read via php_parse_date()
- CVE-2017-11146: wddx_deserialize() heap out-of-bound read via php_parse_date() (caused by CVE-2017-11145)
- CVE-2017-7890: Buffer over-read into uninitialized memory
- CVE-2017-9224: Buffer Overflow in match_at() (Oniguruma issue)
- CVE-2017-9226: Heap corruption in next_state_val() in 15 encodings (Oniguruma issue)
- CVE-2017-9227: Bug in mbc_enc_len() (Oniguruma issue)
- CVE-2017-9228: Heap corruption in next_state_val() due to uninitialized local variable (Oniguruma issue)
- CVE-2017-9229: SIGSEGV in left_adjust_char_head() due to bad dereference (Oniguruma issue)
- bug70436: Use After Free Vulnerability in unserialize()
- bug74087: Segmentation fault in PHP7.1.1(compiled using the bundled PCRE library)
- bug74603: PHP INI Parsing Stack Buffer Overflow Vulnerability
-
- add LSAPI patches:
- update Litespeed SAPI to 6.11
- ALTPHP-351: make lsphp error messaqges more informative
- ALTPHP-354: SIGCHILD handler fix after CRIU restoring- add require for ea-libnghttp2- EA-6484: Clarify Summary and Description for DSO- EA-6232: Build -curl with HTTP/2 support- LSPHP: fix php_value wrong priorities
- LSPHP: fix using options from .user.ini- Switch libxml2 to OS provided libraries- EA-6282: Swapped ea-php## symlinks to match EasyApache 3 compatibility- Switch libxml2 to cPanel distributed packages- Added ea-php54 symlinks to /usr/bin and /usr/local/bin- Disable dtrace functionality since CentOS does not provide dtrace via repos.- EA-6031: Enable mssql option and use our ea-freetds instead of freetds- ZC-2475: PHPs need build reqs when building for libcurl- EA-2422: Have PHPs use our ea-libcurl- ALTPHP-323: LSPHP: CRIU support added- EA-2422: use ea-libcurl instead of system curl package- add HaredenedPHP patches:�x������������������X��j���������{������DE�$T����������������DECEEE�11.5.2 firmware
- amdgpu: update vcn 5.0.0 firmware
- amdgpu: update smu 14.0.3 firmware
- amdgpu: update sdma 7.0.1 firmware
- amdgpu: update gc 14.0.3 firmware
- amdgpu: update gc 12.0.1 firmware
- amdgpu: update sienna cichlid firmware
- amdgpu: update yellow carp firmware
- amdgpu: update smu 14.0.2 firmware
- amdgpu: update psp 14.0.2 firmware
- amdgpu: update gc 12.0.0 firmware
- amdgpu: update vega20 firmware
- amdgpu: update navi14 firmware
- amdgpu: update vega12 firmware
- amdgpu: update vcn 4.0.4 firmware
- amdgpu: update psp 13.0.7 firmware
- amdgpu: update gc 11.0.2 firmware
- amdgpu: update vega10 firmware
- amdgpu: update vcn 3.1.2 firmware
- amdgpu: update gc 10.3.6 firmware
- amdgpu: update navi10 firmware
- amdgpu: update navi12 firmware
- amdgpu: update psp 13.0.10 firmware
- amdgpu: update gc 11.0.3 firmware
- amdgpu: update vangogh firmware
- amdgpu: update picasso firmware
- amdgpu: update vcn 4.0.0 firmware
- amdgpu: update psp 13.0.0 firmware
- amdgpu: update gc 11.0.0 firmware
- amdgpu: update psp 13.0.14 firmware
- amdgpu: update gc 9.4.4 firmware
- amdgpu: update psp 13.0.6 firmware
- amdgpu: update gc 9.4.3 firmware
- amdgpu: update beige goby firmware
- amdgpu: update gc 10.3.7 firmware
- amdgpu: update psp 14.0.1 firmware
- amdgpu: update gc 11.5.1 firmware
- amdgpu: update gc 11.0.4 firmware
- amdgpu: update dimgrey cavefish firmware
- amdgpu: update aldebaran firmware
- qcom: Update gpu firmwares for qcs8300 chipset
- linux-firmware: add firmware for qat_420xx devices
- amdgpu: DMCUB updates for various ASICs
- i915: Update Xe3LPD DMC to v2.20
- linux-firmware: update firmware for MT7925 WiFi device
- mediatek MT7925: update bluetooth firmware to 20250305133215
- mediatek MT7920: update bluetooth firmware to 20250210151502
- linux-firmware: Update firmware file for Intel BlazarU core
- linux-firmware: Update firmware file for Intel BlazarI core
- intel_vpu: Add firmware for 37xx and 40xx NPUs
- QCA: Add Bluetooth firmwares for QCA2066 with USB transport
- QCA: Add two bluetooth firmware nvm files for QCA2066
- QCA: Update Bluetooth QCA2066 firmware to 2.1.0-00653
- QCA: Update Bluetooth WCN685x 2.1 firmware to 2.1.0-00653
- cirrus: cs35l41: Add firmware and tuning for ASUS Consumer laptops
- cirrus: cs35l41: Add Firmware for various ASUS Commercial laptops
- ASoC: tas2781: Update dsp firmware for Gemtree project
- xe: Update GUC to v70.40.2 for BMG, LNL
- amdgpu: DMCUB updates for various ASICs
- amdgpu: DCUB update for DCN401 and DCN315
- cirrus: cs35l41: Add firmware and tunings for CS35L41 driver for Steam Deck
- ath11k: QCN9074 hw1.0: update to WLAN.HK.2.9.0.1-02175-QCAHKSWPL_SILICONZ-2
- ath11k: QCA6698AQ hw2.1: update to WLAN.HSP.1.1-04604-QCAHSPSWPL_V1_V2_SILICONZ_IOE-1
- ath11k: QCA6698AQ hw2.1: update board-2.bin
- rtw89: 8852bt: update fw to v0.29.122.0 and BB parameter to 07
- linux-firmware: Update AMD SEV firmware
- linux-firmware: update firmware for MT7920 WiFi device
- qca: update WCN3988 firmware
- amdgpu: Update ISP FW for isp v4.1.1
- qcom: add firmware for Adreno A225
- cirrus: cs35l56: Add and update firmware for Cirrus CS35L56 for two HP laptops
- cirrus: cs35l56: Add firmware for Cirrus Amps for some ASUS laptops
- cirrus: cs35l56: Add and update firmware for Cirrus CS35L56 for various Lenovo laptops
- cirrus: cs35l56: Update firmware for Cirrus Amps for some Dell laptops
- linux-firmware: update firmware for en8811h 2.5G ethernet phy
- i915: Update Xe3LPD DMC to v2.17
- ASoC: tas2781: Change regbin firmwares for single device
Resolves: RHEL-84781- Update linux-firmware to latest upstream (RHEL-79835)
  Changes since the last update are noted on items below, copied from
  the git changelog of upstream linux-firmware repository.
- i915: Update Xe2LPD DMC to v2.28
- ASoC: tas2781: Add regbin firmware by index for single device
- WHENCE: qca: add missing version information
- WHENCE: qca: add missing version information
- WHENCE: split generic QCA section into USB and serial sections
- rtl_bt: Update RTL8852B BT USB FW to 0x0474_842D
- iwlwi�x�������������(�����X��k@Q������PZ������>3�$.����������������>3?3�U��?~�d��
��	�	3����� �$�.�8�M�	���������	�(x	�
��
d�		|	�	�
@/
�/�/(E)L*+,- 8$�9|�:8��=t>t?t!@t)Dt1Gt<Ht�It�Xt�Yu\u4]u�^v�bw�dx�ex�fylytyuylvy�w}x}Ty}�1�~h�~l�~r�~�~�~�������
�H�q�������g��h��Ccyrus-sasl2.1.276.el8_5The Cyrus SASL libraryThe cyrus-sasl package contains the Cyrus implementation of SASL.
SASL is the Simple Authentication and Security Layer, a method for
adding authentication support to connection-based protocols.b��192-168-246-189.atm.cloudlinux.comWfAlmaLinuxAlmaLinuxBSD with advertisingAlmaLinux Packaging Team <packager@almalinux.org>System Environment/Librarieshttps://www.cyrusimap.org/sasl/linuxx86_64getent group saslauth >/dev/null || groupadd -g 76 -r saslauth
getent passwd saslauth >/dev/null || useradd -r -g saslauth -d /run/saslauthd -s /sbin/nologin -c "Saslauthd user" saslauth
if [ $1 -eq 1 ] ; then 
        # Initial installation 
        systemctl --no-reload preset saslauthd.service &>/dev/null || : 
fi
if [ $1 -eq 0 ] ; then 
        # Package removal, not upgrade 
        systemctl --no-reload disable --now saslauthd.service &>/dev/null || : 
fi
if [ $1 -ge 1 ] ; then 
        # Package upgrade, not uninstall 
        systemctl try-restart saslauthd.service &>/dev/null || : 
fi�!"RHy�B�$�
������A�A�A�A�������A큤����������b�tb��b��b��b��b��b��b��b��b�tb��b��b��b��V~�b��b�7b��b��b�745394f7413e0426d54af7a632a0148ea6d67687c02fcbd750261bba4838b22774f5b5bac8b16a23e23fc53f2d8bb069375379caf8144989f1e340b0e4c735c175dfe866f4230443de953e3f0ed5a249316804f5d7811cf191acf9aa153de2c4e5f2696ef87e697dfcdcb83b3fbe9a615ea27fbe8c815edbfe53f07c710d92a7ce13363e8d8c0523bf975d744fa1373467552d8a4e3ff70536c232769904dbc688f498814263b485b6810deca6728b7ce6e3ab89475434b5c697b9964a0d13c3c8dadac1f5c0dc87a4eb46e9558f4a613acb981dd52f8e6f0e503744f626ca0f0d3d223b454a775c07c57c488e494b5191c5fde8cd31d602d6c334ea8fd86f018ea80324cf7a1ab202088019bf0fcdc2d0e672aa8be79f85c7bce2a9e2fe5fada9357843e3f54c262fa9d3b746686739a03c9a94c7be51b5731d5944f50df0b9bb2d05ee7506c2f94794f44e77978eb5bb82429af8f80e0b60c83bfc3bd663ba5../../../../usr/sbin/pluginviewer../../../../usr/sbin/testsaslauthd../../../../usr/sbin/saslauthd@rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcyrus-sasl-2.1.27-6.el8_5.src.rpm�������������������������������������������������������������������������������config(cyrus-sasl)cyrus-saslcyrus-sasl(x86-64)group(saslauth)user(saslauth)	@@@@@@�x�������������������X��l�������(�������4�$y�����������������4�4�4�com> 0.32-1Nalin Dahyabhai <nalin@redhat.com> 0.31.5-2Nalin Dahyabhai <nalin@redhat.com> 0.31.5-1Nalin Dahyabhai <nalin@redhat.com> 0.31.4-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.31.3-3Nalin Dahyabhai <nalin@redhat.com> 0.31.3-2Nalin Dahyabhai <nalin@redhat.com> 0.31.3-1Nalin Dahyabhai <nalin@redhat.com> 0.31.2-3Nalin Dahyabhai <nalin@redhat.com> 0.31.2-2Nalin Dahyabhai <nalin@redhat.com> 0.31.2-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.31.1-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.31.1-2Nalin Dahyabhai <nalin@redhat.com> 0.31.1-1Nalin Dahyabhai <nalin@redhat.com>Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.31-2Nalin Dahyabhai <nalin@redhat.com> 0.31-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.30.2-3jkeating - 0.30.2-2Nalin Dahyabhai <nalin@redhat.com> 0.30.2-2Nalin Dahyabhai <nalin@redhat.com> 0.30.2-1Nalin Dahyabhai <nalin@redhat.com> 0.30.1-1Nalin Dahyabhai <nalin@redhat.com> 0.30-1Nalin Dahyabhai <nalin@redhat.com> - 0.29.1-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.29.1-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.29.1-3Ignacio Vazquez-Abrams <ivazqueznet+rpm@gmail.com> - 0.29.1-2Nalin Dahyabhai <nalin@redhat.com> 0.29.1-1Fedora Release Engineering <rel-eng@fedoraproject.org> - 0.29-2Nalin Dahyabhai <nalin@redhat.com> 0.29-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.28-1Nalin Dahyabhai <nalin@redhat.com> 0.27-8Nalin Dahyabhai <nalin@redhat.com> 0.27-7Nalin Dahyabhai <nalin@redhat.com> 0.27-6Nalin Dahyabhai <nalin@redhat.com> 0.27-5Nalin Dahyabhai <nalin@redhat.com> 0.27-4Nalin Dahyabhai <nalin@redhat.com> 0.27-3Nalin Dahyabhai <nalin@redhat.com> 0.27-2Nalin Dahyabhai <nalin@redhat.com> 0.27-1Nalin Dahyabhai <nalin@redhat.com> 0.26-4Nalin Dahyabhai <nalin@redhat.com> 0.26-3Nalin Dahyabhai <nalin@redhat.com> 0.26-2Nalin Dahyabhai <nalin@redhat.com> 0.26-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.25-8Nalin Dahyabhai <nalin@redhat.com> 0.25-7Nalin Dahyabhai <nalin@redhat.com> 0.25-6Nalin Dahyabhai <nalin@redhat.com> 0.25-5Nalin Dahyabhai <nalin@redhat.com> 0.25-4Nalin Dahyabhai <nalin@redhat.com> 0.25-3Nalin Dahyabhai <nalin@redhat.com> 0.25-2Nalin Dahyabhai <nalin@redhat.com> 0.25-1Nalin Dahyabhai <nalin@redhat.com> 0.24-1Nalin Dahyabhai <nalin@redhat.com> 0.23-3Nalin Dahyabhai <nalin@redhat.com> 0.23-2Nalin Dahyabhai <nalin@redhat.com> 0.23-1Nalin Dahyabhai <nalin@redhat.com> 0.22-1Nalin Dahyabhai <nalin@redhat.com> 0.21-3Nalin Dahyabhai <nalin@redhat.com> 0.21-2Nalin Dahyabhai <nalin@redhat.com> 0.21-1Nalin Dahyabhai <nalin@redhat.com> 0.20-1- Always set the home directory permissions according to HOME_MODE
- Resolves: rhbz#2135793- Add a non-default option to revert behavior for CVE-2020-10737 fix
- Resolved: rhbz#2050079- Upstream release 0.34.7
- Force LC_ALL=C.UTF-8 in oddjobd systemd service environment
- Resolves: rhbz#1907481 - oddjob locale issue
- Resolves: rhbz#1907541 - rebase oddjob to 0.34.7- Rebuild against RHEL 8.4.0
  Resolves: rhbz#1886433- Support HOME_MODE from /etc/login.defs
  Resolves: rhbz#1886433- Add gating tests using idm:DL1 module stream and upstream tests
  Resolves: rhbz#1682457- Upstream release 0.34.5
- Resolves: rhbz#1833289 - Rebase oddjob to 0.34.5
- Resolves: rhbz#1833052 - CVE-2020-10737 
  oddjob: race condition in oddjob_selinux_mkdir function in mkhomedir.c can lead to symlink attack- Drop Python 2 build-time dependency, which hasn't been used since we turned
  off building the python bindings years ago (#1595853, #1642502).- Rebuilt for https://fedoraproject.org/wiki/Fedora_29_Mass_Rebuild- Update Python 2 dependency declarations to new packaging standards
  (See https://fedoraproject.org/wiki/FinalizingFedoraSwitchtoPython3)- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_R�x������������������X�6k����������������&�$����������������&&�I)@?%(d����	�	4���������������	�)�P�V`
�
	�

�
�
�

(
P
�
��
�T�Q(�8�O9�O:NO> @ !G 0
H X
I �
X �Y �\ �
] �
^!cb!�d#e##f#&l#(t#@
u#h
v#�w$8
x$`
y$��$��$��$��%$%8%<�&�'�
(�(��)$)(
)4g)8h)<Clibpinyin2.2.02.el8Library to deal with pinyinThe libpinyin project aims to provide the algorithms core
for intelligent sentence-based Chinese pinyin input methods.b]�0x64-builder02.almalinux.org@TAlmaLinuxAlmaLinuxGPLv3+AlmaLinux Packaging Team <packager@almalinux.org>Unspecifiedhttps://github.com/libpinyin/libpinyinlinuxx86_64)�b�K�A�A�A���A큤����b]�/b]�/b]�/b]�+b]�+b]�/b]�/P~K�XSw�P~K�ef974bfbc7edc467f28fdab28ad17147f8b33300c9fc44ff5cece8e697bc42ff0ba6d49c905ac5c2510b5a162910d67ae7e295e24e24a3b97ba495e75dd837f68ceb4b9ee5adedde47b31e975c1d90c73ad27b6b165a1dcd80c7c545eb65b903fd9fd79be676b344eebd3bbe8812bcbb39b866f0e254f3200b6059932511d2c2../../../../usr/lib64/libpinyin.so.13.0.0libpinyin.so.13.0.0rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlibpinyin-2.2.0-2.el8.src.rpm����������������������������������������libpinyinlibpinyin(x86-64)libpinyin.so.13()(64bit)libpinyin.so.13(LIBPINYIN)(64bit)@@@@@@@@@@@@@@@@@



@/sbin/ldconfig/sbin/ldconfiglibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libglib-2.0.so.0()(64bit)libkyotocabinet.so.16()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libpinyin-data(x86-64)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libstdc++.so.6(CXXABI_1.3.8)(64bit)libstdc++.so.6(CXXABI_1.3.9)(64bit)libstdc++.so.6(GLIBCXX_3.4)(64bit)libstdc++.so.6(GLIBCXX_3.4.15)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)2.2.0-2.el83.0.4-14.6.0-14.0-15.2-14.14.3aM��Z��Zz�@Zi�Y���Y�@Yx�@Ycl@Y9<@X���X���X�f@X��@X��@X>�@X��W�@W���W��W��@W��V�=@Va�@VK�U�W�U��@U�a@UD�@T��@Tء@Tи@Tи@S�@S���R��@RnQ�Q���Q�)@Q�n@Q}@QM�@QG�Q9�Q4��Q/F�Qh@P�q�P���P{��PW�P+�@P��P��O�@O�0@O�/@OЗ�O�h�Oq��O;�@O:L�O8�@O%4�O�@O�O�N�V@N��@Nσ@N�H�N��@N���N�G�N�G�N�G�N�/�N�@Nh�@N^"@Peng Wu <pwu@redhat.com> - 2.2.0-2Peng Wu <pwu@redhat.com> - 2.2.0-1Fedora Release Engineering <releng@fedoraproject.org> - 2.1.91-2Peng Wu <pwu@redhat.com> - 2.1.91-1Peng Wu <pwu@redhat.com> - 2.1.0-1Fedora Release Engineering <releng@fedoraproject.org> - 2.0.92-3Fedora Release Engineering <releng@fedoraproject.org> - 2.0.92-2Peng Wu <pwu@redhat.com> - 2.0.92-1Peng Wu <pwu@redhat.com> - 2.0.91-1Peng Wu <pwu@redhat.com> - 2.0.0-1Peng Wu <pwu@redhat.com> - 1.9.92-1Peng Wu <pwu@redhat.com> - 1.9.91-2Peng Wu <pwu@redhat.com> - 1.9.91-1Fedora Release Engineering <releng@fedoraproject.org> - 1.7.0-2Peng Wu <pwu@redhat.com�x�������������������X��k��������Є:��$*����������������:�;�9��E-2024-8925: multipart form data parsing fix
- CVE-2024-8927: cgi.force_redirect configuration bypass
- CVE-2024-9026: error log parsing fix
- CVE-2025-14178: integer overflow in array_merge- remove ea-mod_php provide and require- EA4D-773: Rebuild ea-php80 on rhel>=9 with system libxml2 as cPanel- EA4D-746: Update php-fpm lve patch to extract doc_root from php_admin_values
  for CageFS per-domain isolation- EA4-136: Fix libxml2 v2.15.0 compatibility- EA4D-789: Security fixes
- CVE-2025-6491: fix NULL pointer dereference in PHP SOAP extension via large
  XML namespace prefix
- CVE-2025-1220: fix null byte termination in hostnames- EA4D-677: rebuild with new libtidy 5.8.0- EA4D-789: Security fixes
- CVE-2024-11235: use-after-free for ??= due to incorrect live-range
  calculation- EA4D-789: Security fixes
- CVE-2025-1217: http stream wrapper: fix handling folded headers
- CVE-2025-1734: http stream wrapper: fix handling headers with invalid name and no colon
- CVE-2025-1861: fix http redirect location truncation
- CVE-2025-1219: fix wrong `content-type` on redirect in libxml streams- EA4D-636: rebuild with ea-libicu 77- EA4D-789: Security fixes
- CVE-2024-11234: fix HTTP fulluri CRLF injection
- CVE-2024-8929: fix various heap buffer over-reads for mysqlnd
- CVE-2024-11233: fix single byte overread with convert.quoted-printable-decode
  filter
- CVE-2024-11236: prevent integer overflow in quoters causing OOB writes- ZC-12495: Do gcc like newer PHPs so that the libicu update won’t break the build- ZC-12246: Correct conffiles for Ubuntu- ALTPHP-1839: Change lsapi naming- ZC-12153: make opcache INI a configfile for debs- ZC-12114: Apply fix for libxml2- Fix for hardened PHP
- CVE-2024-3096: Disallow null character in bcrypt password to fix bug
  causing password_verify to erroneously return true
- CVE-2024-2756: fix __Host-/__Secure-cookie bypass due to partial
  CVE-2022-31629 fix- EA-10753: Have snmp module require 'snmp-mibs-downloader' for deb- EA4D-470: build with system libicu for RHEL >= 9- EA-11821: Patch to build with the latest ea-libxml2- ZC-11419: Correct Ubuntu Build issues- EA-11590: Update ea-php80 from v8.0.29 to v8.0.30
	- Libxml:
		Fixed bug GHSA-3qrf-m4j2-pcrr (Security issue with external entity loading in XML without enabling it). (CVE-2023-3823)
	- Phar:
		Fixed bug GHSA-jqcx-ccgc-xwhv (Buffer mismanagement in phar_dir_read()). (CVE-2023-3824)- EA-11475: Update ea-php80 from v8.0.28 to v8.0.29
    - Fixed bug GHSA-76gg-c692-v2mw
        (Missing error check and insufficient random bytes in HTTP Digest authentication for SOAP).- EA-11447: Increase default php memory_limit for new installs from 32M to 128M- ZC-10931: Link statically with libc-client- ZC-10950: Fix build problems- ZC-10936: Clean up Makefile and remove debug-package-nil- ZC-10873: Simplify the libidn deps, for building on Ubunut 20 and 22- EA-11227: Update ea-php80 from v8.0.27 to v8.0.28
- Fixed bug #81744 (Password_verify() always return true with some hash). (CVE-2023-0567)
- Fixed bug #81746 (1-byte array overrun in common path resolve code). (CVE-2023-0568)
- Fixed bug GHSA-54hq-v5wp-fqgv (DOS vulnerability when parsing multipart request body). (CVE-2023-0662)- EA-11075: Correct default value description for log_errors in php.ini- EA-11137: Update ea-php80 from v8.0.26 to v8.0.27
- PDO::quote() may return unquoted string). (CVE-2022-31631)- EA-11074: Update ea-php80 from v8.0.25 to v8.0.26- EA-11039: Ensure php.ini is marked as a config file on debian based systems- EA-11020: Update ea-php80 from v8.0.24 to v8.0.25
- GD: OOB read due to insufficient input validation in imageloadfont(). (CVE-2022-31630)
- Hash: buffer overflow in hash_update() on long parameter. (CVE-2022-37454)- EA-10961: Update ea-php80 from v8.0.23 to v8.0.24- ZC-10009: Add changes so that it builds on AlmaLinux 9- ZC-10260: Link deb against libcurl 4 explicitly- EA-10915: Update ea-php80 from v8.0.22 to v8.0.23- EA-10864: Update ea-php80 from v8.0.21 to v8.0.22- EA-10820: Update ea-php80 from v8.0.20�x�������������������X��l�d����;��$+����������������;�<�:��e5df1f8e4dcff1bfc5c54c8d541d12fdb8bd3d1a32b8f999f05fe2cd802d2b16eb944e1a9cec81c1fe016f2ca0c1cf7c76c2a78aa06224b213fa745da70edfba4f63e0ce0b4a7c843d05b0a66b6c34bb62cc00ad99711b404890585cc5caad3e7ab6880d1acbd8e9695df8c329206b754287a7449348321fdb37582a3dfe5e351c94e87712eccc0de4f3f72080f33cad4ef31ed416f4b01e06b45de59b1cd6c4199ccbf5cee610c174456425802e094dc2f1f145dd3f098e286fd4e2416440fd3462d3f8d39e7bb43d97fdd7ec621f7ae6980b4959ef9a7c572c7116369086d0ea1d5b58c92e851b37602217e299283688f4a972528ca71642cab1424cf35194e239403c380d8a4bcddb713bfb658d6ea4fbf428daad31ae5aa562aaf4e1c058189eb9b49af802c710092b88577dc35c18a33d1143c064ce8581d776be064c7e60557b68daa521452d7f4abef9df1b458d647e363ec73601ac1bc34283162e87ce3d04ce6de2c7dc81afd6c9a05547b71d3448b14abf76bf20a72904abc14b9add76e9e4567d0742b2998160a92b3d4643de766709915fc0595e175943f262491d43f8d7b22ee2546a41f6f7e9dcd17dd92d1ca982f3a65f32f4bd6bb2021fddde709f7b468e840c146687eedf6a272327e4df4273b8005b9162f7035cee577525f740188602d22c74748d27932a34f82424e22348535d1dd03710395eca82da0fa1c14f20e49ffb6b3d6da112399c801f47b24a958a2527d2bd06281642c1aa6c4d16cb7a800bfab5ee94a0b4eeeb91ffa628a7ca31043b566f4d06d7eb1ca718a2bb8734c351776a0cd7207328ed983d2682454f4e68feee6a70935ce2224b45338b6a905eb1b0347b2d32be055428bc93a219ca7c29dee5a136283a84ed0b4417af795662da076709e98ac8c362e97728cd064e0a653fdc0485470e552c878e16aacc09df0512b868caf83cf1a6880230354875caf109a4c25f6c47a99be8eb0360fe6e9e2541b998e1090b9d970ec025c8125d0429e116a7469dada5de45bd72a3a6d1a9c230d0638c8c89c7fd4eee6a1e2480d2ee6e615b0409839f26238c1f77379b660a045c93331c8824f19ffd6d38cc714b867096af9758f4b0c2ee2951a21899f8f54ddfbd7c32dc6db982d13c364098e180cb4be16f6dd9d0e7ab38bfb12d9f87c7fd7c6101c11de6beb0fd4d3a93d7f1deba6713909b24441b40b1d5b9a11424399bad715e612cc5830eb8b97627b2d33928d04ca8f98a0d9436f6466a062e1973f7ec71e2590a52b7bf9bf48e70b9ca728b570eee4e5a33d199769629816348b2d76f92e91e1f31ba493bf6b91cc3299c640a09418dcfc4f7b4cea5cb9f3815972104724d67cf7cc6f29c9d9b2f8805e5785cfe0083cdfb40cc6e8f0cc5fbc18f2bb9275cde8b6fcd70a7cd7eda19cdfa3b7d82524d1f4c29545342fbb230c52ea9abac948565c7597f5643bffd08f0afb21872c7b4628547882829efed24f4e895a6c142675e3c26bdeb5c4509c522f392e73a7569ca65ee074f781ed0b380c82a54b9657e2e09ad65e4b7c6710719ee1855a92c93d2a9a6f446067de2f4005a96a90bfc1e4309a3cf833893c1cb005662e67696888d7017961a4f905b5aa5d9abe67222ca5f5b1fa8220dc4eedb71aa7a02c1a55b9db38bdef0c4252c0b74f2e39ca4fe6b50fc47abcd8ba920e081fb1f262feb9454294be182469feba7c145e6328b9a4af126d5e985a3acc54547e98469d2ef263d051c7a483fa9a354f40b58e69ea20cd0f26f92c1fe414d55af4c402e1acc72931ee4f379c4656693cdfe9e0a878a8a5fcc8b96a372c160e12564b1bf67faacbff22b4f565895dee9fddfd1e6ca059a076d93e6fd0c8143a3b7352c1441b9d8ef27cb0c997d330fa11a4cceded87068b26f8a9035435cb4b9560baca488ec280ea6852229cf1391aba47c89c9532e490d9e327e1b2d5a16eec50ea67f0097e7939f25dff69887069e437d011bf3f507a348b791bb05f4b1a25a857603af800bbefebea55de6fdf8dfbcb75f93529336248d8c548d3fcdad419260f20fad7a4143b15e13e377d4f68f1fa013ca59d47a46aa8edb26cf7885bc18dc535da518edf006595b4ee49741ac885935f92c28593914a903d799f36928415d41e6be52454f4b8b3d76d79915497af5ed93f6c3adbe6f38aef45986ea407ed6ec40de8d865149e3e070f7f132d2cc28bc8887a0afdadfbd6b88142073dd84670919ac22fb3dbcc1c21b2046b6063c7ed465fa0e4d44686553092dc017fec112092aa1795e77cbd8e268ba6334f436dd220f6b73d1fc7a742ce8f7435e55b1f82d227f2e70bc8e3b317a58d9722b1f1efead63a31cfeb40d0fec20c5f6f9deedb67892de8a8195890eb081238df2b2659ed8bf37b30d08c13c218650284e923b3b585988fabc2f6deb0d3890e2264445c39f5360fbcf191e2163dc78ad5c6cecf3da4f805a83956525b3d83d0bcd8b17c4c400e28aaa89fc66ef233edfaf774a04f7f20976d3b1b48263d51b7e5ce3de966b521707001cf60dd8f0004414abeed1bbf37f6493eea77410fdc35287017eabc553a9a54df6511e3e253492ed1fddee16eb67b9ad25145ebf601637ac96adc661d24417836a73b94620c5d0cf84d92942ac1d36976f910fd81993a5d7e658f047e12565004e89fb400bba67c9a19535694d9f4983c2cf591de22aa1a3d3b6eb9092700125594030de36020942e82adddd4e045a16de543a912c88e6962946c66644dcdb36b1bbc14e13b51e0356561b2d53e0d2d7ab78ac4e277496e41af94043819e7b92dd408e9926dc4�x�������������p�����X�Wl`�������Ȟ
��$����������������
����t_irq: Assertion `kernel_xics_fd != -1' failed)
- Resolves: bz#1740692
  (Backport QEMU 4.1.0 rc5 & ga patches)
- Resolves: bz#1741451
  (Failed to hot-plug vcpus)- Rebase to qemu 4.1.0 rc4 [bz#1705235]
- Resolves: bz#1705235
  (Rebase qemu-kvm for RHEL-AV 8.1.0)- kvm-x86_64-rh-devices-add-missing-TPM-passthrough.patch [bz#1519013]
- kvm-x86_64-rh-devices-enable-TPM-emulation.patch [bz#1519013]
- kvm-vfio-increase-the-cap-on-number-of-assigned-devices-.patch [bz#1719823]
- Resolves: bz#1519013
  ([RFE] QEMU Software TPM support (vTPM, or TPM emulation))
- Resolves: bz#1719823
  ([RHEL 8.1] [RFE] increase the maximum of vfio devices to more than 32 in qemu-kvm)- kvm-qemu-kvm.spec-bump-libseccomp-2.4.0.patch [bz#1720306]
- kvm-qxl-check-release-info-object.patch [bz#1712717]
- kvm-target-i386-add-MDS-NO-feature.patch [bz#1722839]
- kvm-block-file-posix-Unaligned-O_DIRECT-block-status.patch [bz#1588356]
- kvm-iotests-Test-unaligned-raw-images-with-O_DIRECT.patch [bz#1588356]
- kvm-rh-set-CONFIG_BOCHS_DISPLAY-y-for-x86.patch [bz#1707118]
- Resolves: bz#1588356
  (qemu crashed on the source host when do storage migration with source qcow2 disk created by 'qemu-img')
- Resolves: bz#1707118
  (enable device: bochs-display (QEMU))
- Resolves: bz#1712717
  (CVE-2019-12155 qemu-kvm: QEMU: qxl: null pointer dereference while releasing spice resources [rhel-av-8])
- Resolves: bz#1720306
  (VM failed to start with error "failed to install seccomp syscall filter in the kernel")
- Resolves: bz#1722839
  ([Intel 8.1 FEAT] MDS_NO exposure to guest - Fast Train)- kvm-Disable-VXHS-support.patch [bz#1714937]
- kvm-aarch64-Add-virt-rhel8.1.0-machine-type-for-ARM.patch [bz#1713735]
- kvm-aarch64-Allow-ARM-VIRT-iommu-option-in-RHEL8.1-machi.patch [bz#1713735]
- kvm-usb-call-reset-handler-before-updating-state.patch [bz#1713679]
- kvm-usb-host-skip-reset-for-untouched-devices.patch [bz#1713679]
- kvm-usb-host-avoid-libusb_set_configuration-calls.patch [bz#1713679]
- kvm-aarch64-Compile-out-IOH3420.patch [bz#1627283]
- kvm-vl-Fix-drive-blockdev-persistent-reservation-managem.patch [bz#1714891]
- kvm-vl-Document-why-objects-are-delayed.patch [bz#1714891]
- Resolves: bz#1627283
  (Compile out IOH3420 on aarch64)
- Resolves: bz#1713679
  (Detached device when trying to upgrade USB device firmware when in doing USB Passthrough via QEMU)
- Resolves: bz#1713735
  (Allow ARM VIRT iommu option in RHEL8.1 machine)
- Resolves: bz#1714891
  (Guest with persistent reservation manager for a disk fails to start)
- Resolves: bz#1714937
  (Disable VXHS support)- kvm-redhat-fix-cut-n-paste-garbage-in-hw_compat-comments.patch [bz#1709726]
- kvm-compat-Generic-hw_compat_rhel_8_0.patch [bz#1709726]
- kvm-redhat-sync-pseries-rhel7.6.0-with-rhel-av-8.0.1.patch [bz#1709726]
- kvm-redhat-define-pseries-rhel8.1.0-machine-type.patch [bz#1709726]
- Resolves: bz#1709726
  (Forward and backward migration failed with "qemu-kvm: error while loading state for instance 0x0 of device 'spapr'")- kvm-target-i386-define-md-clear-bit.patch [bz#1703297 bz#1703304 bz#1703310 bz#1707274]
- Resolves: bz#1703297
  (CVE-2018-12126 virt:8.0.0/qemu-kvm: hardware: Microarchitectural Store Buffer Data Sampling (MSBDS) [rhel-av-8])
- Resolves: bz#1703304
  (CVE-2018-12130 virt:8.0.0/qemu-kvm: hardware: Microarchitectural Fill Buffer Data Sampling (MFBDS) [rhel-av-8])
- Resolves: bz#1703310
  (CVE-2018-12127 virt:8.0.0/qemu-kvm: hardware: Micro-architectural Load Port Data Sampling - Information Leak (MLPDS) [rhel-av-8])
- Resolves: bz#1707274
  (CVE-2019-11091 virt:8.0.0/qemu-kvm: hardware: Microarchitectural Data Sampling Uncacheable Memory (MDSUM) [rhel-av-8.1.0])- kvm-target-ppc-spapr-Add-SPAPR_CAP_LARGE_DECREMENTER.patch [bz#1698711]
- kvm-target-ppc-spapr-Add-workaround-option-to-SPAPR_CAP_.patch [bz#1698711]
- kvm-target-ppc-spapr-Add-SPAPR_CAP_CCF_ASSIST.patch [bz#1698711]
- kvm-target-ppc-tcg-make-spapr_caps-apply-cap-cfpc-sbbc-i.patch [bz#1698711]
- kvm-target-ppc-spapr-Enable-mitigations-by-default-for-p.patch [bz#1698711]
- kvm-slirp-ensure-there-is-�x������������������X��k��������H�������$
�����������������redhat.com> - 1.09-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.09-5Marcela Maslanova <mmaslano@redhat.com> - 1.09-4Marcela Maslanova <mmaslano@redhat.com> - 1.09-3Stepan Kasal <skasal@redhat.com> - 1.09-2Stepan Kasal <skasal@redhat.com> - 1.09-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.05-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.05-5Tom "spot" Callaway <tcallawa@redhat.com> - 0.05-4Tom "spot" Callaway <tcallawa@redhat.com> - 0.05-3Tom "spot" Callaway <tcallawa@redhat.com> - 0.05-2.1Jose Pedro Oliveira <jpo at di.uminho.pt> - 0.05-2Jose Pedro Oliveira <jpo at di.uminho.pt> - 0.05-1- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- update to 1.22- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Perl 5.26 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Perl 5.24 rebuild- update to 1.21- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- update to 1.19- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- No longer needs any non-core buildreqs, and hence bootstrapping
- Drop references to pwhich, which is no longer included
- This release by PLICEASE → update source URL- Perl 5.22 re-rebuild of bootstrapped packages- Perl 5.22 rebuild- update to 1.18- Specify all dependencies- Perl 5.20 re-rebuild of bootstrapped packages- Perl 5.20 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Perl 5.18 re-rebuild of bootstrapped packages- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Perl 5.18 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Specify all dependencies
- Modernize spec
- Drop command macros- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Perl 5.16 re-rebuild of bootstrapped packages- Perl 5.16 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Perl mass rebuild
- add perl_bootstrap macro- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- 661697 rebuild for fixing problems with vendorach/lib- Mass rebuild with perl-5.12.0- rebuild against perl 5.10.1- new upstream version- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Rebuild for perl 5.10 (again)- rebuild for new perl- correct license tag
- add BR: perl(ExtUtils::MakeMaker)- find: fixed arguments order.- First build.�1.221.22-2.el8perl-File-WhichChangesREADMEFile::Which.3pm.gzFileWhich.pm/usr/share/doc//usr/share/doc/perl-File-Which//usr/share/man/man3//usr/share/perl5/vendor_perl//usr/share/perl5/vendor_perl/File/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m32 -march=x86-64 -mtune=generic -mfpmath=sse -mstackrealign -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnudirectoryASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)Perl5 module source textPRRRRutf-822bb8bbf42457f71b05724e2a5a4f3bf117e8e05b73e62c3e7484aef612c9099?���@H@��`!
	Q�d~�����'�̶ٝYQcn��7�_.KW���!"Ђm���9�ɝ�vD���v����ZI�1��Շũ��R��@��s�$��9�H��K4��'M%��m�oc��k@L���(h>�Q䘑��Q�w�p�eum�D���n
	`�w� �	��M9޹�R�ᒾ����#��g��%�)��5�
Q�z;���<�[�Й�5S_�����F�G��+-���z�H����׍�r��3K�s���A֙�<���&�Q� H*.��1�5W��E��x��ZUg�r|�u•�P����s�B⛺�o��Vg��ќ�8�g���5�^�]S_�DzK��ܱyC�$n�*��\���K��#�~�H���}��zA-���꠽ʱ(#s�G���D�ڏ��`!
	Qֈx�����������X��k�	�����F3�$V����������������F3E3	lddir/build/BUILDROOT/cyrus-sasl-2.1.27-6.el8_5.x86_64/run/saslauthd' (No such file or directory)directoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=4f06b63134b56f78a17dd88f968d1ee902e14868, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=85ac574e6263605fd7cfcbdef6ec1ef3da43ed26, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=54d83aa20a127c1ea7d363d0499c9f989cafdc14, strippedtroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)&RRRR%RRR$RRRRRR
R)RR#RRRRRRRRRRR"R!R RR$RRRRRR
R)RRRR$RRRRRR
R)utf-812874676bbedd3256489951c67e5f6bf12c86253ba61a2bcb38e999bdde9e6a2?���`k��!�<���Q�d~���b�;
	Q�d~���I}���=�G�1�;��
��&�Jlk�I��aʡ��O��o�����:�&��-;*��+��6Zk@@��E3���3�G����iv�MJ�BV��b�n�kcW��v�Z���Gw	X��V��Pf��O�fA׆^��m;:H�~p�ce���Y��y��p+���G�Zn�"9���n��&D��q�0U٣��R賂U�e��������1f�d�Bzz���Bt��$�x}ɚ2�(;�l���0���k�q���AW���|i�ӹ��)Z�ࢪ�;���r<0��[B��.py���}@ČmxiÔ����ڱAk�9�ħ�x��we$
^�/��%�����8�x��v�[|2�sٜ�ƨ���4���B�~�i��,�U� ƽ��!�<��ΰ��Q�d~���b�;
	Q�d~���?���f��G5Rv�8�s>22��Uqw��V��<O'훅��qdC-]���8�C�����v��ͬ�����٪�ħ
[˭�҈R���@
����}�УWgxi5q�tWPtBؗzT�pQ6�);��^�g'���fj~t%Y�D�R�H�=�D��x>
+��d؀ۮ�Q{��B}�4]��c��!R�WR���Z/�p�o�]b���D�����~�;Y����Wq����u5!��<�0E�HF��BD������P=@���s-̴���W�G6%JD�B��%5�����(�%�s���Od	m�N%V��C�ӸI<R��0d1�̕լ�4�I�nI��,�mL�By�zNV=�!�*l�d*HwAa�8ݼ��00adad43d291e166b68dd7a95f99bd69c28901f5a105154e8489cd9a70a6508121785f4914a45db01d4e9e42e4a95ceadbd93f00i/'�cDi/&�4bit)u�	
alibgomp.so.1(GOMP_4.0)(64bit)	libgomp.so.1(GOMP_1.0)(64bit) ��flibgomp.so.1()(64bit)�"
#&
'(
*
+,/126	7
89(:;=
AD
FLM
PTUVZ
[\]
^defgh
ij	klmn	xz|�	�
�����
��	�
�
�����
���
������
���	�-0156:;C	DF	GQW
XYZahkly	�
�������&����������
�	����slibgobject-2.0.so.0()(64bit)l$libgnutls.so.30(GNUTLS_3_6_9)(64bit)5 uQ?^!z $libgnutls.so.30(GNUTLS_3_6_3)(64bit)cuPp%libgnutls.so.30(GNUTLS_3_6_10)(64bit)�A489'g
uOw
y��%#>
?^ hz�s"libgnutls.so.30(GNUTLS_3_4)(64bit).so�@4
89&g	uNwy��$">	?^huwz�1libgnutls.so.30()(64bit)l�x��������������o����X�Tk��������8������$?��������������������swap should automatically add selinux label to swapfile
- fix #180730 - col is exiting with 1 (fix util-linux-2.12p-col-EILSEQ.patch)
- fix #181896 - broken example in schedutils man pages
- fix #177331 - login omits pam_acct_mgmt & pam_chauthtok when authentication is skipped.
- fix #177523 - umount -a should not unmount sysfs
- fix #182553 - fdisk -l inside xen guest shows no disks- bump again for double-long bug on ppc(64)- add "blockdev --rmpart N <device>" and "blockdev --rmparts <device>"- rebuilt for new gcc4.1 snapshot and glibc changes- Updated the gssd_check() and idmapd_check(), used with
  nfsv4 mounts, to looked for the correct file in /var/lock/subsys
  which stops bogus warnings.- fix #174676 - hwclock audit return code mismatch
- fix #176441: col truncates data
- fix #174111 - mount allows loopback devices to be mounted more than once to the same mount point
- better wide chars usage in the cal command (based on the old 'moremisc' patch)- rebuilt- rebuilt- update to upstream version 2.13-pre6
- fix #172203 - mount man page in RHEL4 lacks any info on cifs mount options- fix #171337 - mkfs.cramfs doesn't work correctly with empty files- rebuild- updated version of the patch for hwclock audit- fix #171337 - mkfs.cramfs dies creating installer image- update to upstream 2.13pre5
- remove separated cramfs1.1 (already in upstream package)
- remove odd symlink /usr/bin/mkcramfs -> ../../sbin/mkfs.cramfs
- fix #170171 - ipcs -lm always report "max total shared memory (kbytes) = 0"* fix #170564 - add audit message to login- fix #169628 - /usr/bin/floppy doesn't work with /dev/fd0
- fix #168436 - login will attempt to run if it has no read/write access to its terminal
- fix #168434 - login's timeout can fail - needs to call siginterrupt(SIGALRM,1)
- fix #165253 - losetup missing option -a [new feature]
- update PAM files (replace pam_stack with new "include" PAM directive)
- remove kbdrate from src.rpm
- update to 2.13pre4- fix #170110 - Documentation for 'rsize' and 'wsize' NFS mount options
		is misleading- fix #166923 - hwclock will not run on a non audit-enabled kernel
- fix #159410 - mkswap(8) claims max swap area size is 2 GB
- fix #165863 - swsusp swaps should be reinitialized
- change /var/log/lastlog perms to 0644- /usr/share/misc/getopt/* -move-> /usr/share/doc/util-linux-2.13/getopt-*
- the arch command marked as deprecated
- removed: elvtune, rescuept and setfdprm
- removed: man8/sln.8 (moved to man-pages, see #10601)
- removed REDAME.pg and README.reset
- .spec file cleanup
- added schedutils (commands: chrt, ionice and taskset)- fix #159339 - util-linux updates for new audit system
- fix #158737 - sfdisk warning for large partitions, gpt
- fix #150912 - Add ocfs2 support
- NULL is better than zero at end of execl()- fix #157656 - CRM 546998: Possible bug in vipw, changes permissions of /etc/shadow and /etc/gshadow
- fix #159339 - util-linux updates for new audit system (pam_loginuid.so added to util-linux-selinux.pamd)
- fix #159418 - sfdisk unusable - crashes immediately on invocation
- fix #157674 - sync option on VFAT mount destroys flash drives
- fix .spec file /usr/sbin/{hwclock,clock} symlinks- rebuild against new libe2fsprogs (and libblkid) to fix cramfs auto-detection- rebuild- fix #156597 - look - doesn't work with separators- fix #154498 - util-linux login & pam session
- fix #155293 - man 5 nfs should include vers as a mount option
- fix #76467 - At boot time, fsck chokes on LVs listed by label in fstab
- new Source URL
- added note about ATAPI IDE floppy to fdformat.8
- fix #145355 - Man pages for fstab and fstab-sync in conflict- enable build with libblkid from e2fsprogs-devel
- remove workaround for duplicated labels- Fixed nfs mount to rollback correctly.- added /var/log/lastlog to util-linux (#151635)
- disabled 'newgrp' in util-linux (enabled in shadow-utils) (#149997, #151613)
- improved mtab lock (#143118)
- fixed ipcs typo (#151156)
- implemented mount workaround for duplicated labels (#116300)- rebuilt- Changed nfsmount to only�x�������������P_����X�Rm����{���q�$a����������������qH
�?
�
�
��!�	*�	X�����������	

 
'(
cX
lY
t

��
�h
�mQINBFz3zvsBEADJOIIWllGudxnpvJnkxQz2CtoWI7godVnoclrdl83kVjqSQp+2
dgxuG5mUiADUfYHaRQzxKw8efuQnwxzU9kZ70ngCxtmbQWGmUmfSThiapOz00018
+eo5MFabd2vdiGo1y+51m2sRDpN8qdCaqXko65cyMuLXrojJHIuvRA/x7iqOrRfy
a8x3OxC4PEgl5pgDnP8pVK0lLYncDEQCN76D9ubhZQWhISF/zJI+e806V71hzfyL
/Mt3mQm/li+lRKU25Usk9dWaf4NH/wZHMIPAkVJ4uD4H/uS49wqWnyiTYGT7hUbi
ecF7crhLCmlRzvJR8mkRP6/4T/F3tNDPWZeDNEDVFUkTFHNU6/h2+O398MNY/fOh
yKaNK3nnE0g6QJ1dOH31lXHARlpFOtWt3VmZU0JnWLeYdvap4Eff9qTWZJhI7Cq0
Wm8DgLUpXgNlkmquvE7P2W5EAr2E5AqKQoDbfw/GiWdRvHWKeNGMRLnGI3QuoX3U
pAlXD7v13VdZxNydvpeypbf/AfRyrHRKhkUj3cU1pYkM3DNZE77C5JUe6/0nxbt4
ETUZBTgLgYJGP8c7PbkVnO6I/KgL1jw+7MW6Az8Ox+RXZLyGMVmbW/TMc8haJfKL
MoUo3TVk8nPiUhoOC0/kI7j9ilFrBxBU5dUtF4ITAWc8xnG6jJs/IsvRpQARAQAB
tChGZWRvcmEgRVBFTCAoOCkgPGVwZWxAZmVkb3JhcHJvamVjdC5vcmc+iQI4BBMB
AgAiBQJc9877AhsPBgsJCAcDAgYVCAIJCgsEFgIDAQIeAQIXgAAKCRAh6kWrL4bW
oWagD/4xnLWws34GByVDQkjprk0fX7Iyhpm/U7BsIHKspHLL+Y46vAAGY/9vMvdE
0fcr9Ek2Zp7zE1RWmSCzzzUgTG6BFoTG1H4Fho/7Z8BXK/jybowXSZfqXnTOfhSF
alwDdwlSJvfYNV9MbyvbxN8qZRU1z7PEWZrIzFDDToFRk0R71zHpnPTNIJ5/YXTw
NqU9OxII8hMQj4ufF11040AJQZ7br3rzerlyBOB+Jd1zSPVrAPpeMyJppWFHSDAI
WK6x+am13VIInXtqB/Cz4GBHLFK5d2/IYspVw47Solj8jiFEtnAq6+1Aq5WH3iB4
bE2e6z00DSF93frwOyWN7WmPIoc2QsNRJhgfJC+isGQAwwq8xAbHEBeuyMG8GZjz
xohg0H4bOSEujVLTjH1xbAG4DnhWO/1VXLX+LXELycO8ZQTcjj/4AQKuo4wvMPrv
9A169oETG+VwQlNd74VBPGCvhnzwGXNbTK/KH1+WRH0YSb+41flB3NKhMSU6dGI0
SGtIxDSHhVVNmx2/6XiT9U/znrZsG5Kw8nIbbFz+9MGUUWgJMsd1Zl9R8gz7V9fp
n7L7y5LhJ8HOCMsY/Z7/7HUs+t/A1MI4g7Q5g5UuSZdgi0zxukiWuCkLeAiAP4y7
zKK4OjJ644NDcWCHa36znwVmkz3ixL8Q0auR15Oqq2BjR/fyog==
gpg-pubkey2f86d6a15cf7cefbgpg(Fedora EPEL (8) <epel@fedoraproject.org>)-----BEGIN PGP PUBLIC KEY BLOCK-----
Version: rpm-4.14.3 (NSS-3)

mQINBFz3zvsBEADJOIIWllGudxnpvJnkxQz2CtoWI7godVnoclrdl83kVjqSQp+2
dgxuG5mUiADUfYHaRQzxKw8efuQnwxzU9kZ70ngCxtmbQWGmUmfSThiapOz00018
+eo5MFabd2vdiGo1y+51m2sRDpN8qdCaqXko65cyMuLXrojJHIuvRA/x7iqOrRfy
a8x3OxC4PEgl5pgDnP8pVK0lLYncDEQCN76D9ubhZQWhISF/zJI+e806V71hzfyL
/Mt3mQm/li+lRKU25Usk9dWaf4NH/wZHMIPAkVJ4uD4H/uS49wqWnyiTYGT7hUbi
ecF7crhLCmlRzvJR8mkRP6/4T/F3tNDPWZeDNEDVFUkTFHNU6/h2+O398MNY/fOh
yKaNK3nnE0g6QJ1dOH31lXHARlpFOtWt3VmZU0JnWLeYdvap4Eff9qTWZJhI7Cq0
Wm8DgLUpXgNlkmquvE7P2W5EAr2E5AqKQoDbfw/GiWdRvHWKeNGMRLnGI3QuoX3U
pAlXD7v13VdZxNydvpeypbf/AfRyrHRKhkUj3cU1pYkM3DNZE77C5JUe6/0nxbt4
ETUZBTgLgYJGP8c7PbkVnO6I/KgL1jw+7MW6Az8Ox+RXZLyGMVmbW/TMc8haJfKL
MoUo3TVk8nPiUhoOC0/kI7j9ilFrBxBU5dUtF4ITAWc8xnG6jJs/IsvRpQARAQAB
tChGZWRvcmEgRVBFTCAoOCkgPGVwZWxAZmVkb3JhcHJvamVjdC5vcmc+iQI4BBMB
AgAiBQJc9877AhsPBgsJCAcDAgYVCAIJCgsEFgIDAQIeAQIXgAAKCRAh6kWrL4bW
oWagD/4xnLWws34GByVDQkjprk0fX7Iyhpm/U7BsIHKspHLL+Y46vAAGY/9vMvdE
0fcr9Ek2Zp7zE1RWmSCzzzUgTG6BFoTG1H4Fho/7Z8BXK/jybowXSZfqXnTOfhSF
alwDdwlSJvfYNV9MbyvbxN8qZRU1z7PEWZrIzFDDToFRk0R71zHpnPTNIJ5/YXTw
NqU9OxII8hMQj4ufF11040AJQZ7br3rzerlyBOB+Jd1zSPVrAPpeMyJppWFHSDAI
WK6x+am13VIInXtqB/Cz4GBHLFK5d2/IYspVw47Solj8jiFEtnAq6+1Aq5WH3iB4
bE2e6z00DSF93frwOyWN7WmPIoc2QsNRJhgfJC+isGQAwwq8xAbHEBeuyMG8GZjz
xohg0H4bOSEujVLTjH1xbAG4DnhWO/1VXLX+LXELycO8ZQTcjj/4AQKuo4wvMPrv
9A169oETG+VwQlNd74VBPGCvhnzwGXNbTK/KH1+WRH0YSb+41flB3NKhMSU6dGI0
SGtIxDSHhVVNmx2/6XiT9U/znrZsG5Kw8nIbbFz+9MGUUWgJMsd1Zl9R8gz7V9fp
n7L7y5LhJ8HOCMsY/Z7/7HUs+t/A1MI4g7Q5g5UuSZdgi0zxukiWuCkLeAiAP4y7
zKK4OjJ644NDcWCHa36znwVmkz3ixL8Q0auR15Oqq2BjR/fyog==
=84m8
-----END PGP PUBLIC KEY BLOCK-----
\��localhostpubkeyFedora EPEL (8) <epel@fedoraproject.org>Public Keys(none)gpg(Fedora EPEL (8) <epel@fedoraproject.org>)gpg(2f86d6a1)4.14.34:21ea45ab2f86d6a1-5cf7cefb4:21ea45ab2f86d6a1-5cf7cefb?����62c26490e79c69d544c2071bc8e34302590375adi0;i0;^=Q@]�Y�]�V�]Y=�]Y=�]8H@]�\�F@\o�@\\�\N�\/J�\�@[��[�;@[�;@[��[b�@[P}@[D��[;e@['��Z�4@Z}�@Z|;�ZT��Z8�@Z2g�Y�Z@Y�d�Y�*@Y�X@Y�@Y}�@Yx�@Yw2�YT�Y:��Y;@Y�x��������������N����X�>l��������XQ������&��$6����������������&�'�%��ait_kick-add-missing-memory-barrier.patch [bz#2168472]
- kvm-qatomic-add-smp_mb__before-after_rmw.patch [bz#2168472]
- kvm-qemu-thread-posix-cleanup-fix-document-QemuEvent.patch [bz#2168472]
- kvm-qemu-thread-win32-cleanup-fix-document-QemuEvent.patch [bz#2168472]
- kvm-edu-add-smp_mb__after_rmw.patch [bz#2168472]
- kvm-aio-wait-switch-to-smp_mb__after_rmw.patch [bz#2168472]
- kvm-qemu-coroutine-lock-add-smp_mb__after_rmw.patch [bz#2168472]
- kvm-physmem-add-missing-memory-barrier.patch [bz#2168472]
- kvm-async-update-documentation-of-the-memory-barriers.patch [bz#2168472]
- kvm-async-clarify-usage-of-barriers-in-the-polling-case.patch [bz#2168472]
- kvm-scsi-protect-req-aiocb-with-AioContext-lock.patch [bz#2090990]
- kvm-dma-helpers-prevent-dma_blk_cb-vs-dma_aio_cancel-rac.patch [bz#2090990]
- kvm-virtio-scsi-reset-SCSI-devices-from-main-loop-thread.patch [bz#2090990]
- Resolves: bz#2168472
  (Guest hangs when starting or rebooting)
- Resolves: bz#2090990
  (qemu crash with error scsi_req_unref(SCSIRequest *): Assertion `req->refcount > 0' failed or scsi_dma_complete(void *, int): Assertion `r->req.aiocb != NULL' failed [8.7.0])- kvm-io-Add-support-for-MSG_PEEK-for-socket-channel.patch [bz#2137740]
- kvm-migration-check-magic-value-for-deciding-the-mapping.patch [bz#2137740]
- kvm-target-s390x-arch_dump-Fix-memory-corruption-in-s390.patch [bz#2168187]
- Resolves: bz#2137740
  (Multifd migration fails under a weak network/socket ordering race)
- Resolves: bz#2168187
  ([s390x] qemu-kvm coredumps when SE crashes)- kvm-qcow2-Fix-theoretical-corruption-in-store_bitmap-err.patch [bz#2147617]
- kvm-qemu-img-commit-Report-errors-while-closing-the-imag.patch [bz#2147617]
- kvm-qemu-img-bitmap-Report-errors-while-closing-the-imag.patch [bz#2147617]
- kvm-qemu-iotests-Test-qemu-img-bitmap-commit-exit-code-o.patch [bz#2147617]
- Resolves: bz#2147617
  (qemu-img finishes successfully while having errors in commit or bitmaps operations)- kvm-block-mirror-Do-not-wait-for-active-writes.patch [bz#2125119]
- kvm-block-mirror-Drop-mirror_wait_for_any_operation.patch [bz#2125119]
- kvm-block-mirror-Fix-NULL-s-job-in-active-writes.patch [bz#2125119]
- kvm-accel-introduce-accelerator-blocker-API.patch [bz#2161188]
- kvm-KVM-keep-track-of-running-ioctls.patch [bz#2161188]
- kvm-kvm-Atomic-memslot-updates.patch [bz#2161188]
- kvm-migration-Read-state-once.patch [bz#2074205]
- kvm-s390x-pci-RPCIT-second-pass-when-mappings-exhausted.patch [bz#2163713]
- kvm-s390x-pci-coalesce-unmap-operations.patch [bz#2163713]
- kvm-s390x-pci-shrink-DMA-aperture-to-be-bound-by-vfio-DM.patch [bz#2163713]
- kvm-s390x-pci-reset-ISM-passthrough-devices-on-shutdown-.patch [bz#2163713]
- Resolves: bz#2125119
  (Mirror job with "copy-mode":"write-blocking" that used for storage migration can't converge under heavy I/O)
- Resolves: bz#2161188
  (SVM: non atomic memslot updates cause boot failure with seabios and cpu-pm=on)
- Resolves: bz#2074205
  (while live-migrating many instances concurrently, libvirt sometimes return internal error: migration was active, but no RAM info was set)
- Resolves: bz#2163713
  ([s390x] VM fails to start with ISM passed through)- kvm-s390x-tod-kvm-don-t-save-restore-the-TOD-in-PV-guest.patch [bz#2155448]
- Resolves: bz#2155448
  (RHEL8.8 - KVM: s390: pv: don't allow userspace to set the clock under PV - QEMU part)- kvm-hw-display-qxl-Have-qxl_log_command-Return-early-if-.patch [bz#2148545]
- kvm-hw-display-qxl-Document-qxl_phys2virt.patch [bz#2148545]
- kvm-hw-display-qxl-Pass-requested-buffer-size-to-qxl_phy.patch [bz#2148545]
- kvm-hw-display-qxl-Avoid-buffer-overrun-in-qxl_phys2virt.patch [bz#2148545]
- kvm-hw-display-qxl-Assert-memory-slot-fits-in-preallocat.patch [bz#2148545]
- Resolves: bz#2148545
  (CVE-2022-4144 virt:rhel/qemu-kvm: QEMU: QXL: qxl_phys2virt unsafe address translation can lead to out-of-bounds read [rhel-8])- kvm-docs-system-s390x-Document-the-loadparm-machine-prop.patch [bz#2128225]
- kvm-s390x-Register-TYPE_S390_CCW_MACHINE-properties-as-c.patch [bz#2128225]
- kvm-ui-vnc.c-Fixed-a-�x�������������@>����X�YmHV�������R�����$?�������������������`?
��$�-�	6�	r��������	JV](�X�Y�
,�Xh\mQINBGG4urcBEACrbsRa7tSSyxSfFkB+KXSbNM9rxYqoB78u107skReefq4/+Y72
TpDvlDZLmdv/lK0IpLa3bnvsM9IE1trNLrfi+JES62kaQ6hePPgn2RqxyIirt2se
Si3Z3n3jlEg+mSdhAvW+b+hFnqxo+TY0U+RBwDi4oO0YzHefkYPSmNPdlxRPQBMv
4GPTNfxERx6XvVSPcL1+jQ4R2cQFBryNhidBFIkoCOszjWhm+WnbURsLheBp757l
qEyrpCufz77zlq2gEi+wtPHItfqsx3rzxSRqatztMGYZpNUHNBJkr13npZtGW+kd
N/xu980QLZxN+bZ88pNoOuzD6dKcpMJ0LkdUmTx5z9ewiFiFbUDzZ7PECOm2g3ve
Jrwr79CXDLE1+39Hr8rDM2kDhSr9tAlPTnHVDcaYIGgSNIBcYfLmt91133klHQHB
IdWCNVtWJjq5YcLQJ9TxG9GQzgABPrm6NDd1t9j7w1L7uwBvMB1wgpirRTPVfnUS
Cd+025PEF+wTcBhfnzLtFj5xD7mNsmDmeHkF/sDfNOfAzTE1v2wq0ndYU60xbL6/
yl/Nipyr7WiQjCG0m3WfkjjVDTfs7/DXUqHFDOu4WMF9v+oqwpJXmAeGhQTWZC/Q
hWtrjrNJAgwKpp263gDSdW70ekhRzsok1HJwX1SfxHJYCMFs2aH6ppzNsQARAQAB
tDZNeVNRTCBSZWxlYXNlIEVuZ2luZWVyaW5nIDxteXNxbC1idWlsZEBvc3Mub3Jh
Y2xlLmNvbT6JAlQEEwEIAD4WIQSFm+jXxYb1OEMLGcJGe5QtOnm9KQUCYbi6twIb
AwUJA8JnAAULCQgHAgYVCgkICwIEFgIDAQIeAQIXgAAKCRBGe5QtOnm9KUewD/99
2sS31WLGoUQ6NoL7qOB4CErkqXtMzpJAKKg2jtBGG3rKE1/0VAg1D8AwEK4LcCO4
07wohnH0hNiUbeDck5x20pgS5SplQpuXX1K9vPzHeL/WNTb98S3H2Mzj4o9obED6
Ey52tTupttMF8pC9TJ93LxbJlCHIKKwCA1cXud3GycRN72eqSqZfJGdsaeWLmFmH
f6oee27d8XLoNjbyAxna/4jdWoTqmp8oT3bgv/TBco23NzqUSVPi+7ljS1hHvcJu
oJYqaztGrAEf/lWIGdfl/kLEh8IYx8OBNUojh9mzCDlwbs83CBqoUdlzLNDdwmzu
34Aw7xK14RAVinGFCpo/7EWoX6weyB/zqevUIIE89UABTeFoGih/hx2jdQV/NQNt
hWTW0jH0hmPnajBVAJPYwAuO82rx2pnZCxDATMn0elOkTue3PCmzHBF/GT6c65aQ
C4aojj0+Veh787QllQ9FrWbwnTz+4fNzU/MBZtyLZ4JnsiWUs9eJ2V1g/A+RiIKu
357Qgy1ytLqlgYiWfzHFlYjdtbPYKjDaScnvtY8VO2Rktm7XiV4zKFKiaWp+vuVY
pR0/7Adgnlj5Jt9lQQGOr+Z2VYx8SvBcC+by3XAtYkRHtX5u4MLlVS3gcoWfDiWw
CpvqdK21EsXjQJxRr3dbSn0HaVj4FJZX0QQ7WZm6WLkCDQRhuLq3ARAA6RYjqfC0
YcLGKvHhoBnsX29vy9Wn1y2JYpEnPUIB8X0VOyz5/ALv4Hqtl4THkH+mmMuhtndo
q2BkCCk508jWBvKS1S+Bd2esB45BDDmIhuX3ozu9Xza4i1FsPnLkQ0uMZJv30ls2
pXFmskhYyzmo6aOmH2536LdtPSlXtywfNV1HEr69V/AHbrEzfoQkJ/qvPzELBOjf
jwtDPDePiVgW9LhktzVzn/BjO7XlJxw4PGcxJG6VApsXmM3t2fPN9eIHDUq8ocbH
dJ4en8/bJDXZd9ebQoILUuCg46hE3p6nTXfnPwSRnIRnsgCzeAz4rxDR4/Gv1Xpz
v5wqpL21XQi3nvZKlcv7J1IRVdphK66De9GpVQVTqC102gqJUErdjGmxmyCA1OOO
RqEPfKTrXz5YUGsWwpH+4xCuNQP0qmreRw3ghrH8potIr0iOVXFic5vJfBTgtcuE
B6E6ulAN+3jqBGTaBML0jxgj3Z5VC5HKVbpg2DbB/wMrLwFHNAbzV5hj2Os5Zmva
0ySP1YHB26pAW8dwB38GBaQvfZq3ezM4cRAo/iJ/GsVE98dZEBO+Ml+0KYj+ZG+v
yxzo20sweun7ZKT+9qZM90f6cQ3zqX6IfXZHHmQJBNv73mcZWNhDQOHs4wBoq+FG
QWNqLU9xaZxdXw80r1viDAwOy13EUtcVbTkAEQEAAYkCPAQYAQgAJhYhBIWb6NfF
hvU4QwsZwkZ7lC06eb0pBQJhuLq3AhsMBQkDwmcAAAoJEEZ7lC06eb0pSi8P/iy+
dNnxrtiENn9vkkA7AmZ8RsvPXYVeDCDSsL7UfhbS77r2L1qTa2aB3gAZUDIOXln5
1lSxMeeLtOequLMEV2Xi5km70rdtnja5SmWfc9fyExunXnsOhg6UG872At5CGEZU
0c2Nt/hlGtOR3xbt3O/Uwl+dErQPA4BUbW5K1T7OC6oPvtlKfF4bGZFloHgt2yE9
YSNWZsTPe6XJSapemHZLPOxJLnhs3VBirWE31QS0bRl5AzlO/fg7ia65vQGMOCOT
LpgChTbcZHtozeFqva4IeEgE4xN+6r8WtgSYeGGDRmeMEVjPM9dzQObf+SvGd58u
2z9f2agPK1H32c69RLoA0mHRe7Wkv4izeJUc5tumUY0e8OjdenZZjT3hjLh6tM+m
rp2oWnQIoed4LxUw1dhMOj0rYXv6laLGJ1FsW5eSke7ohBLcfBBTKnMCBohROHy2
E63Wggfsdn3UYzfqZ8cfbXetkXuLS/OM3MXbiNjg+ElYzjgWrkayu7yLakZx+mx6
sHPIJYm2hzkniMG29d5mGl7ZT9emP9b+CfqGUxoXJkjs0gnDl44bwGJ0dmIBu3aj
VAaHODXyY/zdDMGjskfEYbNXCAY2FRZSE58tgTvPKD++Kd2KGplMU2EIFT7JYfKh
HAB5DGMkx92HUMidsTSKHe+QnnnoFmu4gnmDU31i
gpg-pubkey3a79bd2961b8bab7gpg(MySQL Release Engineering <mysql-build@oss.oracle.com>)-----BEGIN PGP PUBLIC KEY BLOCK-----
Version: rpm-4.14.3 (NSS-3)

mQINBGG4urcBEACrbsRa7tSSyxSfFkB+KXSbNM9rxYqoB78u107skReefq4/+Y72
TpDvlDZLmdv/lK0IpLa3bnvsM9IE1trNLrfi+JES62kaQ6hePPgn2RqxyIirt2se
Si3Z3n3jlEg+mSdhAvW+b+hFnqxo+TY0U+RBwDi4oO0YzHefkYPSmNPdlxRPQBMv
4GPTNfxERx6XvVSPcL1+jQ4R2cQFBryNhidBFIkoCOszjWhm+WnbURsLheBp757l
qEyrpCufz77zlq2gEi+wtPHItfqsx3rzxSRqatztMGYZpNUHNBJkr13npZtGW+kd
N/xu980QLZxN+bZ88pNoOuzD6dKcpMJ0LkdUmTx5z9ewiFiFbUDzZ7PECOm2g3ve
Jrwr79CXDLE1+39Hr8rDM2kDhSr9tAlPTnHVDcaYIGgSNIBcYfLmt91133klHQHB
IdWCNVtWJjq5YcLQJ9T�x�������������X-����XV4m�������H@���'������$7����������������'�&�(�� Fix bug #79528: Different object of the same xml between 7.4.5 and 7.4.4- Fix: Fix bug #79200 Some iconv functions cut Windows-1258- Fix bug #61597: SXE properties may lack attributes and content
- Fix bug #74940: DateTimeZone loose comparison always true
- Fix bug #75673: SplStack::unserialize() behavior
- Fix bug #79200: Some iconv functions cut Windows-1258
- Fix bug #79296: ZipArchive::open fails on empty file
- Fix bug #79330: shell_exec() silently truncates after a null byte
- Fix bug #79364: When copy empty array, next key is unspecified
- Fix bug #79396: setting Date/Time during a forward DST transition
- Fix bug #79410: system() swallows last chunk if it is exactly 4095 bytes without newline
- Fix bug #79424: php_zip_glob uses gl_pathc after call to globfree
- Fix bug #79465: OOB Read in urldecode() (CVE-2020-7067)- EA-8928: Updated the required version for ea-libcurl- Fix bug #79078: Hypothetical use-after-free in curl_multi_add_handle
- Fix bug #79282: Use-of-uninitialized-value in exif (CVE-2020-7064)
- Fix bug #79329: get_headers silently truncates after a null byte (CVE-2020-7066)- Fix bug #79099: OOB read in php_strip_tags_ex (CVE-2020-7059)
- Fix bug #79037: global buffer-overflow in `mbfl_filt_conv_big5_wchar` (CVE-2020-7060)
- Fix bug #79082: Files added to tar with Phar::buildFromIterator have all-access permissions (CVE-2020-7063)
- Fix bug #79221: Null Pointer Dereference in PHP Session Upload Progress (CVE-2020-7062)- ZC-6270: Fix circular deps like EA-8854- ZC-6247: Remove multiple conflicts between php-fpm and other rpms- MODLS-735: Delete criu images for host/user when lsapi_backend_pgrp_max_crashes triggered- Fixed bug #78793 (Use-after-free in exif parsing under memory sanitizer)
- Fixed bug #78878 (Buffer underflow in bc_shift_addsub). (CVE-2019-11046)
- Fixed bug #78910 (Heap-buffer-overflow READ in exif). (CVE-2019-11047)
- Fixed bug #78863 (DirectoryIterator class silently truncates after a nullbyte). (CVE-2019-11045)
- Updated Litespeed SAPI to 7.6- EA-8762: Update litespeed from upstream to 7.6- Fix #76342: file_get_contents waits twice specified timeout
- Fix #76859 stream_get_line skips data if used with data-generating filter
- Fix #78413: php-fpm request_terminate_timeout does not take effect after fastcgi_finish_request
- Fix #78579: mb_decode_numericentity: args number inconsistency
- Fix bug #78599 (env_path_info underflow can lead to RCE) (CVE-2019-11043)- ZC-4361: Fix bogus changelog dates- Fixed CVE-2019-13224- Apply allow_coredump patch for MODLS-694- EA-8549: Build php-fpm with pcntl- MODLS-689: Apply crash_limit patch- Fix #69100: Bus error from stream_copy_to_stream
- Fix #75457: heap-use-after-free
- Fix #77946: Bad cURL resources returned by curl_multi_info_read
- Fix #78333: Exif crash (bus error) due to wrong alignment and invalid cast
- Fix #78342: Bus error in configure test for iconv //IGNORE
- Fix #78379: (Cast to object confuses GC, causes crash)- Fix bug #77124
- Fix bug #78192 PDO SQLite SegFault when reuse statement after schema has changed
- Fix #78202: Opcache stats for cache hits are capped at 32bit NUM
- Fix #78212: Segfault in built-in webserver
- Fix bug #78222 (heap-buffer-overflow on exif_scan_thumbnail)
- Fix bug #78256 (heap-buffer-overflow on exif_process_user_comment)
- Fixed bug #78279
- Fixed bug #78297- EA-8576: Update litespeed from upstream to 7.5- EA-8558: Update litespeed from upstream to 7.4.2- Update litespeed 7.4.3 version- EA-8538: Update litespeed from upstream to 7.4- Fix bug #77967 - Bypassing open_basedir restrictions via file uris
- Fix #77973: Uninitialized read in gdImageCreateFromXbm
- Fix bug #77988 - heap-buffer-overflow on php_jpg_get16
- Fix bug #78069 - Out-of-bounds read in iconv.c:_php_iconv_mime_decode() due to integer overflow- Fixed bug #50020 (DateInterval:createDateFromString() silently fails)
- Fixed bug #76717
- Fix #77024: SplFileObject::__toString() may return array
- Fixed bug #77597
- Fixed bug #77664 (Segmentation fault when using undefined constant in custom wrap�x�������������0����X�k@=���8 �������'�$�����������������'�'�'�upstream release 3.3.15
- Add support for Ubuntu 24.04 and AlmaLinux 10- Include missing headers and manpages in Ubuntu package- Upstream update to version 3.3.13
- Require support for libzstd.- Upstream update to version 3.3.1- Add RedHat 9 & Ubuntu 22 support.- Upstream update to release 3.2.6- Update for debian support- Add requires for libcurl so that the remote-io plugin can always build correctly- Update to upstream realease 3.1.8- Update to upstream realease 3.1.7- use cmake from system instead of cpanel-cmake- remove backward compatibility, need to rebuild using the new libraries- adjust obsoletes rules- update from mariadb-native-clientcpanel-mariadb-native-client-devel	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~����������������3.3.15-2.cp130~el83.3.15-2.cp130~el83.3.153.3.15mariadb_configerrmsg.hma_list.hma_pvio.hma_tls.hma_io.hmariadb_com.hmariadb_ctype.hmariadb_dyncol.hmariadb_rpl.hmariadb_stmt.hmariadb_version.hmysql.hclient_plugin.hplugin_auth.hmysqld_error.hlibmariadb.alibmariadbclient.alibmysqlclient.alibmysqlclient_r.alibmariadb.pcmanman3mariadb_cancel.3mariadb_connection.3mariadb_dyncol_check.3mariadb_dyncol_column_cmp_named.3mariadb_dyncol_column_count.3mariadb_dyncol_create_many_named.3mariadb_dyncol_create_many_num.3mariadb_dyncol_exists_named.3mariadb_dyncol_exists_num.3mariadb_dyncol_free.3mariadb_dyncol_list_named.3mariadb_dyncol_list_num.3mariadb_dyncol_unpack.3mariadb_dyncol_update_many_named.3mariadb_dyncol_update_many_num.3mariadb_get_infov.3mariadb_reconnect.3mariadb_rpl_close.3mariadb_rpl_fetch.3mariadb_rpl_get_optionsv.3mariadb_rpl_open.3mariadb_rpl_optionsv.3mariadb_stmt_execute_direct.3mariadb_stmt_fetch_fields.3mysql_affected_rows.3mysql_autocommit.3mysql_change_user.3mysql_close.3mysql_commit.3mysql_data_seek.3mysql_errno.3mysql_error.3mysql_fetch_field.3mysql_fetch_field_direct.3mysql_fetch_fields.3mysql_fetch_lengths.3mysql_fetch_row.3mysql_field_count.3mysql_field_seek.3mysql_field_tell.3mysql_free_result.3mysql_get_character_set_info.3mysql_get_client_info.3mysql_get_client_version.3mysql_get_host_info.3mysql_get_proto_info.3mysql_get_server_info.3mysql_get_server_version.3mysql_get�x������������������X�]m��������,�����$t��������������������?`
�J�U�^�	g�	��`�d�p�t�{�	���(X Y(
p��h�mQGiBD4+owwRBAC14GIfUfCyEDSIePvEW3SAFUdJBtoQHH/nJKZyQT7h9bPlUWC3
RODjQReyCITRrdwyrKUGku2FmeVGwn2u2WmDMNABLnpprWPkBdCk96+OmSLN9brZ
fw2vOUgCmYv2hW0hyDHuvYlQA/BThQoADgj8AW6/0Lo7V1W9/8VuHP0gQwCgvzV3
BqOxRznNCRCRxAuAuVztHRcEAJooQK1+iSiunZMYD1WufeXfshc57S/+yeJkegNW
hxwR9pRWVArNYJdDRT+rf2RUe3vpquKNQU/hnEIUHJRQqYHo8gTxvxXNQc7fJYLV
K2HtkrPbP72vwsEKMYhhr0eKCbtLGfls9krjJ6sBgACyP/Vb7hiPwxh6rDZ7ITnE
kYpXBACmWpP8NJTkamEnPCia2ZoOHODANwpUkP43I7jsDmgtobZX9qnrAXw+uNDI
QJEXM6FSbi0LLtZciNlYsafwAPEOMDKpMqAK6IyisNtPvaLd8lH0bPAnWqcyefep
rv0sxxqUEMcM3o7wwgfN83POkDasDbs3pjwPhxvhz6//62zQJ7Q2TXlTUUwgUmVs
ZWFzZSBFbmdpbmVlcmluZyA8bXlzcWwtYnVpbGRAb3NzLm9yYWNsZS5jb20+iGwE
ExECACwCGyMCHgECF4ACGQEGCwkIBwMCBhUKCQgCAwUWAgMBAAUCXEBY+wUJI87e
5AAKCRCMcY07UHLh9RZPAJ9uvm0zlzfCN+DHxHVaoFLFjdVYTQCfborsC9tmEZYa
whhogjeBkZkorby0O015U1FMIFBhY2thZ2Ugc2lnbmluZyBrZXkgKHd3dy5teXNx
bC5jb20pIDxidWlsZEBteXNxbC5jb20+iG8EMBECAC8FAk53Pa0oHSBidWlsZEBt
eXNxbC5jb20gd2lsbCBzdG9wIHdvcmtpbmcgc29vbgAKCRCMcY07UHLh9bU9AJ9x
DK0oxJFL9vTl9OSZC4lX0K9AzwCcCrS9cnJyz79eaRjL0s2r/Ccljdy5Ag0EPj6j
HRAIAO/hiX8WzHWOMLJT54x/axeDdqn1rBDf5cWmaCWHN2ujNNlgpx5emoU9v7QS
tsNUCOGBbXkeO4Ar7YG+jtSR33zqNh3y5kQ0YkY3dQ0wh6nsl+wh4XIIY/3TUZVt
mdJeUBRHJlfVNFYad2hX1guFI37Ny1PoZAFsxO82g+XB/Se8r/+sbmVcONdcdIeF
KrE3FjLtIjNQcxC6l9Q2Oy8KDxG/zvUZG3+H5i3tdRMyGgmuD6gEV0GXOHYUopzL
eit1+Aa0bCk36Mwbu+BeOw/CJW3+b0mB27hOaf9aCA855IP6fJFvtxcblq8nHIqh
U3Dc9tecsl9/S1xZ5S8ylG/xeRsAAwUH/i8KqmvAhq0X7DgCcYputwh37cuZlHOa
1Ep07JRmBCDgkdQXkGrsj2Wzw7Aw/TGdWWkmn2pxb8BRui5cfcZFO7c6vryi6FpJ
uLucX975+eVY50ndWkPXkJ1HF4i+HJwRqE2zliN/RHMs4LJcwXQvvjD43EE3AO6e
iVFbD+qAAdxUFoOeLblKNBHPG7DPG9xL+Ni5rkE+TXShxsB7F0z7ZdJJZOG0JODm
ox7IstQTGoaU9u41oyZTIiXPiFidJoIZCh7fdurP8pn3X+R5HUNXMr7M+ba8lSNx
ce/F3kmH0L7rsKqdh9d/aVxhJINJ+inVDnrXWVoXu9GBjT8Nco1iU9SIVAQYEQIA
DAUCTnc97QUJE/sBuAASB2VHUEcAAQEJEIxxjTtQcuH1FJsAmwWK9vmwRJ/y9gTn
J8PWf0BVroUTAKClYAhZuX2nUNwH4vlEJQHDqYa5yQ==
gpg-pubkey5072e1f55c4058fbgpg(MySQL Package signing key (www.mysql.com) <build@mysql.com>)-----BEGIN PGP PUBLIC KEY BLOCK-----
Version: rpm-4.14.3 (NSS-3)

mQGiBD4+owwRBAC14GIfUfCyEDSIePvEW3SAFUdJBtoQHH/nJKZyQT7h9bPlUWC3
RODjQReyCITRrdwyrKUGku2FmeVGwn2u2WmDMNABLnpprWPkBdCk96+OmSLN9brZ
fw2vOUgCmYv2hW0hyDHuvYlQA/BThQoADgj8AW6/0Lo7V1W9/8VuHP0gQwCgvzV3
BqOxRznNCRCRxAuAuVztHRcEAJooQK1+iSiunZMYD1WufeXfshc57S/+yeJkegNW
hxwR9pRWVArNYJdDRT+rf2RUe3vpquKNQU/hnEIUHJRQqYHo8gTxvxXNQc7fJYLV
K2HtkrPbP72vwsEKMYhhr0eKCbtLGfls9krjJ6sBgACyP/Vb7hiPwxh6rDZ7ITnE
kYpXBACmWpP8NJTkamEnPCia2ZoOHODANwpUkP43I7jsDmgtobZX9qnrAXw+uNDI
QJEXM6FSbi0LLtZciNlYsafwAPEOMDKpMqAK6IyisNtPvaLd8lH0bPAnWqcyefep
rv0sxxqUEMcM3o7wwgfN83POkDasDbs3pjwPhxvhz6//62zQJ7Q2TXlTUUwgUmVs
ZWFzZSBFbmdpbmVlcmluZyA8bXlzcWwtYnVpbGRAb3NzLm9yYWNsZS5jb20+iGwE
ExECACwCGyMCHgECF4ACGQEGCwkIBwMCBhUKCQgCAwUWAgMBAAUCXEBY+wUJI87e
5AAKCRCMcY07UHLh9RZPAJ9uvm0zlzfCN+DHxHVaoFLFjdVYTQCfborsC9tmEZYa
whhogjeBkZkorby0O015U1FMIFBhY2thZ2Ugc2lnbmluZyBrZXkgKHd3dy5teXNx
bC5jb20pIDxidWlsZEBteXNxbC5jb20+iG8EMBECAC8FAk53Pa0oHSBidWlsZEBt
eXNxbC5jb20gd2lsbCBzdG9wIHdvcmtpbmcgc29vbgAKCRCMcY07UHLh9bU9AJ9x
DK0oxJFL9vTl9OSZC4lX0K9AzwCcCrS9cnJyz79eaRjL0s2r/Ccljdy5Ag0EPj6j
HRAIAO/hiX8WzHWOMLJT54x/axeDdqn1rBDf5cWmaCWHN2ujNNlgpx5emoU9v7QS
tsNUCOGBbXkeO4Ar7YG+jtSR33zqNh3y5kQ0YkY3dQ0wh6nsl+wh4XIIY/3TUZVt
mdJeUBRHJlfVNFYad2hX1guFI37Ny1PoZAFsxO82g+XB/Se8r/+sbmVcONdcdIeF
KrE3FjLtIjNQcxC6l9Q2Oy8KDxG/zvUZG3+H5i3tdRMyGgmuD6gEV0GXOHYUopzL
eit1+Aa0bCk36Mwbu+BeOw/CJW3+b0mB27hOaf9aCA855IP6fJFvtxcblq8nHIqh
U3Dc9tecsl9/S1xZ5S8ylG/xeRsAAwUH/i8KqmvAhq0X7DgCcYputwh37cuZlHOa
1Ep07JRmBCDgkdQXkGrsj2Wzw7Aw/TGdWWkmn2pxb8BRui5cfcZFO7c6vryi6FpJ
uLucX975+eVY50ndWkPXkJ1HF4i+HJwRqE2zliN/RHMs4LJcwXQvvjD43EE3AO6e
iVFbD+qAAdxUFoOeLblKNBHPG7DPG9xL+Ni5rkE+TXShxsB7F0z7ZdJJZOG0JODm
ox7IstQTGoaU9u41oyZTIiXPiFidJoIZCh7fdurP8pn3X+R5HUNXMr7M+ba8lSNx
ce/F3kmH0L�x������/������������XP�k@�pz�������h�$T�����������������h�h�G2|?.Pd����	�	C���������������	"�8�U�[d�	
\�
w

��Jh�

4
�(
�8
�69�6:6G$�H%xI%�X&Y& \&<]&�^(�b)�d+Ce+Hf+Kl+Mt+hu+�v,`w,�x-0y-��.�.�.
�.L.`.d�00*�
1�2	�2L2P2pg2th2xCpython3-pytz2017.211.el8World Timezone Definitions for Pythonpytz brings the Olson tz database into Python. This library allows accurate
and cross platform timezone calculations using Python 2.3 or higher. It
also solves the issue of ambiguous times at the end of daylight savings,
which you can read more about in the Python Library Reference
(datetime.tzinfo).

Almost all (over 540) of the Olson timezones are supported.e+��s390x-builder02.almalinux.org�IAlmaLinuxAlmaLinuxMITAlmaLinux Packaging Team <packager@almalinux.org>Development/Languageshttp://pytz.sourceforge.net/linuxnoarchaEE�858+8+		&&��:W:w5�AK��K�@A�A큤����������A큤��������������������������������A큤��A큤e+��e+��e+��e+��e+��e+��X�:e+��e+��e+��e+��e+��e+��e+��e+��e+��e+��e+��e+��e+��e+��X�6X�6X�6X�6X�6e+��X�6X�6e+��X�6def0b70a97e0f0f6bf2bc61c5aebf6e5615b95d1bbdd4fb52ac0b8c092621c815831a643b5bddb6ece3b7a5808f9af45ab1879575421dfeb3e5dd33205d6054d01ba4719c80b6fe911b091a7c05124b64eeece964e09c058ef8f9805daca546beb145896df77e2fd721dbd4922b5e01f21b19f772a002bddfb213cb248bf91c701ba4719c80b6fe911b091a7c05124b64eeece964e09c058ef8f9805daca546bdcc54a289f581e0ef2b32a3543706d1fd62c26732d88323d37aeba8cb1f31b997be481383b68c98bfc74d9a74f23a3bc3a5a02f91cca16fd6c28b3ecaeb285a27be481383b68c98bfc74d9a74f23a3bc3a5a02f91cca16fd6c28b3ecaeb285a2d641c30dc1ed1016fca2e9fafd87902cfc00aa20642c72a87e2e6f444f488958d641c30dc1ed1016fca2e9fafd87902cfc00aa20642c72a87e2e6f444f488958f38876e3d9b3e782a07b91ad3718d9453dd5efded5511be6e44fc72d927e2fa2f38876e3d9b3e782a07b91ad3718d9453dd5efded5511be6e44fc72d927e2fa2a3a7ccc768c281bdde470418915c2d7a682fe23b37b4f3016d56828c26eebbba64a6accd204331031856959225855c039b2600b6d0f0fdb50b50ab826a3ade6176ccba90e0d23ec83fcc161a60043a183e916ba00a51af2b86d352ca2bf21a66e33189d6829b1f6c23f9a94d1f0c0422ceb059556d5b37e51e9926081d5b7b8e9de8580db0df0e02162484142b0e80a39921740ef76ffcb24f37582e8707c27398ec3b96ce20ebe58d93c7d949f52b4f9dc7802d841d09a25ef84ab10ecfd4d838c13623d81ed14e4e1f985fbe774406231ead6f881139a63d4422b6aeba8fb2dea86b4a408c97e6de0aad76c29e5eb3da0abaf76491c2fb5adc8691db3c33e1402938bfc1bc5fbb3b6a34fcc2cb0ae928fe4f557897e05245ae67fd3b4ceb0b6377f85451e3048677a863eed686c964556e3019afd002be989489044b0917208f803174efef3a5d0388408cb08e62ecae5270ee91ad1e4844dea7697bc2267580590813c8d4280247f802ea87329bb8905595c79552f348dfa132c0d65af2409c489e885d03e225914e9f3d27f6bbe1d6a394e23d429352b0b12d8023686d28a1c7102a51ef9ed37766f7388c71fd41bae2a7a95c30673c419ab84e1acc5f02�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroot�x�������������������X�Gm�������� ;���$�������������������~	
���������������xsgbVQE@4/#
���������������ythcWRFA50$�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
z
u
i
d
X
S
G
B
6
1
%
 



���������������{vjeYTHC72&!���������������|wkfZUID83'"�
�
�
�
�
�
�
�
�
�
�
�
�
�
}
x
l
g
[
V
J
E
9
4
(
#




�	�	�	�	�	�	�	�	�	�	�	�	�	�	~	y	m	h	\	W	K	F	:	5	)	$					��������������zni]XLG;>[;�*�d�>[;�*�d�>[;�*�d�>[;�*�d�>[;�*�d�>[;�*�d�>[;�*�d�>[;�*�d�>[;�*�d�>[;�*�d�>[;�*�d�>[;�*�d�>[;�*�d�>[;�*�d�>[;�*�d�>[;�*�d�>[;�*�d�>[;�*�d�>[;�*�d�>[;�*�d��q�A����+}���q���C��+}����+}������b�T~�>[;�	|>�Iq��-l�>[;�(8�O�w=�����q�;Lp�>[;�48`��+}/X��q����:��@i�����+}����+}������T���>[;�}�����\���u.���>[;3|$��$�����>[;�'�3��q�b�D`�� X��-�>[;>30���+}\$��q�<�P?�>[;hkܪ��+}���+}#X����8���>[;1�>����!�>[;2'�[�<60<���q�ϳ���M�.@
��+}�,��q����J�>[;�h�6��oV7nw�O�w���>[;��$��+}Q(
����s�l��>[;��.����,%�
�߶��B�>[;oH#�G��8�5�>[;&�-~�q��xF{�U�[�H#z>[;1�y�+}�<x�q�/$4`v�oVpD�_sO�wI� r>[;��-o�+}�mE�1%4xok	��3�2eG��D�ak�͖G�[�+}��X�q�0��uV�ÂTE��Q>[;+YO�+}��ME�1�%�K	>[;�lHH����\ZE>[;P�*CVg����+@O�w��<�+}
(8�q��@�6�+}�
�3�q��h�1>[;�}�/�+}L4->[;� (.~��DA$O�wǤ$�+}J��q�?h�2���A�+}�
P�q���C>[;�q���@��h��+}u|+
���j��
>[;pp(>[;
�1�x������������������X��l��������hr������t��$d����������������t�s�u�� doc: ip_resolve documented at two places. remove one. (Ales Kozumplik)- packaging: bump hawkey dep to 0.4.17. (Ales Kozumplik)
- api: remove Base.select_group(). (Ales Kozumplik)
- tests: cleanup our base test case classes a bit. (Ales Kozumplik)
- Add DNF itself among the protected packages. (Ales Kozumplik)
- api: plugins: add the resolved() hook. (Ales Kozumplik)
- api: expose Transaction introspecting in the API. (RhBug:1067156) (Ales Kozumplik)
- api: add basic documentation for dnf.package.Package. (Ales Kozumplik)
- tests: cosmetic: conf.protected_packages is ignored, drop it in FakeConf. (Ales Kozumplik)
- cli: simplify exception handling more. (Ales Kozumplik)
- Fixed a minor typo in user_faq - 'intall' should be 'install' (Martin Preisler)
- fixed encoding of parsed config line (RhBug:1110800) (Jan Silhan)
- syntax: replaced tab with spaces (Jan Silhan)
- doc: acknowledge the existence of plugins on the man page (RhBug:1112669) (Ales Kozumplik)
- improve the 'got root?' message of why a transaction couldn't start. (RhBug:1111569) (Ales Kozumplik)
- traceback in Base.do_transaction. to_utf8() is gone since 06fb280. (Ales Kozumplik)
- fix traceback from broken string formatting in _retrievePublicKey(). (RhBug:1111997) (Ales Kozumplik)
- doc: replace Yum with DNF in command_ref.rst (Viktor Ashirov)
- Fix a missing s in the title (mscherer)
- api: add dnf.rpm.detect_releasever() (Ales Kozumplik)
- Detect distroverpkg from 'system-release(release)' (RhBug:1047049) (Ales Kozumplik)
- bulid: add dnf/conf to cmake. (Ales Kozumplik)
- lint: clean up most lint messages in dnf.yum.config (Ales Kozumplik)
- remove: couple of dead-code methods in dnf.yum.config. (Ales Kozumplik)
- api: document client's responsibility to preset the substitutions. (RhBug:1104757) (Ales Kozumplik)
- move: rpmUtils -> rpm. (Ales Kozumplik)
- refactor: move yumvar out into its proper module dnf.conf.substitutions. (Ales Kozumplik)
- refactor: turn dnf.conf into a package. (Ales Kozumplik)
- doc: api_base.rst pointing to nonexistent method. (Ales Kozumplik)
- remove: some logging from Transaction.populate_rpm_ts(). (Ales Kozumplik)
- Update cli_vs_yum.rst (James Pearson)
- api: doc: queries relation specifiers, with an example. (RhBug:1105009) (Ales Kozumplik)
- doc: phrasing in ip_resolve documentation. (Ales Kozumplik)
- cli: refactored transferring cmdline options to conf (Jan Silhan)
- cli: added -4/-6 option for using ipv4/ipv6 connection (RhBug:1093420) (Jan Silhan)
- cosmetic: empty set inicialization (Jan Silhan)
- repo: improve the RepoError message to include URL. (Ales Kozumplik)
- remove: dnf.yum.config.writeRawRepoFile(). (Ales Kozumplik)
- remove: bunch of (now) blank config options. (Ales Kozumplik)
- removed unique function (Jan Silhan)
- tests: mock.assert_has_calls() enforces its iterable arguments in py3.4. (Ales Kozumplik)
- logging: improve how repolist logs the total number of packages. (Ales Kozumplik)
- logging: Base.close() should not log to the terminal. (Ales Kozumplik)- doc: packaging: add license block to each .rst. (Ales Kozumplik)
- cosmetic: replaced yum with dnf in comment (Jan Silhan)
- takes non-ascii cmd line input (RhBug:1092777) (Jan Silhan)
- replaced 'unicode' conversion functions with 'ucd' (RhBug:1095861) (Jan Silhan)
- using write_to_file py2/py3 compatibility write function (Jan Silhan)
- encoding: all encode methods are using utf-8 coding instead of default ascii (Jan Silhan)
- fixed rpmbuild warning of missing file (Jan Silhan)
- transifex update (Jan Silhan)
- fixed typos in comments (Jan Silhan)
- Drop --debugrepodata and susetags generation with it. (Ales Kozumplik)
- doc: document --debugsolver. (Ales Kozumplik)
- fix: 'dnf repo-pkgs' failures (RhBug:1092006) (Radek Holy)
- lint: make dnf_pylint take '-s' that suppresses line/column numbers. (Ales Kozumplik)
- doc: cli_vs_yum: we do not promote installs to the obsoleting package. (RhBug:1096506) (Ales Kozumplik)
- dealing with installonlies, we always need RPMPROB_FILTER_OLDPACKAGE (RhBug:1095580) (Ales Kozumplik)
- t�x�������������������X��k@@��������������A3�$Q����������������A3@3B3�edhat.com> 2.1.21-6Nalin Dahyabhai <nalin@redhat.com> 2.1.21-5Nalin Dahyabhai <nalin@redhat.com> 2.1.21-4Nalin Dahyabhai <nalin@redhat.com> 2.1.21-3Nalin Dahyabhai <nalin@redhat.com> 2.1.21-2Nalin Dahyabhai <nalin@redhat.com> 2.1.21-1Nalin Dahyabhai <nalin@redhat.com> 2.1.20-5Nalin Dahyabhai <nalin@redhat.com> 2.1.20-4Jeff Johnson <jbj@jbj.org> 2.1.20-3Nalin Dahyabhai <nalin@redhat.com> 2.1.20-2Nalin Dahyabhai <nalin@redhat.com> 2.1.20-1Nalin Dahyabhai <nalin@redhat.com> 2.1.20-0Nalin Dahyabhai <nalin@redhat.com> 2.1.19-3Nalin Dahyabhai <nalin@redhat.com> 2.1.19-2Nalin Dahyabhai <nalin@redhat.com> 2.1.19-1Nalin Dahyabhai <nalin@redhat.com> 2.1.19-0Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.18-4Nalin Dahyabhai <nalin@redhat.com>Thomas Woerner <twoerner@redhat.com> 2.1.18-3Nalin Dahyabhai <nalin@redhat.com> 2.1.18-2Nalin Dahyabhai <nalin@redhat.com> 2.1.18-1Nalin Dahyabhai <nalin@redhat.com> 2.1.17-4Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.17-2Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.17-1Nalin Dahyabhai <nalin@redhat.com>Jeff Johnson <jbj@jbj.org> 2.1.15-7Nalin Dahyabhai <nalin@redhat.com> 2.1.15-6Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.15-5Jeff Johnson <jbj@jbj.org> 2.1.15-5Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.15-4Nalin Dahyabhai <nalin@redhat.com> 2.1.15-3Nalin Dahyabhai <nalin@redhat.com> 2.1.15-2Nalin Dahyabhai <nalin@redhat.com> 2.1.15-1Nalin Dahyabhai <nalin@redhat.com> 2.1.14-1Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.13-3Nalin Dahyabhai <nalin@redhat.com> 2.1.13-2Nalin Dahyabhai <nalin@redhat.com> 2.1.13-1Tim Powers <timp@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.10-3Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.10-2Nalin Dahyabhai <nalin@redhat.com> 2.1.10-1Tim Powers <timp@redhat.com> 2.1.7-5Nalin Dahyabhai <nalin@redhat.com> 2.1.7-4Nalin Dahyabhai <nalin@redhat.com> 2.1.7-3Nalin Dahyabhai <nalin@redhat.com> 2.1.7-2Nalin Dahyabhai <nalin@redhat.com> 2.1.7-1Nalin Dahyabhai <nalin@redhat.com> 2.1.6-1Tim Powers <timp@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.5-1Nalin Dahyabhai <nalin@redhat.com> 2.1.4-1Tim Powers <timp@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.2-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.1-3Nalin Dahyabhai <nalin@redhat.com> 2.1.1-2Nalin Dahyabhai <nalin@redhat.com> 2.1.1-1Nalin Dahyabhai <nalin@redhat.com> 2.1.0-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.5.24-24Nalin Dahyabhai <nalin@redhat.com> 1.5.24-23Nalin Dahyabhai <nalin@redhat.com> 1.5.24-22Nalin Dahyabhai <nalin@redhat.com> 1.5.24-21Nalin Dahyabhai <nalin@redhat.com> 1.5.24-20Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Prospector <bugzilla@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Mads Kiilerich <mads@kiilerich.com>Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>- Fix for CVE-2022-24407
- Resolves: rhbz#2055846- Reduce excessive GSSAPI plugin logging
- Resolves: rhbz#1274734- Add support for setting maxssf=0 in GSS-SPNEGO
- Resolves: rhbz#1822133- Backport GSSAPI Channel Bindings support
- Resolves: rhbz#1817054- Backport fix for CVE-2019-19906
- Resolves: rhbz#1804036- Rc7 to final source
- Resovles bz#1618744- Add patch form Upstream PR55�x������������������X�^m@@������ ������$u������������������7rsKqdh9d/aVxhJINJ+inVDnrXWVoXu9GBjT8Nco1iU9SIVAQYEQIA
DAUCTnc97QUJE/sBuAASB2VHUEcAAQEJEIxxjTtQcuH1FJsAmwWK9vmwRJ/y9gTn
J8PWf0BVroUTAKClYAhZuX2nUNwH4vlEJQHDqYa5yQ==
=PSFW
-----END PGP PUBLIC KEY BLOCK-----
\@X�localhostpubkeyMySQL Package signing key (www.mysql.com) <build@mysql.com>Public Keys(none)gpg(MySQL Package signing key (www.mysql.com) <build@mysql.com>)gpg(5072e1f5)4.14.34:8c718d3b5072e1f5-5c4058fb4:8c718d3b5072e1f5-5c4058fb?����1c1e2e6a6f0460aaa2242f2ba13b76ec122cacf0i0<�i0<��x�������������x�����X��l�k�����:��$*����������������:�;�9��802d638e87cc29446ea8f71dcf5782a092c56e9bf543262122b206fc075a59a64caddc246cb8424fe16b5db5b8b8249fbafece61dfd8bad8fd58d848bd4cf5bf05249b7f9f399913f11abda57cdd3ba1f1b6a29eb5306a988c22830f115fde0b3d32cfb77a3946584e88f6bf981271f9ac8c53f29c46b526d1f9a4727c3d06988ad2f1460255cca47a488719f910730d8862be9c0c500bb8fb75ac9483eb4b077e94e9799c70c2c6e79ac36853b8c0f7aefcabe4b16ca69b7245a0a16040ad1d67988e9c6bcb481a335fa5d879ae36c61478d5c2b6b4dcf7542b98f3df491ac29f67f1d146871c411764519f8a1c4cb4ae438704654a4140439c7adb18a7d1ebc6efd96bfebc4cd52a571bbada56a710131890d059865f82938e82ed4af545c9726cd79441545b7223bf41d66afaa8c3a2e8bd8ee838cc75b865e56dbdf4a05d83ebf53f4e2d0caace9835cd950bc6b09593aeeea54d8ece1ca683482cdddca978ea0c181049e1ae2df7e03dfb2eabf2e766e137f2b4d28aec66a3febe0605b8a300ec5aeea95d016b7083209c50cb3427a3611c635bfa149c85b8194586dd8a9baf4415e1f4eff3f1b6c998a9156c993ef2683d2b705a02002edf7d330c187f40ac7935af0c3c293386d4ea7670c49fa69aa6408cfa1d7d2a83ea146ba7e1a0093020bce12b8a63a158cbf3100a61091d930198029ad76cf09bfe8d7407d3f42789d3799427c46fc9bb6a2dfac2bec866007490370744235c42608147c1cccc6379a70cc317640ee4eccdd9ec90d3811a089c7a2038511d386ee3572f22af5713c7c8a64cfdbc94a663cdece1fd26bf2d4423f23628036f1d59b01f562b818757939544825730c749a9012bc9384faf8fc610b390dd9287cf301295c695e923ef815a6dabb692fbf1a4a9001eb6d6e2f6121bf1375d679108f36298c389d694889e4da30283ac0ed016e3c219e3864d0415a06bcd923d39acedbdf0a568d23a77c1f551d4ae590cb1ba3c620ad55c36466bb77fcf753eac0d57e16f5e8063ccff9fb33e53522f98216888eccf644488ea6b9fc6877af3da581e67493e796f2c06322637b2419d146ecd8cbed09b9704acc0580eb4f5ac421db78fbf84c812fc36e7bc2fd8577cd89076cbf542af1203910ce0647fba0752abae44307c00253651a7533b079a8997211b51929102eb45cccc005da92b8404f6ff94b9b6cbcc49a35b6a21211c1c52018cc7d7dd6fa2817a74bf1ced5506b98b60f6446e4a9fce1be9186e0c6da938315d1353a83f9758cf88fb6462eb31fa75ebda87d82ae5299f404a7351e5e21b81094ca8657221d573b838e1564eef08505b1cca04b235a98f100576d217c2d6ec8972132762fc9172cc8c65bcc7029084199be1807f1c99a21c3eaf6978a389c2352dad3c6757d72e255ba99f3fa3ac9e6145d0f3b25dd30a2588d376ff242619385ba61c468002c19a8fafec4c8616fceed72d87598bc294f39d13d19d88171c95dff6978050185c331523330e6ba1340ab822ccb99e4e2bd78e7ffce40b30abc1eed1d8a0a239ca5774bd74413f19869b4e61c80fb53ea279809761e01c67fa699a9f12d198601db2edd224390281cf2e154196761d6ebc8a355c61308427917ccb8d44d49a1da63239a267c4a4a17d95cb5ed9f76f350047fd17215ddcd01c123edd88fac789a972c165089717bd4c8420e0ad217a0c71be5a1ee094fd9127468e41d50698c4d23625e416633f355a7ce3424dccf4ba451a7332d8b6252e1e2b8cffd7c1b172a3a1b6c2951df86b30bbab92d8e27490c4b73039bfe87db1400fd7e13090cd69183b27cfbaa846938bbf5ad877a947c62bfa7c3763ec53a08615a01614893571a4d7627b302d9e70408dbcb74124174818b168d5291f21ff8af1b789df057ff989b6cca7adc878397868e41247071980a90f607b62306f214dc2d286615135d31f55dae87eda5dc66024db0776d8380b503210dc718017cb1b497d12998592628b9df51c6cbafa6f5d89e7efa3db8093e148777e2829e7f21b84324b7cd93484d10b5af03d34fcb4e2c37a2bc0438a1096c23c76c877a6d40327d3be3adff7c68c12d3ced3a09f8beae99ae59a18822e5d6d19ae6f192266cff1e6091e59c9d37a9fac85cdb55888e73781eb31f4165978fab1e06787b519450f8a1efa2d6d08a72b033224a884f44e43cdc55f5d6067970283bb492a0aa4cddd20c9b29a0631288623ae7ca61e2900cc302c8b52a8f51d505a095690cbb5c71e801d62041284b17c76895d8c1bbb107bbfbda5266f1c1333481d9a56b280f66cb7c9bb8d14004f28fb5345f807520b159e0a11caeee32103ce5055704b94a6aea0c606723b6afd2a34965c854d7c2a091b484d1bd0cabd440e41911496103a8d658fb843f73db358ea69a4523095dc82e38ab4ed2247d7b4f3c3fb61fbabba0c4ce7a140702cafcea77f02e5bf9798c1835c3547723ca464d319d43a3c4df91438302bbcfb5df9ed74883bf7910dc85414b0d7347e49b4ad7a6fdfdb913006c5021b62a894e3a2e8ea69a4523095dc82e38ab4ed2247d7b4f3c3fb61fbabba0c4ce7a140702cafcf56438f1556a5c5dd5a70178eb5ed24281b7e2d7ce93084425a099f4720e181407d47f37a75db06773c28a4123327560973a52506e9fab0b8293e978bf0da77bae19a2289b1854c35baa48034b3e83804dc673945d8b26b9fae2fe66b65fd07acd0b52fda4db3861ea36292f271a5395d99997dcede8645ac5a4e7383c3f990b67ade6b42fda182ccf50a1d702680d6e857c09f56f215b752592ccef324a27b94896�x������������������X�m0������p�h��$x����������������h�g�i��3- 12.0.2- Fix PRIME fd leak- Remove BuildRequires: xorg-x11-server-devel- Fix broken deps with OpenCL- Fix broken deps- Slightly refactor spec
- Drop virtual provides for OCL- Add missing %{?_isa} to requires in some devel sub-packages (bug #1138463)- 12.0.1- 12.0.0- 12.0.0-rc4- Fix packaging error on s390*- 12.0.0-rc3- add missing dependency for /etc/OpenCL/vendors ownership (RHBZ #1265948)- 12.0.0-rc2- 12.0.0-rc1- cbcd7b6- 171a570- add virtual Provides for ocl-icd (RHBZ #1317602)- 11.3.0 (gitea2bff1)
- Add SWR state-tracker (but disable because build is broken)
- Use gallium-osmesa instead of classic osmesa (RHBZ #1305588)
- Remove very old changelogs- Update to 11.2.0-rc3- rebuild against llvm 3.8.0- rebuild against new llvm packages- Fix OpenCL-enabled FTBFS by not forcing clang search path to /usr/lib- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuild for llvm 3.7.1 library split- 24ea81a- OpenCL now supported on aarch64- 5e3edd4- Mangle libtool even harder to get -static-libstdc++ to work- 70d8dbc- 56aff6b- 86fc97d- 5ae37ae- Link with -static-libstdc++ to work around Steam bundling its own copy- 3994ef5
- Enable VirGL driver- 7182498
- Disable SWR rasterizer- Enable experimental SWR rasterizer- 4a168ad- 47d1199- 9932142- 47e18a5
- Rebuild against llvm 3.7- d6fbcf6- Add brw_meta_fast_clear crash workaround patch (#1259443, fdo#86281)- 60aea30- 4e5752e- 21ccdbd
- add surfaceless EGL platform (RHBZ #1251747)- Update to 11.0.0- Use %license
- Minor spec cleanups- ea633db- Drop unecessary make for s390- 8787141- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- add git to BR everywhere- 5a55f68- 51e3453- c1485f4- F23 rebuild against llvm 3.6.0- enable vc4 on arm- f80af89- 10.5.0- 6171131- c3260f8- 290553b- b77eaaf- c633528- a6f6d61- be0311c- 609c3e5- 3ba57ba- 64dcb2b- 6c18279- 0c7f895- cb5a372- enable ilo gallium driver- Sync with_{vaapi,vdpau,nine} settings with F21- Sync ppc build config with F21- fix requirements for d3d- 0d7f4c8- Enable VA state-tracker
- Enable Nine state-tracker (Direct3D9 API)- Restore hardware drivers on ppc64{,le}- 29c7cf2- 3d9c1a9- 9460cd3- f3b709c- rebuild for llvm- 1a17098- c3f17bb18f597d7f606805ae94363dae7fd51582- apply patch for bigendian from karsten
- fix ppc filelist from karsten- 1f184bc114143acbcea373184260da777b6c6be1 commit- add swrast to dri driver list- 80771e47b6c1e47ab55f17311e1d4e227a9eb3d8 commit- 10.4 c2867f5b3626157379ef0d4d5bcaf5180ca0ec1f- e7f2f2dea5acdbd1a12ed88914e64a38a97432f0 commit- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- c40d7d6d948912a4d51cbf8f0854cf2ebe916636 commit- Rebase to 'master' branch (f381c27c548aa28b003c8e188f5d627ab4105f76 commit)- 10.2.3 upstream release- Build aarch64 options the same as ARMv7
- Fix PPC conditionals- Fix up intelInitScreen2 for DRI3 (RHBZ #1115323) (patch from drago01)- add dri3 gnome-shell startup fix from Jasper.- 10.2.2 upstream release- drop radeonsi llvm hack- 10.2.1 upstream release- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- fix build without hardware drivers- 10.2-rc5 upstream release- Removing ppc64le arch from with_llvm- i915: add a missing NULL pointer check (RHBZ #1100967)- 10.2-rc4 upstream release
- add back updated radeonsi hack for LLVM- 10.2-rc3 upstream release- 10.2-rc2 upstream release
- drop radeonsi hack for LLVM- Move gallium-pipe to the correct sub-package (RHBZ #1094588) (kwizart)
- Move egl_gallium.so to the correct location (RHBZ #1094588) (kwizart)
- Switch from with to enable for llvm shared libs (kwizart)- Enable gallium-egl (needed by freedreeno) (RHBZ #1094199) (kwizart)- Enable omx on x86 and arm (RHBZ #1094199) (kwizart)
- Split _with_xa from _with_vmware (RHBZ #1094199) (kwizart)
- Add _with_xa when arch is arm and _with_freedreeno (RHBZ #1094199) (kwizart)- 10.2-rc1 upstream release- Update to today snapshot
- apply as downstream patches for reporting GPU max freque�x�������������h�����X��l0�������0��$ ����������������0�1�/��bit colormap, non-interlacedPNG image data, 1315 x 313, 8-bit/color RGB, non-interlacedPNG image data, 16 x 17, 8-bit/color RGBA, non-interlacedPNG image data, 466 x 422, 8-bit/color RGBA, non-interlacedPNG image data, 211 x 261, 8-bit/color RGB, non-interlacedPNG image data, 1696 x 593, 8-bit colormap, non-interlacedPNG image data, 1598 x 324, 8-bit colormap, non-interlacedPNG image data, 1668 x 328, 8-bit colormap, non-interlacedPNG image data, 223 x 65, 4-bit colormap, non-interlacedPNG image data, 26 x 16, 8-bit gray+alpha, non-interlacedPNG image data, 27 x 15, 8-bit gray+alpha, non-interlacedPNG image data, 78 x 43, 4-bit colormap, non-interlacedPNG image data, 84 x 43, 8-bit colormap, non-interlacedPNG image data, 258 x 65, 8-bit colormap, non-interlacedPNG image data, 86 x 43, 4-bit colormap, non-interlacedPNG image data, 88 x 54, 8-bit colormap, non-interlacedPNG image data, 20 x 15, 8-bit gray+alpha, non-interlacedPNG image data, 295 x 54, 8-bit colormap, non-interlacedPNG image data, 21 x 43, 8-bit gray+alpha, non-interlacedPNG image data, 14 x 12, 8-bit gray+alpha, non-interlacedPNG image data, 18 x 17, 8-bit gray+alpha, non-interlacedPNG image data, 20 x 22, 8-bit gray+alpha, non-interlacedPNG image data, 40 x 36, 8-bit colormap, non-interlacedPNG image data, 54 x 25, 8-bit gray+alpha, non-interlacedPNG image data, 126 x 43, 4-bit colormap, non-interlacedPNG image data, 34 x 25, 8-bit gray+alpha, non-interlacedPNG image data, 132 x 28, 8-bit gray+alpha, non-interlacedPNG image data, 287 x 43, 4-bit colormap, non-interlacedPNG image data, 89 x 16, 4-bit colormap, non-interlacedPNG image data, 174 x 43, 4-bit colormap, non-interlacedPNG image data, 171 x 43, 4-bit colormap, non-interlacedPNG image data, 264 x 43, 4-bit colormap, non-interlacedPNG image data, 27 x 16, 8-bit gray+alpha, non-interlacedPNG image data, 41 x 43, 4-bit colormap, non-interlacedPNG image data, 107 x 43, 4-bit colormap, non-interlacedPNG image data, 824 x 151, 8-bit colormap, non-interlacedPNG image data, 172 x 22, 4-bit colormap, non-interlacedPNG image data, 310 x 36, 4-bit colormap, non-interlacedPNG image data, 334 x 26, 4-bit colormap, non-interlacedPNG image data, 482 x 22, 4-bit colormap, non-interlacedPNG image data, 41 x 15, 4-bit colormap, non-interlacedPNG image data, 13 x 8, 8-bit gray+alpha, non-interlacedPNG image data, 15 x 12, 8-bit gray+alpha, non-interlacedPNG image data, 17 x 12, 8-bit gray+alpha, non-interlacedPNG image data, 20 x 12, 8-bit gray+alpha, non-interlacedPNG image data, 102 x 15, 4-bit colormap, non-interlacedPNG image data, 187 x 24, 4-bit colormap, non-interlacedPNG image data, 263 x 15, 8-bit colormap, non-interlacedPNG image data, 152 x 15, 8-bit colormap, non-interlacedPNG image data, 10 x 16, 8-bit gray+alpha, non-interlacedPNG image data, 50 x 15, 4-bit colormap, non-interlacedPNG image data, 94 x 15, 4-bit colormap, non-interlacedPNG image data, 178 x 22, 4-bit colormap, non-interlacedPNG image data, 16 x 12, 8-bit gray+alpha, non-interlacedPNG image data, 11 x 12, 8-bit gray+alpha, non-interlacedPNG image data, 230 x 24, 4-bit colormap, non-interlacedPNG image data, 201 x 23, 8-bit gray+alpha, non-interlacedPNG image data, 316 x 26, 4-bit colormap, non-interlacedPNG image data, 941 x 566, 8-bit colormap, non-interlacedPNG image data, 495 x 394, 8-bit colormap, non-interlacedPNG image data, 466 x 394, 8-bit colormap, non-interlacedPNG image data, 469 x 453, 8-bit colormap, non-interlacedPNG image data, 1732 x 640, 8-bit colormap, non-interlacedPNG image data, 762 x 571, 8-bit colormap, non-interlacedPNG image data, 2078 x 440, 8-bit colormap, non-interlacedPNG image data, 920 x 197, 8-bit colormap, non-interlacedPNG image data, 20 x 19, 8-bit/color RGBA, non-interlacedPNG image data, 1452 x 450, 8-bit colormap, non-interlacedPNG image data, 2052 x 469, 8-bit colormap, non-interlacedPNG image data, 191 x 35, 8-bit grayscale, non-interlacedPNG image data, 8 x 8, 8-bit gray+alpha, non-interlacedPNG image �x��������������w����X�m��������`�����-�$)�����������������-�-�-�IpToCountry.datcountry-cidrs--ADAEAFAGAIALAMAOAQARASATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBOBQBRBSBTBVBWBYBZCACCCDCFCGCHCICKCLCMCNCOCRCUCVCWCXCYCZDEDJDKDMDODZECEEEGEHERESETFIFJFKFMFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGUGWGYHKHMHNHRHTHUIDIEILIMINIOIQIRISITJEJMJOJPKEKGKHKIKMKNKPKRKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMDMEMFMGMHMKMLMMMNMOMPMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPRPSPTPWPYQARERORSRURWSASBSCSDSESGSHSISJSKSLSMSNSOSRSSSTSVSXSYSZTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWTZUAUGUMUSUYUZVAVCVEVGVIVNVUWFWSXKYEYTZAZMZWZZcountry-ips--ADAEAFAGAIALAMAOAQARASATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBOBQBRBSBTBVBWBYBZCACCCDCFCGCHCICKCLCMCNCOCRCUCVCWCXCYCZDEDJDKDMDODZECEEEGEHERESETFIFJFKFMFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGUGWGYHKHMHNHRHTHUIDIEILIMINIOIQIRISITJEJMJOJPKEKGKHKIKMKNKPKRKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMDMEMFMGMHMKMLMMMNMOMPMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPRPSPTPWPYQARERORSRURWSASBSCSDSESGSHSISJSKSLSMSNSOSRSSSTSVSXSYSZTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWTZUAUGUMUSUYUZVAVCVEVGVIVNVUWFWSXKYEYTZAZMZWZZ/usr/local/cpanel/3rdparty/share/geoipfree//usr/local/cpanel/3rdparty/share/geoipfree/country-cidrs//usr/local/cpanel/3rdparty/share/geoipfree/country-ips/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnu�x�������������Xg����X��l��������������.��$>����������������.�/��PRRRR
RRRRRRR	RRPRRRRRRRR
RRRR	RRutf-8da23084ba9b9eb3172e73c82d4585d79f620a1d1b9a58ff174902f33bedef5da?���@J�x���>5��rC�Y��Me�]!��gdcW&���K�U�b��qc���
	�U�b��q���`�9*��[�����G����qW@��[
���7�q��]!��gdcW&���K�U�b��qc���
	�U�b��q���f�j��V�m@ïĢ4�+�~\��0�BM�~��h�l�;:2e3c461eacff17473aa97edaf85df57582355e4a2a9f716fc6809e5cd8ffb74bbe9d13cfd078f96cec3b0e7ce6ce692f0d8114afi=��f0i=�{usb: common: usb-conn-gpio: Allow wakeup from system suspend (Torez Smith) [2113004]
- usbip: vudc: Don't enable IRQs prematurely (Torez Smith) [2113004]
- USB: usbip: clean up mixed use of _irq() and _irqsave() (Torez Smith) [2113004]
- USB: Follow-up to SPDX identifiers addition - remove now useless comments (Torez Smith) [2113004]
- thunderbolt: Fix some kernel-doc comments (Torez Smith) [2113004]
- usb: hub: Simplify error and success path in port_over_current_notify (Torez Smith) [2113004]
- usb: remove Link Powermanagement (LPM) disable before port reset. (Torez Smith) [2113004]
- thunderbolt: Change TMU mode to HiFi uni-directional once DisplayPort tunneled (Torez Smith) [2113004]
- usb: core: Bail out when port is stuck in reset loop (Torez Smith) [2113004]
- thunderbolt: Add CL1 support for USB4 and Titan Ridge routers (Torez Smith) [2113004]
- thunderbolt: Change downstream router's TMU rate in both TMU uni/bidir mode (Torez Smith) [2113004]
- USB: core: Fix bug in resuming hub's handling of wakeup requests (Torez Smith) [2113004]
- thunderbolt: Fix typos in CLx enabling (Torez Smith) [2113004]
- usb: hub: Add delay for SuperSpeed hub resume to let links transit to U0 (Torez Smith) [2113004]
- usb: hub: make wait_for_connected() take an int instead of a pointer to int (Torez Smith) [2113004]
- thunderbolt: CLx disable before system suspend only if previously enabled (Torez Smith) [2113004]
- usb: hub: avoid warm port reset during USB3 disconnect (Torez Smith) [2113004]
- thunderbolt: Silently ignore CLx enabling in case CLx is not supported (Torez Smith) [2113004]- config: Enable Security Path (Ricardo Robaina) [2161309]
- tcp: Fix build break when CONFIG_IPV6=n (Jamie Bainbridge) [2143849]
- tcp: annotate data-race around queue->synflood_warned (Jamie Bainbridge) [2143849]
- tcp: Add listening address to SYN flood message (Jamie Bainbridge) [2143849]
- tcp: Fix data-races around sysctl_tcp_syncookies. (Jamie Bainbridge) [2143849]
- firmware_loader: Fix memory leak in firmware upload (Mark Langsdorf) [2122319]
- firmware_loader: Fix use-after-free during unregister (Mark Langsdorf) [2122319]
- firmware_loader: fix memory leak for paged buffer (Mark Langsdorf) [2122319]
- firmware_loader: describe 'module' parameter of firmware_upload_register() (Mark Langsdorf) [2122319]
- firmware_loader: Move definitions from sysfs_upload.h to sysfs.h (Mark Langsdorf) [2122319]
- firmware_loader: Add sysfs nodes to monitor fw_upload (Mark Langsdorf) [2122319]
- firmware_loader: Add firmware-upload support (Mark Langsdorf) [2122319]
- firmware_loader: Split sysfs support from fallback (Mark Langsdorf) [2122319]
- firmware_loader: Clear data and size in fw_free_paged_buf (Mark Langsdorf) [2122319]
- firmware: Use kvmalloc for page tables (Mark Langsdorf) [2122319]
- firmware: Unify the paged buffer release helper (Mark Langsdorf) [2122319]
- firmware: Free temporary page table after vmapping (Mark Langsdorf) [2122319]
- arch_topology: Make cluster topology span at least SMT CPUs (Mark Langsdorf) [2122319]
- driver core: fix driver_set_override() issue with empty strings (Mark Langsdorf) [2122319]
- arch_topology: Silence�x�����x�pV����X�Gl����`���$
��������������������-Configure-all-host-notifiers-in-a-single.patch [bz#1927108]
- kvm-hw-arm-smmuv3-Another-range-invalidation-fix.patch [bz#1929720]
- Resolves: bz#1953045
  (qemu-kvm NULL pointer de-reference  during migration at migrate_fd_connect ->...-> notifier_list_notify)
- Resolves: bz#1957667
  ([aarch64] Add 8.5 machine type)
- Resolves: bz#1927108
  (It's too slow to load scsi  disk when use 384 vcpus)
- Resolves: bz#1929720
  ([aarch64] Handle vsmmuv3 IOTLB invalidation with non power of 2 size)- kvm-redhat-s390x-add-rhel-8.5.0-compat-machine.patch [bz#1951476]
- kvm-redhat-add-missing-entries-in-hw_compat_rhel_8_4.patch [bz#1957834]
- kvm-redhat-Define-pseries-rhel8.5.0-machine-type.patch [bz#1957834]
- Resolves: bz#1951476
  ([s390x] RHEL AV 8.5 new machine type for s390x)
- Resolves: bz#1957834
  ([ppc64le] RHEL AV 8.5 new machine type for ppc64le)- Rebase to qemu-kvm 6.0.0- kvm-virtio-pci-compat-page-aligned-ATS.patch [bz#1942362]
- Resolves: bz#1942362
  (Live migration with iommu from rhel8.3.1 to rhel8.4 fails: qemu-kvm: get_pci_config_device: Bad config data)- kvm-block-Simplify-qmp_block_resize-error-paths.patch [bz#1903511]
- kvm-block-Fix-locking-in-qmp_block_resize.patch [bz#1903511]
- kvm-block-Fix-deadlock-in-bdrv_co_yield_to_drain.patch [bz#1903511]
- Resolves: bz#1903511
  (no response on  QMP command 'block_resize')- kvm-vhost-user-blk-fix-blkcfg-num_queues-endianness.patch [bz#1937004]
- kvm-block-export-fix-blk_size-double-byteswap.patch [bz#1937004]
- kvm-block-export-use-VIRTIO_BLK_SECTOR_BITS.patch [bz#1937004]
- kvm-block-export-fix-vhost-user-blk-export-sector-number.patch [bz#1937004]
- kvm-block-export-port-virtio-blk-discard-write-zeroes-in.patch [bz#1937004]
- kvm-block-export-port-virtio-blk-read-write-range-check.patch [bz#1937004]
- kvm-spec-ui-spice-sub-package.patch [bz#1936373]
- kvm-spec-ui-opengl-sub-package.patch [bz#1936373]
- Resolves: bz#1937004
  (vhost-user-blk server endianness and input validation fixes)
- Resolves: bz#1936373
  (move spice & opengl modules to rpm subpackages)- kvm-i386-acpi-restore-device-paths-for-pre-5.1-vms.patch [bz#1934158]
- Resolves: bz#1934158
  (Windows guest looses network connectivity when NIC was configured with static IP)- kvm-scsi-disk-move-scsi_handle_rw_error-earlier.patch [bz#1927530]
- kvm-scsi-disk-do-not-complete-requests-early-for-rerror-.patch [bz#1927530]
- kvm-scsi-introduce-scsi_sense_from_errno.patch [bz#1927530]
- kvm-scsi-disk-pass-SCSI-status-to-scsi_handle_rw_error.patch [bz#1927530]
- kvm-scsi-disk-pass-guest-recoverable-errors-through-even.patch [bz#1927530]
- kvm-hw-intc-arm_gic-Fix-interrupt-ID-in-GICD_SGIR-regist.patch [bz#1936948]
- Resolves: bz#1927530
  (RHEL8 Hypervisor - OVIRT  - Issues seen on a virtualization guest with direct passthrough LUNS  pausing when a host gets a Thin threshold warning)
- Resolves: bz#1936948
  (CVE-2021-20221 virt:av/qemu-kvm: qemu: out-of-bound heap buffer access via an interrupt ID field [rhel-av-8.4.0])- kvm-qxl-set-qxl.ssd.dcl.con-on-secondary-devices.patch [bz#1932190]
- kvm-qxl-also-notify-the-rendering-is-done-when-skipping-.patch [bz#1932190]
- kvm-virtiofsd-Save-error-code-early-at-the-failure-calls.patch [bz#1935071]
- kvm-virtiofs-drop-remapped-security.capability-xattr-as-.patch [bz#1935071]
- Resolves: bz#1932190
  (Timeout when dump the screen from 2nd VGA)
- Resolves: bz#1935071
  (CVE-2021-20263 virt:8.4/qemu-kvm: QEMU: virtiofsd: 'security.capabilities' is not dropped with xattrmap option [rhel-av-8])- kvm-migration-dirty-bitmap-Use-struct-for-alias-map-inne.patch [bz#1930757]
- kvm-migration-dirty-bitmap-Allow-control-of-bitmap-persi.patch [bz#1930757]
- kvm-qemu-iotests-300-Add-test-case-for-modifying-persist.patch [bz#1930757]
- kvm-failover-fix-indentantion.patch [bz#1819991]
- kvm-failover-Use-always-atomics-for-primary_should_be_hi.patch [bz#1819991]
- kvm-failover-primary-bus-is-only-used-once-and-where-it-.patch [bz#1819991]
- kvm-failover-Remove-unused-parameter.patch [bz#1819991]
- kvm-failover-Remove-external-partially_hotplugged-proper.�x�������������HF����X�m��������XN����	�$�����������������	�	�I9�?5�d��
��	�	F���4�8�C�N�V�	��������$	R
���
\�+��T�	�(
#8
,M9`M:�M>+@+G+,H+�I+�X+�Y,\,$],�^-�b.�d0Be0Gf0Jl0Lt0du0�v1w4|x4�y54�5��5��5��5�66�7�7��
9R9{�9�9�9�g9�h9�Clibraw13942.1.25.el8Library providing low-level IEEE-1394 accessThe libraw1394 library provides direct access to the IEEE-1394 bus.
Support for both the obsolete ieee1394 interface and the new firewire
intererface are included, with run-time detection of the active stack.]�@�build.cloudlinux.com�SCloudLinuxCloudLinuxLGPLv2+CloudLinux Packaging Team <packager@cloudlinux.com>Unspecifiedhttp://www.dennedy.org/libraw1394/linuxx86_64E`ExTx*#@�#g��/H����A�A�A�A�A�����A큤��A큤��������]�@�]�@�]�@�]�@�]�@�]�@�]�@�]�@�]�@�]�@�]�@�]�@�]�@�]�@�]�@�W+�R}&]�@�R}&]�@�]�@�]�@�]�@�99d97715402e777cc8005f6e29215b14c0ae02e49e632f9a94cd690dfa81c4e0f6ebe44c3eb5ba282c47f4869316905b2fbf64430f55ee000a3c78ec223588e20dddb53925d37afeeb54f59efbd2e839b6357f9dcadcc1b907d9b17393693944ff874b61be48a64e21c238ecb436dbbed3ae3f8672624efd83a352ca57062d5a4648256fa45cbe6bb26388098cd16d14e29b1da97169c033d6b45e52f4214fd33cf9f17e7978ed46d0421371ad77b12e2a52f4be4d45c676a87dd2275c99bd945bbcbb737e60fe9deba08ecbd00920cfcc3403ba2e534c64fdeea49d6bb8750960493a417ac838919005a3cd24b98a8670f89ffe051248af8f6c70647f43490134166e5e2fd751ad71047143c956bdf362e928e08abc4b2a5a01261378ee923cb453ae4f794d7402e5371e1553cbcf4c3f5369f182421fb60d7adb0eed9ee0aeb735de020d34c6bc69ad27244be927e5e4b44ab1f078f8e0c384bae89780e50b../../../../usr/bin/dumpiso../../../../usr/lib64/libraw1394.so.11.1.0../../../../usr/bin/testlibraw../../../../usr/bin/sendisolibraw1394.so.11.1.0�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlibraw1394-2.1.2-5.el8.src.rpm������������������������������������������������������������������������������������libraw1394libraw1394(x86-64)libraw1394.so.11()(64bit)@@@@@@@@



@/sbin/ldconfig/sbin/ldconfiglibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.2)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libraw1394.so.11()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.2Zz�@Y�@Yx�@X��@X�@X��V�=@U�a@T�s@S�@S���Q��Q+R@Q�P��OU�@OB5�O�M�?�MQ0@M
�K�E�KE�J�$�Jj�I�2�Io%@Il�@I=@I9�I%Q@H�f@H���H_�@HW�@HW�@H�@G�@G�f�G3�G�@GJ�F�_�Fr@Fq-�F&@F$��F@FA�E�{@E��D��@D��@C�@C�C���C�q�Ct��B��B8�B#�B�@�q�@��@qJ@@Dw@@7H@@+j�?I�@>��@>̻�>P�>.�x��������������5����X�lx��������,���Z��$J����������������Z�Y��
ildah and podman"
- Resolves: #1803496- update to 0.7.2
- Related: RHELPLAN-25139- update to 0.7.1
- Related: RHELPLAN-25139- update to 0.7
- apply patch to fix build on RHEL-8
- Related: RHELPLAN-25139- Resolves: #1720654 - rebase to v0.4.1- rebase
- Resolves:#1666510- Resolves: #1640232
- built commit 50c7a50- Resolves: #1614856 - add manpage
- built commit 1c72a1a
- add BR: go-md2man- built commit d40ac75
- remove fedora bz ids
- Exclude ix86 and ppc64- Resolves: #1609598 - initial upload to Fedora
- bundled gnulib- correct license field- fix license- First package for Fedora/bin/sh	
1.13-1.module_el8.10.0+4120+03ad4b471.13-1.module_el8.10.0+4120+03ad4b47	fuse-overlayfs.build-id63fe6c2a360a66a10219a9c6b8091ae8da738456fuse-overlayfs.conffuse-overlayfsREADME.mdfuse-overlayfsCOPYINGfuse-overlayfs.1.gz/usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/63//usr/lib/modules-load.d//usr/share/doc//usr/share/doc/fuse-overlayfs//usr/share/licenses//usr/share/licenses/fuse-overlayfs//usr/share/man/man1/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnuELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=63fe6c2a360a66a10219a9c6b8091ae8da738456, strippeddirectoryASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)RRRRRRRRRRR
RRR	RRRR
RRRutf-874caf8e7d93a5644e0502a9d4292ce7c017657908441794990c66e126532a055container-tools:rhel8:8100020260302080735:20125149?���ۉ3!�^���P,��*����%�i��x
	*����%���^7�C�B������_?���$/�[U8�I��
פ�!!�3_&d9�[��~�E���Z�d����(��{�q�F��_�#c��dg�����x���<��Z0�<���:9T���eX��o�y��?(p�֚����C�TH�D>[������v�o�{C����-AWt	��I<\����Rr(\��KV�`p?^�}'_"‰�։O�_����[Z��ӭ�c�2XA*�d4��$�ݍ��5';��QW���);	d�e��;���l%=h;8���v����N�PZB�l��l��z.�Ymx�A"�s�Z<E4|X�FN�K�#v˶��z��j\"Ҡ�� >�=��}�Uq��$�כ�OB�9�H�)�'����e��L]��vP�&N��~*9R�7/�+ ��u�T�a��h�K�7i��_>���y8�s������W	t���L������-m����C|��44MݰH?�_�"�P���E�IG_ȕɪ�Z�J��/�3!�^���P,��*����%�i��x
	*����%��p���1)8LX?'Y�>�xfr4�x���3����h���S�ރ��3�FI�b�*Y�e
!�2���q|y���m��0�����xz�K�6�&�똪�-�|��~r�s~@o�_�[��1�/D�Rxn�kH3���yS�k�hy{��va!��K�5��_��ڐ�o�H�z�C�A
v=�[GÇd}�b�#�`Ӣ@�w{�$��:�~`	�nF��8wJX>W���e����g���	�x���9��KI��9�dmPh�3���d��H���NxY�]IJu�֚a�d����O%WfqQ������A��&?����E�l��O=��[5d�R)��{r�#F� ��'6�_zax~M�J�@�?�����gw'5�R��� DFͧ��}�0 ���3 _U�H�kxS���Te4��D�qLj
����o�CNE}罠y��1�8�����c%Ё���eZ~\뛓ܔ�D�2�;ߏ�(&����4},R�A�3a48ed44a489634c19edcf3ef2a0f6f8fc76cbf66c6ca379f04bb342a1a6f365939a2ca6a2c188e5b58910841bb03dde289460e6i��n|i��m Long) [1699076]
- [net] sctp: add SCTP_FUTURE_ASSOC for SCTP_PEER_ADDR_THLDS sockopt (Xin Long) [1699076]
- [net] sctp: use SCTP_FUTURE_ASSOC for SCTP_LOCAL_AUTH_CHUNKS sockopt (Xin Long) [1699076]
- [net] sctp: use SCTP_FUTURE_ASSOC for SCTP_MAXSEG sockopt (Xin Long) [1699076]
- [net] sctp: use SCTP_FUTURE_ASSOC for SCTP_ASSOCINFO sockopt (Xin Long) [1699076]
- [net] sctp: use SCTP_FUTURE_ASSOC for SCTP_RTOINFO sockopt (Xin Long) [1699076]
- [net] sctp: use SCTP_FUTURE_ASSOC for SCTP_PEER_ADDR_PARAMS so�x�������������8%����X�ml������$+��������������������lib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)5.6.01.501.801.932.1103502.1210.650.160.0053.0.4-14.6.0-14.0-15.2-14.14.3hK@g��@g�v@e��e��Z|;�Z8�@Yy�Y7�Y2��Y��Y�X�B�X���Xs{@X�W�%�Wq@W<Y@W7@V�=@Vp�U���Ux&�Up=�Up=�UJ@U�@T��@TR(@T=@SVY�Michal Josef Špaček <mspacek@redhat.com> - 2.18-402Jitka Plesnikova <jplesnik@redhat.com> - 2.18-401Jitka Plesnikova <jplesnik@redhat.com> - 2.18-400Jitka Plesnikova <jplesnik@redhat.com> - 2.18-399Jitka Plesnikova <jplesnik@redhat.com> - 2.18-398Fedora Release Engineering <releng@fedoraproject.org> - 2.18-397Petr Pisar <ppisar@redhat.com> - 2.18-396Fedora Release Engineering <releng@fedoraproject.org> - 2.18-395Jitka Plesnikova <jplesnik@redhat.com> - 2.18-394Jitka Plesnikova <jplesnik@redhat.com> - 2.18-393Jitka Plesnikova <jplesnik@redhat.com> - 2.18-2Petr Pisar <ppisar@redhat.com> - 2.18-1Petr Pisar <ppisar@redhat.com> - 2.16-1Fedora Release Engineering <releng@fedoraproject.org> - 2.14-5Petr Pisar <ppisar@redhat.com> - 2.14-4Petr Pisar <ppisar@redhat.com> - 2.14-3Petr Pisar <ppisar@redhat.com> - 2.14-2Petr Pisar <ppisar@redhat.com> - 2.14-1Jitka Plesnikova <jplesnik@redhat.com> - 2.11-366Jitka Plesnikova <jplesnik@redhat.com> - 2.11-365Fedora Release Engineering <releng@fedoraproject.org> - 2.11-349Petr Pisar <ppisar@redhat.com> - 2.11-348Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.11-347Jitka Plesnikova <jplesnik@redhat.com> - 2.11-346Jitka Plesnikova <jplesnik@redhat.com> - 2.11-345Jitka Plesnikova <jplesnik@redhat.com> - 2.11-2Petr Pisar <ppisar@redhat.com> - 2.11-1Petr Pisar <ppisar@redhat.com> - 2.10-1Petr Pisar <ppisar@redhat.com> - 2.05-309Petr Pisar <ppisar@redhat.com> - 2.05-308Petr Pisar <ppisar@redhat.com> 2.05-307Petr Pisar <ppisar@redhat.com> 2.05-1- Resolves: RHEL-9605
  - Add 2022 PAUSE public key.
  - Change default value for urllist to https://www.cpan.org
  - Use gpg --verify --output ... to disentangle data and signature- Resolves: RHEL-77186 - Update man page- Resolves: RHEL-77186
- Fix permission for creating site directories- Fix tests to run in correct order- Fix CVE-2023-31484
- Package tests- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebase patches to prevent from installing back-up files- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Perl 5.26 re-rebuild of bootstrapped packages- Perl 5.26 rebuild- Don't BR: perl(Module::Build) when bootstrapping- Upgrade to CPAN-2.18 as provided in perl-5.25.12- 2.16 bump- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Use Perl porter's fix for searching cpan -j file (CPAN RT#116507)
- Fix logging fatal errors (https://github.com/andk/cpanpm/pull/104)- Apply remains of CVE-2016-1238 fix from perl (CPAN RT#116507)
- Do not search cpan -j file in @INC (CPAN RT#116507)- Fix CVE-2016-1238 properly (CPAN RT#116507)- 2.14 bump
- Fix installation from a working directory (CPAN RT#115734)
- Fix "cpan -O" invocation (CPAN RT#115786)
- Do not use Net::FTP if ftp_proxy variable points to an HTTP server
  (CPAN RT#110833)
- Recognize URL schemata disregarding the case
- Fix CVE-2016-1238 (loading optional modules from current working directory)
- Recognize exact version dependency operator (CPAN RT#47934)
- Cope with non-digit version strings- Perl 5.24 re-rebuild of bootstrapped packages- Increase release to favour standalone package- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Require make package- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Perl 5.22 re-rebuild of bootstrapped packages- Increase release to favour standalone package- Perl 5.22 rebuild- 2.11 bump in order to dual-live with perl 5.22- 2.10 bump- Allow changing the configuration directory name- Create site paths for the first time (bug #1158873)- Synchronize to perl.spec modifications
- Disable non-core modules when bootstrapping- Specfile aut�x������������������X��k��������p�������C��$S����������������C�B�D��sts (vpodzime)
- Make the regexp for testing crypto_generate_backup_passphrase() stricter (vpodzime)
- Leave room in the backup passphrase for a trailing 0 (dshea)
- Add functions to get names of data/metadata internal LVs (vpodzime)
- Allow getting info for an internal LV (vpodzime)
- Gather information about all LVs (vpodzime)
- Round requested size to KBs in lvresize() (#1221247) (vpodzime)
- Add overrides for the ensure_init() function (vpodzime)
- Change the default value of the 'reload' parameter of try_reinit() (vpodzime)
- Merge pull request #21 from vpodzime/master-thpool_size_discard (vpodzime)
- Add overrides for the lvm_is_valid_thpool_chunk_size() function (vpodzime)- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Adapt the release helper targets to autotools (vpodzime)
- Fixes of paths in Makefile.am's inspired by build failures on s390 (vpodzime)
- Add an s390-specific BuildRequires (vpodzime)
- Distribute also the boilerplate_generator.py script (vpodzime)
- Fix path to the generated blockdev.pc file (vpodzime)
- Adapt tests that compile stuff to autotools (vpodzime)
- Merge pull request #18 from vpodzime/master-autotools (vpodzime)
- Merge pull request #20 from dashea/gtkdoc-sections (vpodzime)
- Use the autotools building system instead of scons (vpodzime)
- Add the two new functions to the 'blockdev' docs section (vpodzime)
- Fix the line defining the docs file for the s390 section (vpodzime)
- Add a missing #include to the kbd.api file (vpodzime)
- Prevent s390-specific stuff from being used on other architectures (vpodzime)
- Update the documentation of the is_initialized() function (vpodzime)
- Merge pull request #19 from vpodzime/master-ensure_init (vpodzime)
- Remove private macros from the gtkdoc sections file. (dshea)
- Terminate ifdef statements for arch check. (sbueno+anaconda)
- Return early from the init functions if setting up logging fails (vpodzime)
- Add tests for the new and modified init functions (vpodzime)
- Add new try_init() and try_reinit() functions (vpodzime)
- Fix for adding number of loaded plugins (vpodzime)
- Fix for ensure_init() (vpodzime)
- Rename the try_init() function to ensure_init() and improve it (vpodzime)
- Check number of loaded plugins and library initialization state (vpodzime)
- Make 'reload' default to True instead of False in overrides (vpodzime)
- Add the s390 plugin test file. (sbueno+anaconda)
- Add the s390 plugin functions. (sbueno+anaconda)
- Add the s390 plugin. (sbueno+anaconda)
- Fix a typo in the spec file. (sbueno+anaconda)
- Require the kmod-devel package for the build process (vpodzime)
- Merge pull request #16 from dashea/escrow-encoding (vpodzime)
- Merge pull request #13 from vpodzime/master-lvm_cache (vpodzime)
- Merge pull request #12 from vpodzime/master-kbd_plugin (vpodzime)
- Merge pull request #14 from vpodzime/master-better_is_multipath (vpodzime)
- Use g_strdup() instead of g_strdup_printf() to just dup a string (vpodzime)
- Fix the spelling of "escrow" (dshea)
- Make the crypto plugin string parameters const (dshea)
- Set encoding to NULL before writing the escrow packet. (dshea)
- Get cache stats directly from the device mapper (vpodzime)
- Reimplement the is_mpath_member() function using device mapper (vpodzime)
- Add the LVM cache related symbols to the LVM section in the documentation (vpodzime)
- Update the list of LVM cache related functions in features.rst (vpodzime)
- Add tests for functions related to the LVM cache technology (vpodzime)
- Implement the lvm_cache_stats() function (vpodzime)
- Implement the lvm_cache_pool_name function (vpodzime)
- Implement the lvm_cache_create_cached_lv() function (vpodzime)
- Implement lvm_cache_attach/detach() functions (vpodzime)
- Implement the lvm_cache_create_pool() function plus two support functions (vpodzime)
- Implement the lvm_cache_get_default_md_size() function (vpodzime)
- Add the 'type' parameter to the lvm_lvcreate function (vpodzime)
- Teach boilerplate_generator to work with enum return types (vpodzime)
- Teach boilerplate_gen�x������������������Xjm������*�����$�����������������*�*�,?�
�!�,�5�	>�	r������	JV](�X�Y�
��$h(mQINBFXDwiQBEAC7MwdSQOtpq5B4ye+ZDrEE2xaYSYbVF9qw6SnVZ6uTVAJ8r/7T
zc9YNi/PjP7CisIgF3W5Ds1rsNxptp6Zxu3aQDxJweWQRmxpbubdrxgIUFpryR8o
uazL8ji9cZ/nXLvTWK7ElHPhHlSIO0Kw+3VJ94igit9+VQvNIg4kCsYWIQwrdrlI
Y/MwpdiWKnNyYNedSLFTfz2VE0nIyljuDQoyDusAfVtwRmTLghpSVCmnRwu8VL7q
bdb95n5i03KshrZBhGte8SU6BuDiBBrXB/jQBlp4GiVcu3yUgrRf0MscY6gAwsDH
sivvgdMy7YW5ewsznI4w1fH0uZX4nmvx/+Hidb9V7Jr+l3nNrE0KLfcaFk22S/77
vqHEd4wiQQq6X5LRsitzoGRVuIYQDqK5O1CV83CFYqUu7Ru0Ws17VIe7ROLPqzI0
Y/Nz37OCS4lciQB6mx+qRwwt4ZevV2/4a2nnTAT/DvT28+vdLCwn/8NgjQM7o3or
2jKNuirXAA2xihL3drS4MQ8K7JTcWIzLAAY+SLthoflrmhnx4X+2ztggyfR6y9qp
zNlG7j8Nb8o3AxKcIVe/7B37HPznX0YF0LXziMchkGT3oiydvXqfbSOTWjGLpu3A
1Jf3S71vID/9x4oYTFHNejVveDVyXW+0muzlgle7xBG+zHQbjSPuyarcxQARAQAB
tC5jUGFuZWwgUHVibGljIFJQTSBLZXkgPGRldmVsb3BtZW50QGNwYW5lbC5uZXQ+
iQJPBBMBAgA5AhsDBgsJCAcDAgYVCAIJCgsEFgIDAQIeAQIXgBYhBH+2mgYvM08l
EMzf/iN4tZV+kxx8BQJdSDlEAAoJECN4tZV+kxx8q8UQALrlSuVwukXCg4MYAjHA
TrYCZYnzGc79+3WNCQi3uqUo3IX9OFqNn3il83sVbcC6EDkiFx/CP4FIYuxGdBvk
z7dC5VrKyBkwFrwj4JpavDVVF9Z2ydznj5YDZUxTMHGm1WHLZ83m/vqGsuO8kL9q
nnie7S2HO+w4xtW+i/s5omQxQyHOpE5I2818W/7Op79nU06UJ4glibzGI51sIDT8
E/yDsFxBF2cQVNhomp/JB1SdBIYfBZ/Vl5EVquvQXr7ZVDCTetsavrpLdcFApmAE
k2TPEVHJWYAYa4nRpfpaAFWp5VCwo6+AbARY/upZ40ig24nifrFAqfjSBMzRBQq0
6TQbEke2uU7bk0Elt5DTF2GyAmsQfDUt9n7PlYYjZGDInAUz39YT6l9futAJrtyG
RnO4fps5Ia9Sd+nYT5jRWTaJWryr0HYkgrzLCZK2VgViu7k4iRp4HRjRmhZYYStK
v9hSDlamP+JwbeSRMrhtK4Ru704Tjq5cX8LWx/q4VZwi+XcMhqoV1ayQ6Dt2Dd2q
HjXjVNMOXlk8pS0sdJaWhyoZm4SLIY9cQEI2ocbsvqW1T/T4MVdghUd+pPJ7ZGKD
2ZNxJYw5FnCiOEJdpWFu9YK59EtsWP2st59PrMJyEqC3AhWB+Qcumc4wcSGdzycG
5d7Nny9H8fddEUzncvqJjBruiQIcBBABAgAGBQJVw8SOAAoJEEzyecXAQkkH7LIP
/iZ9hDpH2VKbVHgNk0p4kPfHHxtmq1fLMIY7mgPo2y6rL9lCOLBjzxWqgynxqvLM
KzFboY0ARuf8FcPcdA9zARVuSxa3T1AAlxqLc5yYKYucLGbaHGRC8ezDgfVvBkJi
OeSA5pklGWtICkA6WcmesyU/8pIBj2r2Bky6md7oYd2H8mH32vK4JyxAR2xtstXX
St9mNr6eTTTxYwKf0T85fW8DmNv1IoNYEJ4J7dN5XmwQrpspE5Meq1Ir5MZyNkGk
I93Yv8vsreH/B4cCUo6pGhH5Lmthy8eugkyPDYxJ7+lJCFV+yf95DE+WEiDkVwh7
JQSYiJK+kx9rhgkiI1P8tasJBY1A5IE/07HkvJTZgJLm9m/+0NbM9dw575dqMJZv
T2lc/mEboN8aWaWJcfw7lVaoQyR2o+E6mlDeFE+l8dT1dAjEC+ZM8kEZvCbeY0uY
mwU+8AIMXiO8tDtzSAxfgrseXbmM1JxQilk3jrPXN8tpXmQNgypm7gRmcgterOjd
VI4aV2l5H9IxUiit28lqVItHEPGovuTPnqOK/JxBId0aN4a2cprBBLJmvZCD8VkC
c/gTRbeYWH8ybDfeOiyZI27y1BH18DXYJza3XjA7zh2owXVPc686EFH/xdG9bfbT
PrYABn/dmzCX3F3toynZgWrYcmk5Xe9hlPy84C2llXxYiQI+BBMBAgAoBQJVw8Ik
AhsDBQkFo5qABgsJCAcDAgYVCAIJCgsEFgIDAQIeAQIXgAAKCRAjeLWVfpMcfOZq
D/9hVsWVvrildxv59E8uOWfDUMNgjiv8nrJwhm8kvii1G4fJDRyv6MiZ4pgl5F5p
eqA94sBzaPPi53/MSeYcDykK3ya83gfHyY/UK8lkMmNGYiYpog+TeXZqUlmUb8zl
AR7bFj+3bHboBzL3zUL4D44WyPoKAsqpyaotII1pW3/lPdDLuuYmSJ0AMtUL4vRJ
8rWk2gO2JVHMKrozEyIFbuaQSxvnTI1iT9ujHWLu+jqmszqgRJq6rM01mjavlPs8
Loe234nGpZ8rgTkM5Nfe82ZPDKE5a34b2DroxOnDnaxehTV26bikrdrLWSi+Uvmu
GqaogvkgkEItl/ohNQr7WXbGgMupS7OtH3CUnP0PaHXdefVlNFIpUF5L+tG3cj/m
ygzGS7BbIH4UU75BLPu2u8tE2NEz+Cj3uLjYQJPfxJX4lyLyCiOFvw7ln6+79lG4
c1bYPVtEueGi9ABFC0fEwcE9x6WQYAVja36rLLb4ZRrq9X/CbR7lqhAntJZlQW46
iK+pGtMQmgS1gmW8AHDj+jrdSulcui07/X6HAWuzI87ujtUTxLuEoUVruYGwxOfn
Wjicd/vlfQ+1Cmzak8pYbP248bZmjc5QboK09KNvCqcvTt4R8pp5ZvwWUq80cSgj
Zpel2trCOJK6UcKtpsG9/4ucTORCOXlKEV3WU/+ZACZ5YQ==
gpg-pubkey7e931c7c5d483944gpg(cPanel Public RPM Key <development@cpanel.net>)-----BEGIN PGP PUBLIC KEY BLOCK-----
Version: rpm-4.14.3 (NSS-3)

mQINBFXDwiQBEAC7MwdSQOtpq5B4ye+ZDrEE2xaYSYbVF9qw6SnVZ6uTVAJ8r/7T
zc9YNi/PjP7CisIgF3W5Ds1rsNxptp6Zxu3aQDxJweWQRmxpbubdrxgIUFpryR8o
uazL8ji9cZ/nXLvTWK7ElHPhHlSIO0Kw+3VJ94igit9+VQvNIg4kCsYWIQwrdrlI
Y/MwpdiWKnNyYNedSLFTfz2VE0nIyljuDQoyDusAfVtwRmTLghpSVCmnRwu8VL7q
bdb95n5i03KshrZBhGte8SU6BuDiBBrXB/jQBlp4GiVcu3yUgrRf0MscY6gAwsDH
sivvgdMy7YW5ewsznI4w1fH0uZX4nmvx/+Hidb9V7Jr+l3nNrE0KLfcaFk22S/77
vqHEd4wiQQq6X5LRsitzoGRVuIYQDqK5O1CV83CFYqUu7Ru0Ws17VIe7ROLPqzI0
Y/Nz37OCS4lciQB6mx+�x�����������@�����X�@l�������� ����$��$4����������������$�%�#��derflow in vnc_client_cut_text_ext leads to CPU exhaustion [rhel-8])- kvm-virtio-fix-the-condition-for-iommu_platform-not-supp.patch [bz#2116302]
- kvm-virtio-fix-feature-negotiation-for-ACCESS_PLATFORM.patch [bz#2116302]
- Resolves: bz#2116302
  (RHEL8.6 - virtiofs will not mount fs on secure execution guest)- kvm-redhat-Update-linux-headers-linux-kvm.h-to-v5.18-rc6.patch [bz#2124757]
- kvm-target-s390x-kvm-Honor-storage-keys-during-emulation.patch [bz#2124757]
- kvm-virtiofsd-use-g_date_time_get_microsecond-to-get-sub.patch [bz#2018885]
- Resolves: bz#2124757
  (RHEL8: skey test in kvm_unit_test got failed)
- Resolves: bz#2018885
  ([virtiofs] virtiofsd debug log's timestamp is NULL)- kvm-backends-hostmem-Fix-support-of-memory-backend-memfd.patch [bz#2117149]
- kvm-i386-reset-KVM-nested-state-upon-CPU-reset.patch [bz#2125271]
- kvm-i386-do-kvm_put_msr_feature_control-first-thing-when.patch [bz#2125271]
- Resolves: bz#2117149
  (Can't run when memory backing with hugepages and backend type memfd)
- Resolves: bz#2125271
  ([RHEL8.7] Guests in VMX root operation fail to reboot with QEMU's 'system_reset' command [rhel-8.8.0])- kvm-scsi-generic-Fix-emulated-block-limits-VPD-page.patch [bz#2120279]
- Resolves: bz#2120279
  (Wrong max_sectors_kb and Maximum transfer length on the pass-through device [rhel-8.7])- kvm-migration-Introduce-ram_transferred_add.patch [bz#2110203]
- kvm-migration-Tally-pre-copy-downtime-and-post-copy-byte.patch [bz#2110203]
- kvm-QIOChannelSocket-Fix-zero-copy-flush-returning-code-.patch [bz#2110203]
- kvm-Add-dirty-sync-missed-zero-copy-migration-stat.patch [bz#2110203]
- kvm-migration-multifd-Report-to-user-when-zerocopy-not-w.patch [bz#2110203]
- kvm-migration-Avoid-false-positive-on-non-supported-scen.patch [bz#2110203]
- kvm-migration-add-remaining-params-has_-true-in-migratio.patch [bz#2110203]
- kvm-QIOChannelSocket-Add-support-for-MSG_ZEROCOPY-IPV6.patch [bz#2110203]
- kvm-pc-bios-s390-ccw-Fix-booting-with-logical-block-size.patch [bz#2112296]
- Resolves: bz#2110203
  (zerocopy capability can be enabled when set migrate capabilities with multifd and compress/xbzrle together)
- Resolves: bz#2112296
  (virtio-blk: Can't boot fresh installation from used 512 cluster_size image under certain conditions)- kvm-linux-aio-fix-unbalanced-plugged-counter-in-laio_io_.patch [bz#2105410]
- kvm-linux-aio-explain-why-max-batch-is-checked-in-laio_i.patch [bz#2105410]
- Resolves: bz#2105410
  (Stalled IO Operations in VM)- kvm-migration-Never-call-twice-qemu_target_page_size.patch [bz#2072049]
- kvm-multifd-Rename-used-field-to-num.patch [bz#2072049]
- kvm-multifd-Add-missing-documentation.patch [bz#2072049]
- kvm-multifd-The-variable-is-only-used-inside-the-loop.patch [bz#2072049]
- kvm-multifd-remove-used-parameter-from-send_prepare-meth.patch [bz#2072049]
- kvm-multifd-remove-used-parameter-from-send_recv_pages-m.patch [bz#2072049]
- kvm-multifd-Fill-offset-and-block-for-reception.patch [bz#2072049]
- kvm-multifd-Make-zstd-compression-method-not-use-iovs.patch [bz#2072049]
- kvm-multifd-Make-zlib-compression-method-not-use-iovs.patch [bz#2072049]
- kvm-migration-All-this-fields-are-unsigned.patch [bz#2072049]
- kvm-multifd-Move-iov-from-pages-to-params.patch [bz#2072049]
- kvm-multifd-Make-zlib-use-iov-s.patch [bz#2072049]
- kvm-multifd-Make-zstd-use-iov-s.patch [bz#2072049]
- kvm-multifd-Remove-send_write-method.patch [bz#2072049]
- kvm-multifd-Use-a-single-writev-on-the-send-side.patch [bz#2072049]
- kvm-multifd-Use-normal-pages-array-on-the-send-side.patch [bz#2072049]
- kvm-QIOChannel-Add-flags-on-io_writev-and-introduce-io_f.patch [bz#2072049]
- kvm-QIOChannelSocket-Implement-io_writev-zero-copy-flag-.patch [bz#2072049]
- kvm-migration-Add-zero-copy-send-parameter-for-QMP-HMP-f.patch [bz#2072049]
- kvm-migration-Add-migrate_use_tls-helper.patch [bz#2072049]
- kvm-multifd-multifd_send_sync_main-now-returns-negative-.patch [bz#2072049]
- kvm-multifd-Send-header-packet-without-flags-if-zero-cop.patch [bz#2072049]
- kvm-multifd-Implement-zero-copy-write-in-multifd-migrati�x������������������X��l��������h�������g��$w����������������g�h�f��at.com> - 2:4.1.4.3-2Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.3-1Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.2-11Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.2-10Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.2-9Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.2-8Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.2-7Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.2-6Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.2-5Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.2-4Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.2-3Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.2-2Peter Vrabec <pvrabec@redhat.com> - 2:4.1.4.2-1Tomas Mraz <tmraz@redhat.com> - 2:4.1.4.1-7Peter Vrabec <pvrabec@redhat.com> 2:4.1.4.1-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2:4.1.4.1-5Peter Vrabec <pvrabec@redhat.com> 2:4.1.4.1-4Peter Vrabec <pvrabec@redhat.com> 2:4.1.4.1-3Peter Vrabec <pvrabec@redhat.com> 2:4.1.4.1-2Peter Vrabec <pvrabec@redhat.com> 2:4.1.4.1-1Peter Vrabec <pvrabec@redhat.com> 2:4.1.4-1Peter Vrabec <pvrabec@redhat.com> 2:4.1.3.1-2Peter Vrabec <pvrabec@redhat.com> 2:4.1.3.1-1Peter Vrabec <pvrabec@redhat.com> 2:4.1.3-2Peter Vrabec <pvrabec@redhat.com> 2:4.1.3-1Peter Vrabec <pvrabec@redhat.com> 2:4.1.2-12Peter Vrabec <pvrabec@redhat.com> 2:4.1.2-11Peter Vrabec <pvrabec@redhat.com> 2:4.1.2-10Jesse Keating <jkeating@redhat.com> - 2:4.1.2-9Peter Vrabec <pvrabec@redhat.com> 2:4.1.2-8Peter Vrabec <pvrabec@redhat.com> 2:4.1.2-7Peter Vrabec <pvrabec@redhat.com> 2:4.1.2-6Peter Vrabec <pvrabec@redhat.com> 2:4.1.2-5Peter Vrabec <pvrabec@redhat.com> 2:4.1.2-4Peter Vrabec <pvrabec@redhat.com> 2:4.1.2-3Peter Vrabec <pvrabec@redhat.com> 2:4.1.2-2Peter Vrabec <pvrabec@redhat.com> 2:4.1.2-1Peter Vrabec <pvrabec@redhat.com> 2:4.1.1-2Peter Vrabec <pvrabec@redhat.com> 2:4.1.1-1Peter Vrabec <pvrabec@redhat.com> 2:4.1.0-5Peter Vrabec <pvrabec@redhat.com> 2:4.1.0-4Peter Vrabec <pvrabec@redhat.com> 2:4.1.0-3Peter Vrabec <pvrabec@redhat.com> 2:4.1.0-2Peter Vrabec <pvrabec@redhat.com> 2:4.1.0-1Peter Vrabec <pvrabec@redhat.com> 2:4.0.18.1-20Peter Vrabec <pvrabec@redhat.com> 2:4.0.18.1-19Peter Vrabec <pvrabec@redhat.com> 2:4.0.18.1-18Peter Vrabec <pvrabec@redhat.com> 2:4.0.18.1-17Peter Vrabec <pvrabec@redhat.com> 2:4.0.18.1-16Peter Vrabec <pvrabec@redhat.com> 2:4.0.18.1-15Peter Vrabec <pvrabec@redhat.com> 2:4.0.18.1-14Peter Vrabec <pvrabec@redhat.com> 2:4.0.18.1-13Peter Vrabec <pvrabec@redhat.com> 2:4.0.18.1-12Peter Vrabec <pvrabec@redhat.com> 2:4.0.18.1-11Peter Vrabec <pvrabec@redhat.com> 2:4.0.18.1-10Peter Vrabec <pvrabec@redhat.com> 2:4.0.18.1-9Dan Walsh <dwalsh@redhat.com> 2:4.0.18.1-8Peter Vrabec <pvrabec@redhat.com> 2:4.0.18.1-7Peter Vrabec <pvrabec@redhat.com> 2:4.0.18.1-6Steve Grubb <sgrubb@redhat.com> 2:4.0.18.1-5Peter Vrabec <pvrabec@redhat.com> 2:4.0.18.1-4Peter Vrabec <pvrabec@redhat.com> 2:4.0.18.1-3Peter Vrabec <pvrabec@redhat.com> 2:4.0.18.1-2Peter Vrabec <pvrabec@redhat.com> 2:4.0.18.1-1Peter Vrabec <pvrabec@redhat.com> 2:4.0.17-7Peter Vrabec <pvrabec@redhat.com> 2:4.0.17-6Peter Vrabec <pvrabec@redhat.com> 2:4.0.17-5Peter Vrabec <pvrabec@redhat.com> 2:4.0.17-4Peter Vrabec <pvrabec@redhat.com> 2:4.0.17-3Peter Vrabec <pvrabec@redhat.com> 2:4.0.17-2Peter Vrabec <pvrabec@redhat.com> 2:4.0.17-1Jesse Keating <jkeating@redhat.com> - 2:4.0.16-3.1Peter Vrabec <pvrabec@redhat.com> 2:4.0.16-3Peter Vrabec <pvrabec@redhat.com> 2:4.0.16-2Peter Vrabec <pvrabec@redhat.com> 2:4.0.16-1Peter Vrabec <pvrabec@redhat.com> 2:4.0.15-3Peter Vrabec <pvrabec@redhat.com> 2:4.0.15-2Peter Vrabec <pvrabec@redhat.com> 2:4.0.15-1Peter Vrabec <pvrabec@redhat.com> 2:4.0.14-4Peter Vrabec <pvrabec@redhat.com> 2:4.0.14-3Peter Vrabec <pvrabec@redhat.com> 2:4.0.14-2Jesse Keating <jkeating@redhat.com> - 2:4.0.14-1.2Jesse Keating <jkeating@redhat.com> - 2:4.0.14-1.1Peter Vrabec <pvrabec@redhat.com> 2:4.0.14-1Jesse Keating <jkeating@redhat.com>Peter Vrabec <pvrabec@redhat.com> 2:4.0.13-4Peter Vrabec <pvrabec@redhat.com> 2:4.0.13-3Steve Grubb <sgrubb@redhat.com> 2:4.0.13-2Peter Vrabec <pvrabec@�x�������������������X�Dmp�������������*�$1�����������������*�*�*�te (#140353)- Fix sending mails (#131583)
- Preserve file attributes when compressing files (#121523, original patch by
  Daniel Himler)- Fix #126490 typo- rebuilt- rebuilt- fix is_selinux_enabled call- Turn off selinux- Turn on selinux- always use compressext for the extension for compressed
  files; before compresscmd and compressext had to agree
- moved all compression to one code block
- compression, scripts don't use system() anymore
- compress and maillast didn't work together properly
- delaycompress and mailfirst didn't work properly
- don't use system() for mailing (or uncompressing) logs anymore
- use "-s" for speciying the subjected of mailed logs- Fix #100546, change selinux port.- Port to SELinux 2.5- Fix #90229, #90274, #89458, #91408- Old patch from pm@debian.org- Fixes from bugzilla- Commit patch from Fidelis Assis <fidelis@embratel.net.br>- Commit fix for #65299- Commit fix for #62560- Apply various bugfix patches from the openwall people- Fix bug #55809 (include logrotate.status in "files")
- Fix bug #58328 (incorrect error detection when reading state file)
- Allow 'G' size specifier from bug #57242- noreplace config file- patch from Alexander Kourakos <awk@awks.org> to stop the shared
  postrotate/prerotate scripts from running if none of the log(s) need
  rotating.  All log files are now checked for rotation in one batch,
  rather than sequentially.
- more fixes from Paul Martin <pm@debian.org>- fix from paul martin <pm@debian.org> for zero-length state files- fix segfault when logfile is in current directory.- fix URL for source location- man page cleanups, check for negative rotation counts- more minor manpage updates (#45625)- enable LFS support (debian bug #100810)
- quote filenames for running compress commands or pre/postrotate cmds (#21348)
- deprecate "errors" directive (see bug #16544 for explanation)
- update man page
- configurable compression command by Colm Buckley <colm@tuatha.org>- be less strict about whitespace near filenames.  Patch from Paul Martin <pm@debian.org>.- %defattr- see CHANGES- see CHANGES- see CHANGES- support spaces in filenames
- added sharedscripts- use %{_mandir} for man pages- don't rotate lastlog- gzipped manpages/bin/sh	

3.14.0-6.el83.14.0-6.el83.14.0-6.el8	

cron.dailylogrotatelogrotate.conflogrotate.dbtmpwtmplogrotate.build-idf13d79d62fa76902f4d0c46088b20c77280fe4e6logrotatelogrotateChangeLog.mdlogrotateCOPYINGlogrotate.conf.5.gzlogrotate.8.gzlogrotatelogrotate.status/etc//etc/cron.daily//etc/logrotate.d//etc/rwtab.d//usr/lib//usr/lib/.build-id//usr/lib/.build-id/f1//usr/sbin//usr/share/doc//usr/share/doc/logrotate//usr/share/licenses//usr/share/licenses/logrotate//usr/share/man/man5//usr/share/man/man8//var/lib//var/lib/logrotate/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryPOSIX shell script, ASCII text executableASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=f13d79d62fa76902f4d0c46088b20c77280fe4e6, strippedUTF-8 Unicode texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)cannot open `/builddir/build/BUILDROOT/logrotate-3.14.0-6.el8.x86_64/var/lib/logrotate/logrotate.st�x������������������X�:m���������������-��$=����������������-�,�.��uild for new MySQL- libtool 2 workaround for phpize (#476004)
- add missing php_embed.h (#457777)- update to 5.2.8- libtool 2 workaround- update to 5.2.7
- enable pdo_dblib driver in php-mssql- tweak Summary, thanks to Richard Hughes- move gd_README to php-gd
- update to r4 of systzdata patch; introduces a default timezone
  name of "System/Localtime", which uses /etc/localtime (#469532)- enable XPM support in php-gd
- Fix BR for php-gd- enable T1lib support in php-gd- update to 5.2.6
- sync default php.ini with upstream
- drop extension_dir from default php.ini, rely on hard-coded
  default, to make php-common multilib-safe (#455091)
- update to r3 of systzdata patch- split pspell extension out into php-spell (#443857)- Autorebuild for GCC 4.3- ext/date: use system timezone database- rebuild for libc-client bump- Rebuild for openssl bump- update to 5.2.5- correct pcre BR version (#333021)
- restore metaphone fix (#205714)
- add READMEs to php-cli- update to 5.2.4- rebuild for fixed APR- add ldconfig post/postun for -embedded (Hans de Goede)- add php-embedded sub-package- fix build with new glibc
- fix License- define php_extdir in macros.php- obsolete php-dbase- add mcrypt, mhash, tidy, mssql subpackages (Dmitry Butskoy)
- enable dbase extension and package in -common- update to 5.2.3 (thanks to Jeff Sheltren)- fix php-pdo *_arg_force_ref global symbol abuse (#216125)- rebuild against uw-imap-devel- update to 5.2.2
- synch changes from upstream recommended php.ini- enable SASL support in LDAP extension (#205772)- drop mime_magic extension (deprecated by php-pecl-Fileinfo)- fix regression in str_{i,}replace (from upstream)- update to 5.2.1
- add Requires(pre) for httpd
- trim changelog to versions >= 5.0.0- bump default memory_limit to 32M (#220821)
- mark config files noreplace again (#174251)
- drop trailing dots from Summary fields
- use standard BuildRoot
- drop libtool15 patch (#226294)- add php(api), php(zend-abi) provides (#221302)
- package /usr/share/php and append to default include_path (#225434)- fix filter.h installation path
- fix php-zend-abi version (Remi Collet, #212804)- rebuild again- rebuild for net-snmp soname bump- build json and zip shared, in -common (Remi Collet, #215966)
- obsolete php-json and php-pecl-zip
- build readline extension into /usr/bin/php* (#210585)
- change module subpackages to require php-common not php (#177821)- provide php-zend-abi (#212804)
- add /etc/rpm/macros.php exporting interface versions
- synch with upstream recommended php.ini- update to 5.2.0 (#213837)
- php-xml provides php-domxml (#215656)
- fix php-pdo-abi provide (#214281)- rebuild for curl soname bump
- add build fix for curl 7.16 API- from upstream: add safety checks against integer overflow in _ecalloc- update to 5.1.6 (security fixes)
- bump default memory_limit to 16M (#196802)- rebuild- Provide php-posix (#194583)
- only provide php-pcntl from -cli subpackage
- add missing defattr's (thanks to Matthias Saou)- move Obsoletes for php-openssl to -common (#194501)
- Provide: php-cgi from -cli subpackage- split out php-cli, php-common subpackages (#177821)
- add php-pdo-abi version export (#193202)- rebuilt for new libnetsnmp- provide mod_php (#187891)
- provide php-cli (#192196)
- use correct LDAP fix (#181518)
- define _GNU_SOURCE in php_config.h and leave it defined
- drop (circular) dependency on php-pear- update to 5.1.4- update to 5.1.3- provide php-api (#183227)
- add provides for all builtin modules (Tim Jackson, #173804)
- own %{_libdir}/php/pear for PEAR packages (per #176733)
- add obsoletes to allow upgrade from FE4 PDO packages (#181863)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuild for new libc-client soname- only build xmlreader and xmlwriter shared (#177810)- update to 5.1.2- rebuild again- rebuild for new net-snmp- enable short_open_tag in default php.ini again (#175381)- rebuilt- require net-snmp for php-snmp (#174800)- add /usr/share/pear back to ha�x�������������������X��l����������Y��$I����������������Y�X�Z��d5292202883742ef2d25a16875a47d36eb82d739f745434e1cc294815481d3f0d5292202883742ef2d25a16875a47d36eb82d739f745434e1cc29f4ece17ca8c67cfd02b1eacdc8fb4fbab9f0fc5f58eec147dc3d0badaed3945cf4ece17ca8c67cfd02b1eacdc8fb4fbab9f0fc5f58eec147dc3d0badaed3945ceb0235b9bdaaececc721740db17b30bdf202c99ac42f912042a2f88b897a0442bee35e4064f9894857b86b0f3625de398cbaa0b13ed8ef2612636a9c2a092f0erootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroot�x�������������������X��l�P����������$F�������������������
el-perl-542-xml-sax-pureperl-exceptioncpanel-perl-542-xml-sax-pureperl-productionscpanel-perl-542-xml-sax-pureperl-readercpanel-perl-542-xml-sax-pureperl-reader-streamcpanel-perl-542-xml-sax-pureperl-reader-stringcpanel-perl-542-xml-sax-pureperl-reader-uricpanel-perl-xml-saxcpanel-perl-xml-sax-documentlocatorcpanel-perl-xml-sax-parserfactorycpanel-perl-xml-sax-pureperlcpanel-perl-xml-sax-pureperl-debughandlercpanel-perl-xml-sax-pureperl-exceptioncpanel-perl-xml-sax-pureperl-productionscpanel-perl-xml-sax-pureperl-readercpanel-perl-xml-sax-pureperl-reader-streamcpanel-perl-xml-sax-pureperl-reader-stringcpanel-perl-xml-sax-pureperl-reader-uri




/bin/shcpanel-perl-542cpanel-perl-542-file-tempcpanel-perl-542-xml-namespacesupportcpanel-perl-542-xml-sax-basecpanel-perl-542-xml-sax-basecpanel-perl-542-xml-sax-exceptionrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)0.031.053.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h?�b�@a/k@`-@]��@[�s�Q+R@Busy Camels <bc@cpanel.net> - 1.02-1.cp130Busy Camels <bc@cpanel.net> - 1.02-1.cp108Busy Camels <bc@cpanel.net> - 1.02-2.cp1198Busy Camels <bc@cpanel.net> - 1.02-1.cp1198Todd Rinaldo <toddr@cpanel.net> - 1.02-1.cp1186Todd Rinaldo <toddr@cpan.org> - 1.00-1.cp1178Todd Rinaldo <toddr@cpanel.net> - 0.99-1.cp1136- Bump to 1.cp130 for re-build- Bump to 1.cp108 for re-build- Update post_build logic for Ubuntu- Bump to 1.cp1198 for debian re-build- Update from upstream: XML-SAX 1.02- Update from upstream: XML-SAX 1.00- Update from upstream: XML-SAX 0.99/bin/sh	

1.0201.02000000001.02-1.cp130~el801.02000000001.0201.0200000000SAX.pmDocumentLocator.pmIntro.podParserFactory.pmPurePerl.pmDTDDecls.pmDebugHandler.pmDocType.pmEncodingDetect.pmException.pmNoUnicodeExt.pmProductions.pmReader.pmNoUnicodeExt.pmStream.pmString.pmURI.pmUnicodeExt.pmUnicodeExt.pmXMLDecl.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/XML//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/XML/SAX//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/XML/SAX/PurePerl//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/XML/SAX/PurePerl/Reader/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textPerl POD document, ASCII textutf-836316744d78c094dbe2c94346fc9d08e7ed53424b2a5273fb532dae8bccdca7a?�����;�U�9��|��1�/7�57ea5b454c8cf2869e047bc4be2c090b02f94f9c51ab4b16db4699963f0692c8c9b6b0710667e1cd8f68fdbdd580ff2b80045bb1i?�t�Xi?�s [1854528]
- [powerpc] powerpc/watchpoint: Prepare handler to handle more than one watchpoint (Desnes Augusto Nunes do Rosario) [1854528]
- [powerpc] powerpc/watchpoint: Use builtin ALIGN*() macros (Desnes Augusto Nunes do Rosario) [1854528]
- [powerpc] powerpc/watchpoint: Introduce is_ptrace_bp() function (Desnes Augusto Nunes do Rosario) [1854528]
- [powerpc] powerpc/watchpoint: Use loop for thread_struct->ptrace_bps (Desnes Augusto Nunes do Rosario) [1854528]
- [powerpc] powerpc/watchpoint: Convert thread_struct->hw_brk to an array (Desnes�x�������������p�����X��l��������������-�$C�����������������-�)(n�46a32c29b2068f774ea38d65d66203e156a137a89c84d8b0943f4194818a1c4352b3f16f036f5f2a6521edead8d52e4130d10e62b4d0d10cb780267c65c1c090468d018b1de5467b826c979a62be603bb0bba0d3e10fa05a4be584729d128d2d8e2faef92ee5bc198c9ec0faa04b7eab345354543c967dc4d40dc6b50b102d7973fca16939eb84247740b95a79f8bd8f9fa356f159e692c6bb3695813906f5fafcb92b26ca4b524d9466cb3bd49863971e79557f7ee6dae165a1a8ce4ae8a6cf22593cd401b3ccb3e831ab496353b441c66f42f2793ab6a09aa4169e0339de60435950a6958c4e21f16a9294e5798e11a54957a454293dabfc7e804de702e38302ac5d0288b7153ef02959ef1b2e4f987909d9bcf7f4fa2580b9443d88018d158ab70b05aa18e92166e3ddef8322fdb0a19751b03cfd9f624060bfd33fbcd037ddc391a18d7b38eba80dcdbb1a0b340509b4c45f50d11c87f767de0b7f963c3617506b626b107d5a9e4b59e990b9209b857821df06c7b806c340e624268756c25fb3d070dad1ea4c079915abcca8ee91d6506eede6f69cc518cafef6c5cc8b7d86f6686583591a41c4f11da0217a50e68374d5a77ae381643eac4b9d525091a08dd7b2a3f42f23de3798141c2a27e2c0d6b943947fe01107906fa9deccc928d8e86c43698e0a74e85e64412015f29580db10b3b2a873ac0a563fd47986e0da4ab7b39c490d2b8008b050ae24937a43aa39ed14dea0733ede5d726c6254130872684e68cfde2a8479b7bc65338421e26b81c564b8780d5b321df8ee16240ce7caae29688f5460c8f05370fb4d9a689c4699476147e22b0f74c6be230281380e58c4d865526070def553b8569042ebaf15704f78ae2ac773e76b538a5b96e5eb241e8fe2e456fdf666f8519de6d423ab8b33ab32d85d42dc9873f4e9dcf3342b071bcf17a9efcab480bc0086cbc78420848acbfaacc5cf712cb0f33aeb1c6b88c38f0f4b5b33bcc1b1d20848e87ddf88675753b776e1f345bbcb89b2c385d173b017843930e606f831a3ddc02db73093258e14f73fe1473e866767953d0c4cd29bd3a3008ff1ecf42944568a2ec05e93949fa089f8e1c3b22d41c810bc4d14d200ab040cb159c1f0527db4052370bb50e04496cbe322741225c7d5d0960cfb807c99fb37b64f4b2105d083489a228ce6a71563a83af3b9b54c07473bcd2839cc5570a24fab2f0b0b2bb17616846c168ab88196a006f4da389fc395e1899d13e0d48d404cae9d858745474b0b923eb3c46cc88d383dfa54d110165a3c5f692797af4555b3eaeb265eb053b62ad60b173aeb8bdb40a7f655bbbdc728edeffd6df9fd1c54bc551334a10d93a9e8df418490ceb4614c81bcdf7e1a02d9aa2a240cf6b6a66472451b120030b04c9b7bb378d3ed50856c27ddd8352e3147e6295c666d3eca6ae1ae0f2a0d4f25df54912742af3583ec908bfafe9e9de30edd7b556c1c86e4e3b6568694dcb8aac72f0c779eb52f9a2d314c4e3d1ba206c93ca4d6427e0a487bffa030ea540a9ec8f5c16b515b1a1fc48124d737e6ded2e21c6adaf686ffd38aeb752d11ada3b9fc90615817f9e3f589c2db82e250d11b6f3255cfc82e254ea7ed1a0e5a5644702ba0bfabb13301ff9e3ee0769f419d42685205744db1ff1e58a9499b139d9d504fbcf3e254783c6d2fe0785ccd36fa842c1455981d4ac6a0d6959dfdcb9ef518060157a73a0debd9488cdd636db6fcee5d55144a5971aa0a10661abcad45fe02e15dee2d3fc36dac5828654df2b74e43b51bc6d71e32785f63c1f04c5c38ee7b16bcfc6dd9aa4546d4efb22f6d450800a2ab800e3c9bf8d5319f20a56d1da6637ebad812d66439863cc0829c9b69877eecdc170bc76bba11eeb2e2cd830ae349205d3e4ece5cf0786654994c99fd558dfe207469225e071edb6826d288033bff4b29863284eaa6da2ad21c796a307ae69c9deb47ee123556865776950f18bddcb44623502d30fe86947e45fa1f8004f666a06ff3d58b855e0050e4992c057c0e243f968830d4dab129bc52133bb9e2db01cf291e99b20ed0d0d7b6cf86c2db4f1a1a3095267537a915e6620987809b8bfd7ddaaaac8a5b589c6b9ed2858639d14bc66fcfb06b1be8af2b49d0e712d71c2738d3474a3724b07fb13189640c360deba6e4bd7600b2bf9c5ae874e86023efe9ce343588edde24a0c1f0aa96d9ed4a9cd9b5058da178fc36b427d457f139e438c70c048bbf4424905e18868713f039d3a2af5a6c76f7dece158def6e327e5d6690aa7ff4e5b864c69a47b5d834040a0adbeff973a0fac6c4d5aefa71c5af0b470de04b5acc4e4f6b326c05ede34a2a22d7e680763b800651cbc997b31b0e98eba381f92bc5c3d0329f6274b6b0d41523d5de9d9645150d6e8b7aa5b5818a9c8dea4a874a468d27fda338a6b318cf89889a6e6741672a8c2d2f621b37a76a8cdeda2a241148fa1129563adb2f7205a9a3339cfb5e570865e6dc165cd50b3ae19be42f277dc0e9eb43c351fde9f3a8901cbeb4f7e4558715d70a0c71e65d07418ecef4cccd2e010fd49682ba1aa1b356d50c75652044cc732718335e27e552a016380d0126a457ec8b984aa0d21d186f032a13767eca8ef2d19e7545960eb3ec64edf9e210baf6360f888900ca0e50f9185fb4dcb940463e0f150b38d2cad6ba9bca662696c5f653b4cc1b52bb36da66ca6e08dd5b53bb2cf531e79c8f115ebf9b8939c467e9565b33e303c6e1715265e0731ed6f78f58209733b1cf215740b365ab9abc89e5b23549e1196a4960e24aae3ca819816ab75e6e09a�x������������������Xum\8����������$2������������������?�?d���#�	/�	g���������	�����	
]
`din����(89 :G�H�I�X�Y�\�]�^�b3d�e�f�l�t�u�v��������,0
@i����g�h�Ccpanel-perl-542-task-weaken1.061.cp130~el8CPAN module - Ensure that a platform has weaken supportCpanel build perl module 'Task::Weaken'Ensure that a platform has weaken supporthеbh-centos-8.dev.cpanel.net
�perlcpanel/perlhttps://metacpan.orglinuxnoarch
��$Zص_10daf57ebd31cf2e9b3a3729e465fe7da43072f574493421e4879b4cd090c4eerootrootcpanel-perl-542-task-weaken-1.06-1.cp130~el8.src.rpm����cpanel-perl(Task::Weaken)cpanel-perl-542-task-weakencpanel-perl-task-weaken




cpanel-perl-542cpanel-perl-542-scalar-utilcpanel-perl-542-strictrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)1.143.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h?�b�@`-@[�-�Q+R@Busy Camels <bc@cpanel.net> - 1.06-1.cp130Busy Camels <bc@cpanel.net> - 1.06-1.cp108Busy Camels <bc@cpanel.net> - 1.06-1.cp1198Todd Rinaldo <toddr@cpanel.net> - 1.06-1.cp1178Todd Rinaldo <toddr@cpanel.net> - 1.04-1.cp1136- Bump to 1.cp130 for re-build- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Task-Weaken 1.06- Update from upstream: Task-Weaken 1.041.061.06-1.cp130~el81.06Weaken.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Task/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-83cb468cdd1237e2b5f413c061e06c3f7b2e0b6c6fd652a6b1b2f4eef9644e252?����.��V=6� �[	�Ҕ%5796f9c0b4b903c23604e77a87605115746f4a7fb7c77abf7eed0bc7170824bea7e4d1dea4c14debce90b53a06abfb8f11b41ed6i?�t�i?�s6]
- [wireless] rtw88: 8723d: Add 8723DE to Kconfig and Makefile (Jarod Wilson) [1860496]
- [wireless] rtw88: fill zeros to words 0x06 and 0x07 of security cam entry (Jarod Wilson) [1860496]
- [wireless] rtw88: 8723d: Add coex support (Jarod Wilson) [1860496]
- [wireless] rtw88: 8723d: set ltecoex register address in chip_info (Jarod Wilson) [1860496]
- [wireless] rtw88: 8723d: implement flush queue (Jarod Wilson) [1860496]
- [wireless] rtw88: 8723d: Add shutdown callback to disable BT USB suspend (Jarod Wilson) [1860496]
- [wireless] rtw88: 8723d: Add power tracking (Jarod Wilson) [1860496]
- [wireless] rtw88: 8723d: add IQ calibration (Jarod Wilson) [1860496]
- [wireless] rtw88: 8723d: Add LC calibration (Jarod Wilson) [1860496]
- [wireless] brcmfmac: fix WPA/WPA2-PSK 4-way handshake offload and SAE offload failures (Jarod Wilson) [1860496]
- [wireless] mt76: mt7915: fix possible deadlock in mt7915_stop (Jarod Wilson) [1860496]
- [wireless] mt76: mt7915: allocate proper size for tlv tags (Jarod Wilson) [1860496]
- [wireless] mt76: mt7915: add debugfs t�x�������������`o����X�	m@/�������~����-�$(�����������������-�-
ASCII text, with very long linesdirectoryASCII textutf-83a48cd3f1948c4b2ee6be90a7aa3b1232fa3891c79ab97a9262357d891d2b771?����QdƝS�wl��V��G,f3617d87c0ebefe3fbacd598606b3d7419f65414cb887f7b9bddc5316925940bfac3437085c1ce558189f80a1419471c80f89fc6i̒��=�i̒�Lei) [1694521]
- [block] blkcg: Fix kernel-doc warnings (Ming Lei) [1694521]
- [block] block: Unexport blk_mq_add_to_requeue_list() (Ming Lei) [1694521]
- [block] block: add BLK_MQ_POLL_CLASSIC for hybrid poll and return EINVAL for unexpected value (Ming Lei) [1694521]
- [include] blk-mq: remove unused 'nr_expired' from blk_mq_hw_ctx (Ming Lei) [1694521]
- [block] loop: access lo_backing_file only when the loop device is Lo_bound (Ming Lei) [1694521]
- [block] blk-mq: use blk_mq_sched_mark_restart_hctx to set RESTART (Ming Lei) [1694521]
- [kernel] blkcg: annotate implicit fall through (Ming Lei) [1694521]
- [block] block: Replace function name in string with __func__ (Ming Lei) [1694521]
- [block] block: fix NULL pointe�x��������������^����X�m��������8B�	�$
�����������������	�	�/sbin/ldconfig	

�2.1.2-5.el82.1.2-5.el8		

dumpisosendisotestlibraw.build-id23e7f607dd374986291ab6d6002863ce41aa901fa6b8c6d203f7f0a92e21eff864ac1a06f2c8f233d7f7408d74af624e14e9c25d952aea2ae1e943e5ea909803dea9690f7d4515ea8497d684b70edf4dlibraw1394.so.11libraw1394.so.11.1.0libraw1394NEWSREADMElibraw1394COPYING.LIBdumpiso.1.gzsendiso.1.gztestlibraw.1.gzisodump.5.gz/usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/23//usr/lib/.build-id/a6//usr/lib/.build-id/d7//usr/lib/.build-id/ea//usr/lib64//usr/share/doc//usr/share/doc/libraw1394//usr/share/licenses//usr/share/licenses/libraw1394//usr/share/man/man1//usr/share/man/man5/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnuELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=23e7f607dd374986291ab6d6002863ce41aa901f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ea909803dea9690f7d4515ea8497d684b70edf4d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=d7f7408d74af624e14e9c25d952aea2ae1e943e5, strippeddirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a6b8c6d203f7f0a92e21eff864ac1a06f2c8f233, strippedASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)	RRRR	RR
RRRR	RR
RRRR	RR
PRRRRRRRR
utf-886bcb7cabb18a4e1682687ecea64b04a1de02cb9587cd59765daf6bd76437af4?��� (��`g
	Q�d~���>�����!\P���\����C��V���Wo� ���8��{���j8Cߕ	�~��5�g8f^C���=���Jm��CV��ܣ�7l�R�g�D� �����M`m���yP���Q.z�QГm/��P%M�7L�^�T���'�S�X��k����ъR��C�i۞^�"i��H����24�fQ;>6:g�3�Rau�s�Y�5��B�;�r���P֬k{X�q~F��Q��㻄�̧���(��u�Pm��ѣ)�pʉ��X.4�&�<�pR�ͽ��h�͕xj�z�>�+ae���L����XY
zpg)F���h�Ya/"�	���J�x������Y�|�pG�bj����s+�i��W����vڬ��Q+�A��Ms�Ore���`g
	Q�d~���
��2u���p�Fi��J�x9\B�8l�3�"��zT횫l�Y��m$�ֺ�%v��Bܐ�WNje9O�O�[���YFj���H�X����@�t��nV���w̤F#���<���z��3<���~l�H�n��B_�_���(��J�'�Z���ƝZP9z���}�b/���ՠ˧i����J{�����X�|
8���(�N���I�[s��2�$	����"i+�U���7
���Y�դ4���ZW�fb��J�i*���dN����{�dч~o��Yq.�>���O{���ı��l�v�����(�X��~��!�c�N�v��w������1��kݡ�F|�M��t�}t���%���'��|O;�004c739a347fc5ec7763bae6af2958a15f5b18ef6aacbac2b3bde89210b0953142b7caeb35ec64b9ea5efb67e221feac14e2d5e0i/'�|i/&�0(AUGEAS_0.15.0)(64bit)'�.$libaugeas.so.0(AUGEAS_0.14.0)(64bit)l�I$libaugeas.so.0(AUGEAS_0.12.0)(64bit)6�($libaugeas.so.0(AUGEAS_0.11.0)(64bit)2�)$libaugeas.so.0(AUGEAS_0.10.0)(64bit)4�"#libaugeas.so.0(AUGEAS_0.1.0)(64bit)O�x�������������PN����X�Sm������������$�������������������)	
���������������xsgbVQE@4/#
���������������ythcWRFA50$�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
z
u
i
d
X
S
G
B
6
1
%
 



���������������{vjeYTHC72&!���������������|wkfZUID83'"�
�
�
�
�
�
�
�
�
�
�
�
�
�
}
x
l
g
[
V
J
E
9
4
(
#




�	�	�	�	�	�	�	�	�	�	�	�	�	�	~	y	m	h	\	W	K	F	:	5	)	$					��������������zni]XLG;6*%������������+}����+}����+}����+}����+}����+}����+}����+}����+}����+}����+}����+}����+}����+}����+}����+}����+}����+}����+}����+}����+}����+}����+}����+}����q���xD��+}�L
��q�������u�����qH��+}��>[;%5���>[;Cn�+�>[;�(�f�>[;��e��+}�`��q���7�>[;S	�#��+}��'��q��Lx���u-���$����#������ܭ�O�w�T!����L�Xd��+}E��>[;%�0��+}\��q�(��F�>[;�L,��+}	���q���x`���7�
��$�,)�*����	4P��O�w�TZ�>[;O�����+}k��>[;�j�"�>[;<'&��>~.@F�>[;'0��+}<��q�m�HI�>[;�����q�c�4t�����[�<d����G��H2�|��oV�7�A�>[;��6��+}�\�>[;�1�+�>[;�g<��>[;.&�2�>[;^<!~�+}� ?|�q�,,t^{>[;Ed0y�q�s��}v���XtG���<p���&��o>[;z�dHj�+}�d
i>[;�0�5hE�1p3TQf	>[;�$(�c>[;�^^�+}��\�q�K-8s[>[;�x)YU�N�&\�SG��4`8P�oVW7�N>[;�~<J�+}�hI>[;T.T.HE�1�%F	Vg����0D����r@>[;A\5>�+}�<�q�
A��;>[;p=9��딪�f4��끔�/�+}�
�.�+},4)>[;-�(>[; 8��%�f#I��$>[;a ��#�q�1��M >[;�
�$�+}_��q�]?�>[;���O�w�B0�h������+�+}�
�>[;<q� 
�+}f�
	>[;�*d0�A�(@�q���E�x��������������=����X�nlH{������h���������$*��������������������ogenerated by cpanspec 1.78.	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOP������������������������������������������������2.181.662.185.55.50025.50035.50025.50015.50015.502.186.00015.55.50011.0015.55.55.50081.015.53101.96011.96015.50082.125.55.501.96012.125.50035.50010.960.015.55.50025.50065.50125.55.50032.18-402.el8_10				

cpancpan-mirrorsperl-CPANChangesPAUSE2003.pubPAUSE2005.pubPAUSE2007.pubPAUSE2009.pubPAUSE2011.pubPAUSE2015.pubPAUSE2022.pubREADMETodocpan-mirrors.1.gzcpan.1.gzApp::Cpan.3pm.gzCPAN.3pm.gzCPAN::API::HOWTO.3pm.gzCPAN::Admin.3pm.gzCPAN::Debug.3pm.gzCPAN::Distroprefs.3pm.gzCPAN::FirstTime.3pm.gzCPAN::HandleConfig.3pm.gzCPAN::Kwalify.3pm.gzCPAN::Mirrors.3pm.gzCPAN::Nox.3pm.gzCPAN::Plugin.3pm.gzCPAN::Plugin::Specfile.3pm.gzCPAN::Queue.3pm.gzCPAN::Tarzip.3pm.gzCPAN::Version.3pm.gzAppCpan.pmCPANCPAN.pmAPIHOWTO.podAdmin.pmAuthor.pmBundle.pmCacheMgr.pmComplete.pmDebug.pmDeferredCode.pmDistribution.pmDistroprefs.pmDistrostatus.pmExceptionRecursiveDependency.pmblocked_urllist.pmyaml_not_installed.pmyaml_process_error.pmFTPFTP.pmnetrc.pmFirstTime.pmHTTPClient.pmCredentials.pmHandleConfig.pmIndex.pmInfoObj.pmKwalifyKwalify.pmdistroprefs.dddistroprefs.ymlLWPUserAgent.pmMirrors.pmModule.pmNox.pmPluginPlugin.pmSpecfile.pmPrompt.pmQueue.pmShell.pmTarzip.pmURL.pmVersion.pm/usr/bin//usr/share/doc//usr/share/doc/perl-CPAN//usr/share/man/man1//usr/share/man/man3//usr/share/perl5/vendor_perl//usr/share/perl5/vendor_perl/App//usr/share/perl5/vendor_perl/CPAN//usr/share/perl5/vendor_perl/CPAN/API//usr/share/perl5/vendor_perl/CPAN/Exception//usr/share/perl5/vendor_perl/CPAN/FTP//usr/share/perl5/vendor_perl/CPAN/HTTP//usr/share/perl5/vendor_perl/CPAN/Kwalify//usr/share/perl5/vendor_perl/CPAN/LWP//usr/share/perl5/vendor_perl/CPAN/Plugin/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -march=z13 -mtune=z14 -fasynchronous-unwind-tables -fstack-clash-protectioncpioxz2noarch-redhat-linux-gnuPerl script text e�x�������������@-����X�Cm([H>����*�$0�����������������*�*�*�strotate/prerotate script in nosharedscripts mode- fix #603040 - do not remove log if there is an error in
  rotate process- fix #602643 - logrotate "size" directive cannot exceed
  1895825408 bytes- revert the "create 0640 root adm" permission change (#489038)- fix #578115 - missingok problem with globs- fix #489038 -  RFE: useful permissions on log files- fix #545919 (rotate non-writable files when copy is set)- fix #525659 (man page for logrotate.conf)- fix #517321 (logrotate blocking anacron)- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- new upstream version 3.7.8- fix #468926 (segfault with very large /var/log/messages)- less aggressive approach to the fix- fix #471463 (selinux problems with logrotate)- new upstream version- improve patch for #432330
- fix #437748 - don't forget to close log files- fix #432330 segfault on corrupted status file- fix #429454 - logrotate fails due to invalid pointer- fix the selinux patch- fix #427274 - logrotate fails to preserve SELinux file contexts
- fix #427661 - SELinux stops vsftpd from working correctly- popt-devel dependency was still missing- add missing dependencies to spec file- rebuild- new upstream version
- fix #248565 logrotate never rotates /var/log/btmp
- fix compile warnings
- tabooext accepts wildcards (related #247816)
- fix minor errors and update man page (related #250059)
- fix handling of size directive (related #247410)- fix ignoring pre/postrotate arguments (related #241766)- use dateext in the default config file (#240292)
- add options to use shred for deleting files -- adapt patch sent by
  Peter Eckersley <pde@eff.org> (#239934)
- ignore .cfsaved files by default (#223476)- add error checking before running prerotate and postrotate scripts- fix error hadnling after prerotate, postrotate, firstaction 
  script failure. (http://qa.mandriva.com/show_bug.cgi?id=29979)- new upstream release.- another spec file fixes (#226104)- fix problem with compress_options_list (#227706)
- fix spec file to meet Fedora standards (#226104)- logrotate won't stop if there are some errors in configuration
  or glob failures (#166510, #182062)- fix some rpmlint issues- allow multibyte characters in readPath() (#122145)- "size" option was ignored in config files (#221341)- rebuilt for unwind info generation, broken in gcc-4.1.1-21- fix leaking file descriptor (#205072)- Use selinux raw functions- make error message, about ignoring certain config files,
  a debug message instead (#196052)- rebuild- rename ENOSUP to ENOTSUP- clean up a couple of SELinux problems. Patch from Daniel J. Walsh.- add new "minsize" option (#173088)- correct man page "extension" option description  (#185318)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- fix_free_segfaults (#172918)- new upstream release
- indent sources- fix_free_segfaults (#172918)- man description for "nodateext" option (#171577)
- remove not working "pattern" option (#171577)- some more clean up (#171587)- fix_free_segfaults (#171093)- fix leaks of tabooExts- fix_free_segfaults (#170904)- code clean up (#169885)- fix bug introduced in logrotate 3.7.2-3(#169858)
- fix some memory leaks (#169888)- do not run compression program in debug mode (#166912)- even when sharedscript option used, do postrotate 
  script before compress (#167575)- allow yearly rotations(#134612)- new upstream release- fix some "error running script" messages- fix man page (#163458,#163366)- enhance logrotate with "dateext", "maxage"- use security_getenforce() instead of selinux_getenforcemode- Add selinux_getenforce() calls to work when not in enforcing mode- rebuild- do not use tmpfile to run script anymore (#149270)- remove logrotate-3.7.1-share.patch, it doesn't solve (#140353)- Add section to logrotate.conf for "/var/log/btmp" (#117844)- Typo and missing information in man page (#139346)- compressed logfiles and logrota�x������������������X�&m������p%�����$
������������������Hp74/root/usr/lib64/php/modules//usr/lib//usr/lib/.build-id//usr/lib/.build-id/80/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnuASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=804a6032c683453028943992cf5a23ac1e5fdd70, strippeddirectoryutf-829c73c3fdf98f7983a01cf68e983e2d239472affbd7b16bbc4b24aae110d4acd?���`h8�+7Ɵ�.C�?�g��L܈]!��gdcW&���K�U�b��qi�n�
	�U�b��q�!��n$6�Y�(�n�X�����)8]J��`v|�y����<�]!��gdcW&���K�U�b��qi�n�
	�U�b��q3�8NOX�O4�6�H�s%Y��a���gT�;tX�kD�I�cdd092276414aae9580177bb8313f3c0f15808de2e264bedc1fb6e76ed5187a694215c96b9a31e64ce1008d7df93fd1430045b68aiݵ_y�iݵ1m: Remove unnecessary V_IRQ unsetting (Vitaly Kuznetsov) [1841490]
- [x86] kvm: svm: Merge svm_enable_vintr into svm_set_vintr (Vitaly Kuznetsov) [1841490]
- [x86] kvm: vmx: Handle preemption timer fastpath (Vitaly Kuznetsov) [1841490]
- [x86] kvm: x86: TSCDEADLINE MSR emulation fastpath (Vitaly Kuznetsov) [1841490]
- [x86] kvm: x86: introduce kvm_can_use_hv_timer (Vitaly Kuznetsov) [1841490]
- [x86] kvm: vmx: Optimize posted-interrupt delivery for timer fastpath (Vitaly Kuznetsov) [1841490]
- [x86] kvm: x86: Introduce more exit_fastpath_completion enum values (Vitaly Kuznetsov) [1841490]
- [x86] kvm: x86: Introduce kvm_vcpu_exit_request() helper (Vitaly Kuznetsov) [1841490]
- [x86] kvm: x86: Print symbolic names of VMX VM-Exit flags in traces (Vitaly Kuznetsov) [1841490]
- [x86] kvm: vmx: Introduce generic fastpath handler (Vitaly Kuznetsov) [1841490]
- [x86] kvm: nvmx: Drop superfluous VMREAD of vmcs02.GUEST_SYSENTER_* (Vitaly Kuznetsov) [1841490]
- [x86] kvm: nvmx: Truncate writes to vmcs.SYSENTER_EIP/ESP for 32-bit vCPU (Vitaly Kuznetsov) [1841490]
- [x86] kvm: vmx: Improve handle_external_interrupt_irqoff inline assembly (Vitaly Kuznetsov) [1841490]
- [documentation] kvm: documentation: Fix up cpuid page (Vitaly Kuznetsov) [1841490]
- [x86] kvm: x86: Sanity check on gfn before removal (Vitaly Kuznetsov) [1841490]
- [virt] kvm: No need to retry for hva_to_pfn_remapped() (Vitaly Kuznetsov) [1841490]
- [x86] kvm: x86: Force ASYNC_PF_PER_VCPU to be power of two (Vitaly Kuznetsov) [1841490]
- [x86] kvm: vmx: Remove unneeded __ASM_SIZE usage with POP instruction (Vitaly Kuznetsov) [1841490]
- [x86] kvm: x86/mmu: Add a helper to consolidate root sp allocation (Vitaly Kuznetsov) [1841490]
- [x86] kvm: x86/mmu: Drop KVM's hugepage enums in favor of the kernel's enums (Vitaly Kuznetsov) [1841490]
- [x86] kvm: x86/mmu: Move max hugepage level to a separate #define (Vitaly Kuznetsov) [1841490]
- [x86] kvm: x86/mmu: Tweak PSE hugepage handling to avoid 2M vs 4M conundrum (Vitaly Kuznetsov) [1841490]
- [x86] kvm: x86: Cleanup vcpu->arch.guest_xstate_size (Vitaly Kuznetsov) [1841490]
- [x86] kvm: nvmx: Tweak handling of failure code for nested VM-Enter failure (Vitaly Kuznetsov) [1841490]
- [x86] kvm: x86/mmu: Capture TDP level when updating CPUID (Vitaly Kuznetsov) [1841490]
- [x86] kvm: vmx: Move nested EPT out of kvm_x86_ops.get_tdp_level() hook (Vitaly Kuznetsov) [1841490]
- [x86] kvm: vmx: Add proper cache tracking for CR0 (Vitaly Kuznetsov) [1841490]
- [x86] kvm: vmx: Add proper cache tracking for CR4 (Vitaly Kuznetsov) [1841490]
- [x86] kvm: nvmx: Unconditionally validate CR3 during nested transitions (Vitaly Kuznetsov) [1841490]
- [x86] kvm: x86: Save L1 TSC offset in 'struct kvm_vcpu_arch' (Vitaly Kuznetsov) [1841490]
- [x86] kvm: nvmx: Skip IBPB when temporarily switching between vmcs01 and vmcs02 (Vitaly Kuznetsov) [1841490]
- [x86] kvm: nvmx: Skip IBPB when switching between vmcs01 and vmcs02 (Vitaly Kuznetsov) [184149�x������������������X1�k���������W���@������$P����������������@�?�A�� (vpodzime)
- Do not require python3 for the boilerplate generation script (vpodzime)
- Use a proper initialization value for 'GPollFD fds[2]' (vpodzime)
- Deal with older parted and libblkid (vpodzime)
- Make python3 and gtk-doc optional (vpodzime)
- Bump the version of the utils library (vpodzime)
- Fix docstring for 'bd_md_node_from_name' (vtrefny)
- Add tests for added mdraid methods (vtrefny)
- Skip 'MDTestNominateDenominateActive' unless feeling lucky (vtrefny)
- MDRaid tests: change 'wait_for_resync' to wait for given action (vtrefny)
- Add functionality need by storaged to mdraid plugin (vtrefny)
- Move 'echo_str_to_file' method to utils (vtrefny)
- Add a function to setup a loop device from a file descriptor (vpodzime)
- Add functions to get/set the autoclear flag on a loop device (vpodzime)
- Fix checking /proc/mdstat for resync action (vtrefny)
- Adapt the test config files to version 2.x (vpodzime)- Rebuild for Python 3.6- Rebuild for a chain-build with storaged (vpodzime)- Do not require an exclusive lock on the device to commit part stuff (vpodzime)
- Prevent failure if there are no btrfs subvolumes (vpodzime)
- Fix the test for getting version of a failing utility (vpodzime)
- Also run the utils tests (vpodzime)
- Bump the version of the pkgconfig module (vpodzime)
- Include utils.h in plugins that need it (vpodzime)
- Fix dependency check in fs plugin (vtrefny)
- Add support for setting part id (part type) on msdos part tables (vtrefny)
- Trim the extra info for MD RAID's name (vpodzime)
- Add xfsprogs and dosfstools as dependencies of the fs plugin (vpodzime)
- Fix md_name_from_node to work with the "/dev/" prefix (vpodzime)
- New major upstream release- Revert "Prevent issues between libparted and udev" (vpodzime)
- Revert "Open the device file as RDWR when committing parts" (vpodzime)- Open the device file as RDWR when committing parts (vpodzime)
- Handle mdadm --examine output during migration (adamw)
  Resolves: rhbz#1381996- Prevent issues between libparted and udev (vpodzime)- Make sure all object paths are passed and extracted as such (vpodzime)
  Resolves: rhbz#1374973- Do not report volume name for FW RAID container device (vpodzime)
  Related: rhbz#1379865
- Search for just "UUID" in mdadm --examine output (vpodzime)
  Related: rhbz#1379865
- Use 'mdadm --examine --export' to get MD RAID level (vpodzime)
  Related: rhbz#1379865- Try to search for "RAID Level" in mdadm's output (vpodzime)
  Resolves: rhbz#1379865
- Fix the number passed to LVM DBus as a job-creation timeout (vpodzime)
  Resolves: rhbz#1378970- Explicitly cast number constants for GVariants (vpodzime)- Add functions for creating thin/cache pools from existing LVs (vpodzime)
- Add the new mpath_get_members() function to the docs (vpodzime)- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- Add a function to get all mpath member devices (vpodzime)
- Fix backport issues in the zfcp-related functionality (#1348442) (vpodzime)
- Revert "Fix a few const params in the s390 plugin." (vpodzime)
- Fix creation of the version-only tags (vpodzime)- Include the LV roles in the LVdata (vpodzime)
- Add a few missing items to the documentation (vpodzime)
- Document fields of the structures (vpodzime)
- Report (meta)data LV name properly for cache pools in lvm-dbus (vpodzime)
- Add information about related LVs to LVMLVdata (vpodzime)
- Remove unused code for getting supported functions (vpodzime)
- Add zFCP functionality to s390 plugin (sbueno+anaconda)
- Fix a few const params in the s390 plugin. (sbueno+anaconda)- Ignore merge commits when creating changelog (vpodzime)
- Only take the number of the first %changelog line found (vpodzime)
- Add some more detailed description to the part plugin (vpodzime)
- Fix a few extra issues with the const types (vpodzime)
- Add function for getting best free region (vpodzime)
- Add function for getting free regions (vpodzime)
- Fix the error message when setting part flag fails (vpodzime)
- Add function for setting disk flags (vpodzim�x�������������������X�)m��������$�����������������?�?Xd��!�'�	3�	_���������	�������	
U
X\af����(�8�9�:�G�H�I�XY\,]0^?brd�e�f�l�t�u�v�����Thl
|�����g�h�Ccpanel-perl-542-io-interactive1.0271.cp130~el8CPAN module - Utilities for interactive I/OCpanel build perl module 'IO::Interactive'Utilities for interactive I/Oh�%bh-centos-8.dev.cpanel.net"kartistic_2cpanel/perlhttps://metacpan.orglinuxnoarch"k�$h�9103ca700e0a5822d310282380a487772db3cd49936d63f3c5bc5002a9a003b2frootrootcpanel-perl-542-io-interactive-1.027-1.cp130~el8.src.rpm����cpanel-perl(IO::Interactive)cpanel-perl-542-io-interactivecpanel-perl-io-interactive




cpanel-perl-542rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h�@b���b�@`-@W��@Q+R@Todd Rinaldo <toddr@cpan.org> - 1.027-1.cp130Todd Rinaldo <toddr@cpan.org> - 1.023-1.cp108Busy Camels <bc@cpanel.net> - 1.022-1.cp108Busy Camels <bc@cpanel.net> - 1.022-1.cp1198Todd Rinaldo <toddr@cpan.org> - 1.022-1.cp1162Todd Rinaldo <toddr@cpanel.net> - 0.0.6-1.cp1136- Update from upstream: IO-Interactive 1.027- Update from upstream: IO-Interactive 1.023- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: IO-Interactive 1.022- Update from upstream: IO-Interactive 0.0.61.0271.027-1.cp130~el81.027Interactive.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/IO/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-8ee515a8a69b79a56ddeb7caab772fe7808824c114a4a904653c7b8f36eab8014?����4(�
5���0R�N�}�/71acd4c5258fcb006dec9f2e30cd19847bb593d1a9e8798f4ca3123768f60fef4d1a85d92c70175b62fe0d4cc54e8c54dafd872di?�z#�i?�s: the rest, stop using tty_schedule_flip() (Rafael Aquini) [2078869] {CVE-2022-1462}
- tty: drivers/tty/, stop using tty_schedule_flip() (Rafael Aquini) [2078869] {CVE-2022-1462}
- vt: keyboard, use tty_insert_flip_string in puts_queue (Rafael Aquini) [2078869] {CVE-2022-1462}
- vt: use tty_insert_flip_string in respond_string (Rafael Aquini) [2078869] {CVE-2022-1462}- intel_th: pci: Add Raptor Lake-S CPU support (Michael Petlan) [2040035]
- intel_th: pci: Add Raptor Lake-S PCH support (Michael Petlan) [2040035]
- virtio-net: support XDP when not more queues (Eugenio Pérez) [2122225]
- virtio_net: Don't process redirected XDP frames when XDP is disabled (Eugenio Pérez) [2122225]
- virtio_net: Fix not restoring real_num_rx_queues (Eugenio Pérez) [2122225]
- x86,config: Enable straight-line-speculation fix (Wander Lairson Costa) [2062175] {CVE-2021-26341}
- x86/alternative: Relax text_poke_bp() constraint (Wander Lairson Costa) [2062175] {CVE-2021-26341}
- perf/x86: Add support for perf text p�x������������� �����X��j��������@���������$�����������������������at.com> - 20141117-4Jens Petersen <petersen@redhat.com> - 20141117-3Jens Petersen <petersen@redhat.com> - 20141117-2Jens Petersen <petersen@redhat.com> - 20141117-1Peng Wu <pwu@redhat.com> - 20141001-5Peng Wu <pwu@redhat.com> - 20141001-4Parag Nemade <pnemade AT redhat DOT com> - 20141001-3Pravin Satpute <psatpute@redhat.com> - 20141001-2Pravin Satpute <psatpute@redhat.com> - 20141001-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 20130807-2Pravin Satpute <psatpute@redhat.com> - 20130807-1Pravin Satpute <psatpute@redhat.com> - 20130624-1Pravin Satpute <psatpute@redhat.com> - 20130411-5Pravin Satpute <psatpute@redhat.com> - 20130411-4Pravin Satpute <psatpute@redhat.com> - 20130411-3Pravin Satpute <psatpute@redhat.com> - 20130411-2Pravin Satpute <psatpute@redhat.com> - 20130411-1- Add CI tests
  Resolves: rhbz#1682152
- Fix typos in fontconfig config for Kannada
  Resolves: rhbz#1764502- change the Sinhala fontconfig priority to 65 (#1450802)- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- use _font_pkg- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- add a fontconfig priority option to the notopkg macro,
  which allows overriding the default 66 priority- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Resolves #1321685 - Added Noto Mono font.
- License changed from ASL 2.0 to OFL. 
- New package addition: Mono, Serif Bengali, Serif Devanagari
- Serif Gujarari, Serif Malayalam, Serif Tamil and Serif Telugu.- Resolves #1368772 - Fixes issue with LICENSE file.- Resolves #1269404 - Update to new git release 20150929
- Upstream divided google-noto-fonts package into noto-cjk-font and noto-emoji
- Removed packages: google-noto-color-emoji-fonts, google-noto-sans (cjk-fonts,
- japanese-fonts, simplified-chinese-fonts and traditional-chinese-fonts)
- Replaced by google-noto-cjk-fonts and google-noto-emoji-fonts
- New subpackages - google-noto-nastaliq-urdu-fonts and google-noto-sans-tibetan-fonts- Fix for python2 fonttools- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Updating to git snapshot d47480343178.
- Remove Thaana and Oriya from under-development list.
- Add Syriac requirements from Unicode Core Specification.- Updating to git snapshot 762640379a51.
- Added 2 new packages Oriya and Oriya-UI.
- Update Hebrew, Georgian, and Ethiopic fonts.
- Fix cmap of U+06F7 to Urdu form of digit 7.- Resolves #1162341: Packaged Noto Color Emoji- improve generated font subpackage descriptions
- it is Hanunoo not Hanuno!
- specify font filenames more precisely- add obsoletes to cover the change of package names for Hanuno, Linear B,
  and Meetei Mayek- create the fonts subpackages with a macro- move cjk fonts fontconfig priority from 65-0 to 66
- generate the appinfo metainfo for the subpackages
- use a single for-loop to install the font config and appdata files
- move parent appinfo metainfo to common (Parag Nemade)- update to latest git (aae16d0cd626)
- package Japanese, Korean, and CJK fonts
- add Thaana font
- add common subpackage for license and doc files
- order spec subpackages lexically- Rename Chinese sub-packages- Add Chinese fonts- Add metainfo file to show this font in gnome-software- Resolves #1159562: Typo in fontconfig file- Google stops release tarball. Zip file derived from git Download zip.
- 45 new packages added as follows.
- kufi-arabic-fonts, naskh-arabic-fonts, naskh-arabic-ui-fonts, sans-balinese-fonts, 
- sans-bamum-fonts, sans-batak-fonts, sans-buginese-fonts, sans-buhid-fonts, 
- sans-canadian-aboriginal-fonts, sans-cham-fonts, sans-cuneiform-fonts, sans-cypriot-fonts, 
- sans-gothic-fonts, sans-gurmukhi-fonts, sans-gurmukhi-ui-fonts, 
- sans-inscriptional-pahlavi-fonts, sans-inscriptional-parthian-fonts, sans-javanese-fonts, 
- sans-lepcha-fonts, sans-limbu-fonts, sans-linearb-fonts, sans-mongolian-fonts, 
- sans-myanmar-fonts, sans-myanmar-ui-fonts, sans-new-tai-lue-fonts, sans-ogha�x�������������8�����X-Em�D��������*�����$2�����������������*�*latus' (No such file or directory)RRRR
R	RRRR
RRRRRRRutf-8a46bf0b563d46795e948503690e305a01c867be99526bb9cdbe803db57f431a6?��� B8��!�<���Q�d~���d+h�
	Q�d~��������b�mfT�2���-����o`FNqEDz���y�lR��02h�oJ�;���m55�Y��Jjȃ��Bxn�)sD-�>֕3����,��μ:��mh���z���/�ػ ���(ߥ��y�>�G�DKmܻ]�0�VF$t�|���A�̔.a6K#��'�X�T�TRGtǺr(��9�Lt�_��FM>p�ԋm���8���X�ًcz�rhg%fB�P����Rυ��6T
���-������ulM4P�X�f��WP����Y(n�3��R�Qſ1&2��1i#�sʆL��˔Y�a�B����'�N��ܶ���ȨB�@}`�\Pt\��pN�A�~�M���Y�O�njk#A���ssR�i��QF���Q�@�=���5q���!�<��ΰ��Q�d~���d+h�
	Q�d~���R��ڮs��c[W�l�h�C#�/�o��h�j���ߤ�hm7:��1��Y����-�_Eis�Ī��4�u�3��*'�`^���Y��ю��l���pU1� �}�ۄ�ֽJ�i��ը�jG��n��j��KkLd��uV�b�)��>�Fn�ҚɃ��E�^��įACo�E�pf+�`�&�_�.r�.�S0U�ps?�4'o#���t����	�9�M�WOө����L�}�*�}��3�g��:�zI(��C�at���=`�-���:.Ş�!U�BSX����?�����\(��.˾	(���W?Ĕ1]��UK'C�L���M5�ӝ�ꣳ11�;a?��h�K	���s��,]i+{ޘ�l{ĭ]�_���43d61c43a71af3b9700ec08e1860bde3619b3ae14ccbdc6bf5f908e828ef7b06b31e437f436ce1e29f28946e76ad954b4efead38i/'�Ci/&�+,bebe@latinbgcacsdadeelesfrglhrhuiditjakoplptrorusksrsvtrukzhzh����239-82.el82392390.9239-82.el8239-82.el8239-82.el8206239-82.el80.9229-5206							













		






























 !"#$%&'()*+,-../01234566789:;<<=>>?@AAABBCDEEFGHIJKKKLMMMMMMMMMMMMLLLNOPOQOROSLLLLLTTTTTTTLULVVVVVVVVVVVVVVVVVVVVVVVVVVVVWVVVVVVVVVVVVVVVVVXXXXXVVVVVVVVVVVVVVVVVVYVVVVVVVVVVVVVVVVVVVVZZZZVVVVVVV[[[[[[[[[[[[[[[[[[[VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV�x������������������X�l��������H�������$�����������������������i�e1i�e0i�ei�e0i�e/i�e/i�e0i�e/i�e/i�e/i�e0i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e/i�e(i�e(i�e)i�e(i�e)i�e(i�e(i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e)i�e*i�e*i�e*i�e*i�e*i�e*i�e*i�e*i�e*i�e*i�e*i�e*i�e*i�e*i�e*i�e+i�e+i�e+i�e+i�e+i�e+i�e+i�e+i�e+i�e+i�e+i�e+i�e+i�e)i�e)i�e,i�e+i�e+i�e,i�e+i�e+i�e+i�e+i�e+i�e+i�e+i�e,i�e,i�e,i�e,i�e,i�e,i�e,i�e,i�e,i�e+i�e+i�e+i�e+i�e,i�e,i�e,i�e/i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e/i�e/i�e/i�e/i�e/i�e)i�e)i�e1i�e1i�e1i�e-i�e,i�e-i�e,i�e-i�e-i�e-i�e-i�e-i�e-i�e-i�e-i�e-i�e-i�e-i�e-i�e-i�e-i�e.i�e-i�e-i�e-i�e-i�e-i�e-i�e-i�e-i�e-i�e-i�e-i�e-i�e-i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�e.i�ei�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�e0i�ei�e(i�e(i�e#i�e#i�e#i�e#i�e#i�e#i�e#i�e#i�e#i�e#i�e#i�e#i�e167b0be7fa9899f040d3d731d635f98866841306623411ab6bfb727f8b13be84da06f5ccee56de7879de20f59d39692d45ac81c058d16bceae35b203ad52e3d7c712fecfb3daf05f3f9f30fbf781a6746dfa950a2ccfc485eb257f9f34b1b77523ffaffb78904b5f929c0df3dfcfa7c0552a74d66db6677ba394d904cd74a9c6df9a43d0609d797975ebbe0b777ce0a49af806db9b7f15eaacaa983d354027a1a5e7a0836adc18f1f014a5daaf9a393ac05cfe866087956f935fe0a2638cd9a7f15faed69b1755af68b1f5515af2894e6e9bc16174de427fb9a98cd89d7c1361d515489bf6696f20f1bb9c22632bf74b25c5cf7b45647f092fcb9de13962fbd3674248d214a316fae0a0723727160ad7eb3ae6e8e97ec5620c4da7a0de94a9415b0d15f699e1071fdeafb18ac2ac85d2169c01ba7d02054341268954a939ca39e10b99ebe5b5a34d00febc7b39fa995363a8f8e2c36b12357093aa76a532d797c367f6bbc2aabec24a64deb54f51d3a6a1d268b6223b6394b158d7bcef6760d41ba3bf8df6e0d59fc79ef150d7ea365f707a83bf089622069507753fcdb1a7f35e9fee011f48e5fa6e14b639aab47a68849d56aeec1359b1e14ea2752b095baf8fbdc87a43ad4edc378b6b159430acb266faa19ae99757a8c3ece689565a57de52ed623945b2e805e68565c9bc9ddeb626e131d5146e647b537f9a19b4db6e1fa85f2b3bfaec42cf50a36bd2fb07bb2bea4ddfcd7abe6ac4bc21f58c09d2f10bb5fad99d51f4d25c23728cc9ec67d04b223f693f557ee02c82e1a633dbc0a3dd3fc395c0844f1d96b55b95fc27343de60eb80dd3cffa7221bdd18803f94a6b56bd8ffd153af16466b6be788505349359d522ad38fbf48c070d87257b129db7f74ad7446b7e9daf91751dc4be8b51c08fc2af73f097271057ae768e9906931ac0bb5b34d53f43e4b00eacad95964b57a3b440fa2283a276ef83a0bf8363e23efbcc697a8fe26dd0e2ed2843af06b0e07e0f2b1277ace07b02a48720b2472568df633ec657758a1c3da68dba11a44589e60dd66f473ce19939df5bc4d98d9530729386dd9838d027fcd779038639bc2ae1c71b2194ff709324edb32894e74c88da70f6952793a54f0bf5a55a677a7b2763b1d09a9c366fc30f4dd1df2e18df88cc3074d539da57c0650d7232fbff3fe32545281386d13c272a25bbdeb76eda24ef7197d7617bad8d151e6653483873131c2a1828eb7f5638c6af5afa6bbc7fa64a2a47489b287968fcffe5d122e500c2dae94fb53abc71eda4629b9d362cbbf8ff9954b6aa36df56d2863405c05420dd081e00a9b5004dee5612b1080c79ef63c9f39e10e1a1d2e76cac499fc41c0a8d6e4fd7c8c8aa941ab27c46b69430b6bf003d84df17e1ef6b718bdf52389c348cfd9cd77ff80610dc33736a30c7c6c0c48a9dff1fb9c11124546cc9ab10f8c8d4f542e6a320faa2ae7b99461be8f9790c5b88c56cb3fb8fb4a6a9c14f59996586bf1263d4d1636a2efac2cfff03c38abe1622fb509a0679914e73326a52097848ae4bb9480b6e355920157cc07e530558163197b957fa2f2ded4069984a22ad184a3b2dcf530a26dd87cb223d7788d69a96056cc3c518f0336355efa53f3a3173d5a30558a6847d9653867593ea0cf4590df99c4bb5f2a55667c9907597f590611a8ccbacf401cee43bc416f3b75c50d7200e52d41c99a92ba707f7627a29ff8bfcba6552afb30340b6121f7f81c4f50fa8bc1e05c2cb37a9366e523a3bb556d1299dc85c290bd51b10df12b480544bb16f46345fd0e6539278b28c6bbfa2f029e0e271aa6e9d2c4b8cc066f07d317c47�x�������������������X��l�b�������L�$
����������������LLL� 5.3.0-5Joe Orton <jorton@redhat.com> 5.3.0-4Joe Orton <jorton@redhat.com> 5.3.0-3Joe Orton <jorton@redhat.com> 5.3.0-2Remi Collet <Fedora@famillecollet.com> 5.3.0-1Remi Collet <Fedora@famillecollet.com> 5.2.10-1Remi Collet <Fedora@FamilleCollet.com> - 5.2.9-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.2.8-10Joe Orton <jorton@redhat.com> 5.2.8-9Joe Orton <jorton@redhat.com> 5.2.8-8Joe Orton <jorton@redhat.com> 5.2.8-7Joe Orton <jorton@redhat.com> 5.2.8-5Joe Orton <jorton@redhat.com> 5.2.8-4Joe Orton <jorton@redhat.com> 5.2.8-3Remi Collet <Fedora@FamilleCollet.com> 5.2.8-2Remi Collet <Fedora@FamilleCollet.com> 5.2.8-1Remi Collet <Fedora@FamilleCollet.com> 5.2.7-1.1Remi Collet <Fedora@FamilleCollet.com> 5.2.7-1Joe Orton <jorton@redhat.com> 5.2.6-7Joe Orton <jorton@redhat.com> 5.2.6-6Remi Collet <Fedora@FamilleCollet.com> 5.2.6-5Remi Collet <Fedora@FamilleCollet.com> 5.2.6-4Joe Orton <jorton@redhat.com> 5.2.6-3Joe Orton <jorton@redhat.com> 5.2.5-7Fedora Release Engineering <rel-eng@fedoraproject.org> - 5.2.5-6Joe Orton <jorton@redhat.com> 5.2.5-5Joe Orton <jorton@redhat.com> 5.2.5-4Release Engineering <rel-eng at fedoraproject dot org> - 5.2.5-3Joe Orton <jorton@redhat.com> 5.2.5-2Joe Orton <jorton@redhat.com> 5.2.4-3Joe Orton <jorton@redhat.com> 5.2.4-2Joe Orton <jorton@redhat.com> 5.2.3-9Joe Orton <jorton@redhat.com> 5.2.3-8Hans de Goede <j.w.r.degoede@hhs.nl> 5.2.3-7Joe Orton <jorton@redhat.com> 5.2.3-6Joe Orton <jorton@redhat.com> 5.2.3-5Joe Orton <jorton@redhat.com> 5.2.3-4Joe Orton <jorton@redhat.com> 5.2.3-3Joe Orton <jorton@redhat.com> 5.2.3-2Joe Orton <jorton@redhat.com> 5.2.2-4Joe Orton <jorton@redhat.com> 5.2.2-3Joe Orton <jorton@redhat.com> 5.2.2-2Joe Orton <jorton@redhat.com> 5.2.1-5Joe Orton <jorton@redhat.com> 5.2.1-4Joe Orton <jorton@redhat.com> 5.2.1-3Joe Orton <jorton@redhat.com> 5.2.1-2Joe Orton <jorton@redhat.com> 5.2.0-10Joe Orton <jorton@redhat.com> 5.2.0-9Joe Orton <jorton@redhat.com> 5.2.0-8Joe Orton <jorton@redhat.com> 5.2.0-7Joe Orton <jorton@redhat.com> 5.2.0-6Joe Orton <jorton@redhat.com> 5.2.0-5Joe Orton <jorton@redhat.com> 5.2.0-4Joe Orton <jorton@redhat.com> 5.2.0-3Joseph Orton <jorton@redhat.com> 5.1.6-4Joe Orton <jorton@redhat.com> 5.1.6-3Joe Orton <jorton@redhat.com> 5.1.6-2Jesse Keating <jkeating@redhat.com> - 5.1.4-8.1Joe Orton <jorton@redhat.com> 5.1.4-8Joe Orton <jorton@redhat.com> 5.1.4-7Joe Orton <jorton@redhat.com> 5.1.4-6Radek Vokal <rvokal@redhat.com> 5.1.4-5.1Joe Orton <jorton@redhat.com> 5.1.4-5Joe Orton <jorton@redhat.com> 5.1.4-3Joe Orton <jorton@redhat.com> 5.1.3-3Joe Orton <jorton@redhat.com> 5.1.2-5Jesse Keating <jkeating@redhat.com> - 5.1.2-4.3Jesse Keating <jkeating@redhat.com> - 5.1.2-4.1Joe Orton <jorton@redhat.com> 5.1.2-4Joe Orton <jorton@redhat.com> 5.1.2-3Joe Orton <jorton@redhat.com> 5.1.2-2Joe Orton <jorton@redhat.com> 5.1.1-8Joe Orton <jorton@redhat.com> 5.1.1-7Joe Orton <jorton@redhat.com> 5.1.1-6Jesse Keating <jkeating@redhat.com>Joe Orton <jorton@redhat.com> 5.1.1-5Joe Orton <jorton@redhat.com> 5.1.1-4Joe Orton <jorton@redhat.com> 5.1.1-3Joe Orton <jorton@redhat.com> 5.1.1-2Tomas Mraz <tmraz@redhat.com> 5.0.5-6Joe Orton <jorton@redhat.com> 5.0.5-5Joe Orton <jorton@redhat.com> 5.0.5-4Joe Orton <jorton@redhat.com> 5.0.5-3Joe Orton <jorton@redhat.com> 5.0.4-11Joe Orton <jorton@redhat.com> 5.0.4-10Joe Orton <jorton@redhat.com> 5.0.4-9Joe Orton <jorton@redhat.com> 5.0.4-8Joe Orton <jorton@redhat.com> 5.0.4-7Joe Orton <jorton@redhat.com> 5.0.4-6Joe Orton <jorton@redhat.com> 5.0.4-5Joe Orton <jorton@redhat.com> 5.0.4-4Joe Orton <jorton@redhat.com> 5.0.4-3Joe Orton <jorton@redhat.com> 5.0.4-2Joe Orton <jorton@redhat.com> 5.0.4-1Joe Orton <jorton@redhat.com> 5.0.3-5Joe Orton <jorton@redhat.com> 5.0.3-4Joe Orton <jorton@redhat.com> 5.0.3-3Joe Orton <jorton@redhat.com> 5.0.3-2Joe Orton <jorton@redhat.com> 5.0.3-1Joe Orton <jorton@redhat.com> 5.0.2-8Joe Orton <jorton@redhat.com> 5.0.2-7Joe Orton <jorton@redhat.com> 5.0.2-6Joe �x������������������X�gm���������������$|�����������������L
�?�
������	
�	N�
��
��
��
��
��	(gXpYx
���h�mQGiBErMciARBACTC8VC4hZ6IanmBjEMJWETD0u3z1VsaEcLkdwGXfj/wmh8ItPt
KJWQNGF6b/D479M3zVIPN0o8fpMel+w8WfUPRp0I1XeS0qz1L+0yyPa5xAXNlJpe
zSe4fHzuWcpCj865AMf4arChfnTpBW2m5mINW5PlplFojk37c4bmnlwfuwCgp0ZH
9eCnQJ5X406WeEe5cxKbZS0D/0VtidBC4zYrOkHQ4y9xX4TYNuDL8ns8FAquFSe2
HI0uMg/cocF3iDlvTNQ9JByh5I+Yyl7X9YJM5WMLBLxQjjDo1iqCuI49XIBNxF5c
T6cDi4rH83VxNjNNdnTd3U8I/44WkMNTcWcbz/qk3GWIH9G6f22UKA4mpxjNawec
f9cXA/4zyJGpgtUU2ttzpnvm/V2IuVnIP2zSrRfWF7FRn4WXAGzsWXabioF5hxxF
1GRG0L/GOW5z0ehfKw2r5X97C/5GQTn5TEQV6FGEHFzHXorG/deJ7bs8JVKH5Jar
AXxuubpoB0BCYGsJak3Q2SvBlwpIoeX52XMQJdNMSx/V8oVJyrQ+Q2xvdWRMaW51
eCBQYWNrYWdlciAoQ2xvdWRMaW51eCBLZXkpIDxwYWNrYWdlckBjbG91ZGxpbnV4
LmNvbT6IYAQTEQIAIAUCSsxyIAIbAwYLCQgHAwIEFQIIAwQWAgMBAh4BAheAAAoJ
EIxVpmKGCMtx3iQAn2OFKq64JgsXPEHQVvg/6teSBYF3AKCQD9j6IF4pxaSPUPbN
zA+nmGtQvLkBDQRKzHIhEAQAzkNuuIFf5JrlSCINjmN1unHK5TC9JRlGEAJg2y75
+zDqX0HF6mibu9bZUQBwxnOW98hFZ3iESqC709G/XbjU315Pqw5g+mvzgqelT/r6
T+3RmM90nhwLQ4OqOjBUwLhJE+XafFudshA+bm2StrVI9uLxjjleh7wKWNluiMQo
8EMAAwYEAILAQ3huwTnUpIp9xLOStrO+RQLWGvnzfJR75C96HJG9aj8bKbUcym2e
aKDIxUPxT5/ML2lSRlvsVIMV8/7NARc7qNri3DYWtrzv0q5mclp2+lyq1pkHwkD7
1JGv+p2zfG1rhJPrf1eYVfPeiweXl46YQ382QNL33vYga6/kp3jziEkEGBECAAkF
AkrMciECGwwACgkQjFWmYoYIy3GYiQCfZfnlCJhKbWqkqih6hu+db/pCSGcAn1Y7
RjXkR2ODIchbwoWVn0JvZnZz
gpg-pubkey8608cb714acc7220gpg(CloudLinux Packager (CloudLinux Key) <packager@cloudlinux.com>)-----BEGIN PGP PUBLIC KEY BLOCK-----
Version: rpm-4.14.3 (NSS-3)

mQGiBErMciARBACTC8VC4hZ6IanmBjEMJWETD0u3z1VsaEcLkdwGXfj/wmh8ItPt
KJWQNGF6b/D479M3zVIPN0o8fpMel+w8WfUPRp0I1XeS0qz1L+0yyPa5xAXNlJpe
zSe4fHzuWcpCj865AMf4arChfnTpBW2m5mINW5PlplFojk37c4bmnlwfuwCgp0ZH
9eCnQJ5X406WeEe5cxKbZS0D/0VtidBC4zYrOkHQ4y9xX4TYNuDL8ns8FAquFSe2
HI0uMg/cocF3iDlvTNQ9JByh5I+Yyl7X9YJM5WMLBLxQjjDo1iqCuI49XIBNxF5c
T6cDi4rH83VxNjNNdnTd3U8I/44WkMNTcWcbz/qk3GWIH9G6f22UKA4mpxjNawec
f9cXA/4zyJGpgtUU2ttzpnvm/V2IuVnIP2zSrRfWF7FRn4WXAGzsWXabioF5hxxF
1GRG0L/GOW5z0ehfKw2r5X97C/5GQTn5TEQV6FGEHFzHXorG/deJ7bs8JVKH5Jar
AXxuubpoB0BCYGsJak3Q2SvBlwpIoeX52XMQJdNMSx/V8oVJyrQ+Q2xvdWRMaW51
eCBQYWNrYWdlciAoQ2xvdWRMaW51eCBLZXkpIDxwYWNrYWdlckBjbG91ZGxpbnV4
LmNvbT6IYAQTEQIAIAUCSsxyIAIbAwYLCQgHAwIEFQIIAwQWAgMBAh4BAheAAAoJ
EIxVpmKGCMtx3iQAn2OFKq64JgsXPEHQVvg/6teSBYF3AKCQD9j6IF4pxaSPUPbN
zA+nmGtQvLkBDQRKzHIhEAQAzkNuuIFf5JrlSCINjmN1unHK5TC9JRlGEAJg2y75
+zDqX0HF6mibu9bZUQBwxnOW98hFZ3iESqC709G/XbjU315Pqw5g+mvzgqelT/r6
T+3RmM90nhwLQ4OqOjBUwLhJE+XafFudshA+bm2StrVI9uLxjjleh7wKWNluiMQo
8EMAAwYEAILAQ3huwTnUpIp9xLOStrO+RQLWGvnzfJR75C96HJG9aj8bKbUcym2e
aKDIxUPxT5/ML2lSRlvsVIMV8/7NARc7qNri3DYWtrzv0q5mclp2+lyq1pkHwkD7
1JGv+p2zfG1rhJPrf1eYVfPeiweXl46YQ382QNL33vYga6/kp3jziEkEGBECAAkF
AkrMciECGwwACgkQjFWmYoYIy3GYiQCfZfnlCJhKbWqkqih6hu+db/pCSGcAn1Y7
RjXkR2ODIchbwoWVn0JvZnZz
=EHVC
-----END PGP PUBLIC KEY BLOCK-----
J�r localhostpubkeyCloudLinux Packager (CloudLinux Key) <packager@cloudlinux.com>Public Keys(none)gpg(CloudLinux Packager (CloudLinux Key) <packager@cloudlinux.com>)gpg(8608cb71)4.14.34:8c55a6628608cb71-4acc72204:8c55a6628608cb71-4acc7220?����6c766dd39bbf7e2623c1070cf5a388cd741797f8i0=wi0=wlL.plR.plT.plU.plLbAI.plAL.plBA.plBB.plCJ.plCL.plCM.plEX.plGL.plID.plIN.plIS.plNS.plNU.plOP.plPO.plPR.plQU.plSA.plXX.plLowerY.plMathY.plNFCQCM.plY.plNFDQCN.plY.plNFKCQCN.plY.plNFKDQCN.plY.plNtDi.plNone.plNu.plNv0.pl1.pl10.pl100.pl1000.pl10000.pl100000.pl11.pl12.pl13.pl14.pl15.pl16.pl17.pl18.pl19.pl1_16.pl1_2.pl1_3.pl1_4.pl1_6.pl1_8.pl2.pl20.pl200.pl2000.pl20000.pl2_3.pl3.pl30.pl300.pl3000.pl30000.pl3_16.pl3_4.pl4.pl40.pl400.pl4000.pl40000.pl5.pl50.pl500.pl5000.pl50000.pl6.pl60.pl600.pl6000.pl60000.pl7.pl70.pl700.pl7000.pl70000.pl8.pl80.pl800.pl8000.pl800�x�������������x�����X�Om8������X@���������$�������������������(?
�
�*�5�>�	G�	t�
�
�
�
 �
'�	
O
[
b(
�X
�Y
�

�� h$mQINBGUlFG8BEADc0kEC57b722MbPVkI8aoYFAEWM+lj084H26msZpAYVfW7fCi5
S7g3n6htVdvvnB6MrJANitZgQhMyC7tchNQz5sjrFffasNkOoI5Q27PSrG676ILP
diowPWfJkwrN0f0UcJsV3w5KBedvUXJnoa64lP/oBFkbz3SvUTqZFkSBzOfCTdXW
bvpZonghgm/AEU8wqsdOitXU23Xn4fsPB7aULgR31jz3irnaUDFXUnNqoiQpU6JB
P6WiFqN/IZMH95HW1WlMBGSOalSbQUlNEND3J0lxK2a33UBmTdR3aLyS+o9P8+7b
Cdzbkrs1fXXVxxvlaQdSWBSjVULUZjKIZ+HtqhIaTiBELa7JHBEBbEZgNHpymmc8
hIF6fdTbzbbYx9MbNmpzCcr+SKHubCdvZyX2FsWK1CHvYx6iPc9wcu4x9yh8MIfp
KpLSJG1SaSCHbUdatpsOSQK2pbIN3THsvFrKPVssLrMgVjwp22Q3vMFL+ldq0vZ5
6uIIiNRKrX2CKKrUy1kF7FjDNMx4riaCQHs5vp7qOttxv0E/X4Z9B4QZdC02H2Mq
Ea5LoDxONutv+JMzWFyxIEQvbnfdDSu4QUDkn3H1WkBNmqTUwny5DSxZNjGB8a6P
ISaIE+kN2pp5v9eB8Q4+4BxbU2G2/Jy/V6bFC8eLL+PIKodPKbpCqoPyGwARAQAB
tCdBbG1hTGludXggT1MgOCA8cGFja2FnZXJAYWxtYWxpbnV4Lm9yZz6JAk8EEwEI
ADkWIQS8Xt3K31AsB38Vgogq6B6KztcliwUCZSUUbwIbAwQLCQgHAyICAQQVCgkI
BBYCAwECHgcCF4AACgkQKugeis7XJYvOeA/9E/hJwfd7UPtvsv+y7Wiei1NCt+OJ
AzJQPjEzHJNmLAD157AHtpA2yZpB9GlRQkjRu40fn0It20mwjnl0j5oHF9HnQ+/H
Qtiw9pwgNpZJaTe5YnzETbGqrrOVgWihkJyJhn42vtuirNu7pKJvWilRvz1a81JK
i/okezXp1KBrgrxR/bG26c8k61AK6n/ExI1MoHZhyaAAebFqG8vTiWTuC2a4t7SD
pxbzsn5CMuXqVY1gxIdiUGzgrXfSm5WgpSYEG01VN+VF885caPvtMHoLBy/pLGN3
5TKp4pKiA9JGQxtlZLdO666UbpgbjoxFYxNZEwY3Tdx37zbsP4pHcaN8fOGbk5mG
h8LwkjppPZzoXONyBfUJ+uHBEzRJEw4KtVRgaZZfCcojRvmyJB4TAM1SYkikaw8F
0gi3OPRWtVdEogxP0XD/tTrPSKo7pTDEk17HIyKCU0KxF4ZSbxXFMeH5OZUQAQM4
l7ECGNg3bVhXC66AHE72mz/PN39M2Z0Sww7GWYCf6IDhhkeTxYx+I7VW1Uo9ht5L
i3ZRMbX/h6NBYTUaPJEx3fwixNv2+RtE3m4JIxg76xBOYGLyIRlaImWNGKTnGz5m
IBRP5Vm7nRdFOOFhNz+iDIyq0LEyhGU7xCriFaL+ozXLiIzycidgTTZW3WfkHxlr
ZEzov/wIBeoaIp8=
gpg-pubkeyced7258b6525146fgpg(AlmaLinux OS 8 <packager@almalinux.org>)-----BEGIN PGP PUBLIC KEY BLOCK-----
Version: rpm-4.14.3 (NSS-3)

mQINBGUlFG8BEADc0kEC57b722MbPVkI8aoYFAEWM+lj084H26msZpAYVfW7fCi5
S7g3n6htVdvvnB6MrJANitZgQhMyC7tchNQz5sjrFffasNkOoI5Q27PSrG676ILP
diowPWfJkwrN0f0UcJsV3w5KBedvUXJnoa64lP/oBFkbz3SvUTqZFkSBzOfCTdXW
bvpZonghgm/AEU8wqsdOitXU23Xn4fsPB7aULgR31jz3irnaUDFXUnNqoiQpU6JB
P6WiFqN/IZMH95HW1WlMBGSOalSbQUlNEND3J0lxK2a33UBmTdR3aLyS+o9P8+7b
Cdzbkrs1fXXVxxvlaQdSWBSjVULUZjKIZ+HtqhIaTiBELa7JHBEBbEZgNHpymmc8
hIF6fdTbzbbYx9MbNmpzCcr+SKHubCdvZyX2FsWK1CHvYx6iPc9wcu4x9yh8MIfp
KpLSJG1SaSCHbUdatpsOSQK2pbIN3THsvFrKPVssLrMgVjwp22Q3vMFL+ldq0vZ5
6uIIiNRKrX2CKKrUy1kF7FjDNMx4riaCQHs5vp7qOttxv0E/X4Z9B4QZdC02H2Mq
Ea5LoDxONutv+JMzWFyxIEQvbnfdDSu4QUDkn3H1WkBNmqTUwny5DSxZNjGB8a6P
ISaIE+kN2pp5v9eB8Q4+4BxbU2G2/Jy/V6bFC8eLL+PIKodPKbpCqoPyGwARAQAB
tCdBbG1hTGludXggT1MgOCA8cGFja2FnZXJAYWxtYWxpbnV4Lm9yZz6JAk8EEwEI
ADkWIQS8Xt3K31AsB38Vgogq6B6KztcliwUCZSUUbwIbAwQLCQgHAyICAQQVCgkI
BBYCAwECHgcCF4AACgkQKugeis7XJYvOeA/9E/hJwfd7UPtvsv+y7Wiei1NCt+OJ
AzJQPjEzHJNmLAD157AHtpA2yZpB9GlRQkjRu40fn0It20mwjnl0j5oHF9HnQ+/H
Qtiw9pwgNpZJaTe5YnzETbGqrrOVgWihkJyJhn42vtuirNu7pKJvWilRvz1a81JK
i/okezXp1KBrgrxR/bG26c8k61AK6n/ExI1MoHZhyaAAebFqG8vTiWTuC2a4t7SD
pxbzsn5CMuXqVY1gxIdiUGzgrXfSm5WgpSYEG01VN+VF885caPvtMHoLBy/pLGN3
5TKp4pKiA9JGQxtlZLdO666UbpgbjoxFYxNZEwY3Tdx37zbsP4pHcaN8fOGbk5mG
h8LwkjppPZzoXONyBfUJ+uHBEzRJEw4KtVRgaZZfCcojRvmyJB4TAM1SYkikaw8F
0gi3OPRWtVdEogxP0XD/tTrPSKo7pTDEk17HIyKCU0KxF4ZSbxXFMeH5OZUQAQM4
l7ECGNg3bVhXC66AHE72mz/PN39M2Z0Sww7GWYCf6IDhhkeTxYx+I7VW1Uo9ht5L
i3ZRMbX/h6NBYTUaPJEx3fwixNv2+RtE3m4JIxg76xBOYGLyIRlaImWNGKTnGz5m
IBRP5Vm7nRdFOOFhNz+iDIyq0LEyhGU7xCriFaL+ozXLiIzycidgTTZW3WfkHxlr
ZEzov/wIBeoaIp8=
=mC/C
-----END PGP PUBLIC KEY BLOCK-----
e%olocalhostpubkeyAlmaLinux OS 8 <packager@almalinux.org>Public Keys(none)gpg(AlmaLinux OS 8 <packager@almalinux.org>)gpg(ced7258b)4.14.34:2ae81e8aced7258b-6525146f4:2ae81e8aced7258b-6525146f?����bcd4ef9989fdadbd39a3a1915afba8b208a7d7b7i0\i0\ a regular expression with a POSIX class
  (RT#128313)- Remove reflexive dependencies
- Use pregenera�x���������������XH]l���������$�������������������� kvm-job-Use-AIO_WAIT_WHILE-in-job_finish_sync.patch [bz#1637976]
- kvm-test-bdrv-drain-Test-AIO_WAIT_WHILE-in-completion-ca.patch [bz#1637976]
- kvm-block-Add-missing-locking-in-bdrv_co_drain_bh_cb.patch [bz#1637976]
- kvm-block-backend-Add-.drained_poll-callback.patch [bz#1637976]
- kvm-block-backend-Fix-potential-double-blk_delete.patch [bz#1637976]
- kvm-block-backend-Decrease-in_flight-only-after-callback.patch [bz#1637976]
- kvm-blockjob-Lie-better-in-child_job_drained_poll.patch [bz#1637976]
- kvm-block-Remove-aio_poll-in-bdrv_drain_poll-variants.patch [bz#1637976]
- kvm-test-bdrv-drain-Test-nested-poll-in-bdrv_drain_poll_.patch [bz#1637976]
- kvm-job-Avoid-deadlocks-in-job_completed_txn_abort.patch [bz#1637976]
- kvm-test-bdrv-drain-AIO_WAIT_WHILE-in-job-.commit-.abort.patch [bz#1637976]
- kvm-test-bdrv-drain-Fix-outdated-comments.patch [bz#1637976]
- kvm-block-Use-a-single-global-AioWait.patch [bz#1637976]
- kvm-test-bdrv-drain-Test-draining-job-source-child-and-p.patch [bz#1637976]
- kvm-qemu-img-Fix-assert-when-mapping-unaligned-raw-file.patch [bz#1639374]
- kvm-iotests-Add-test-221-to-catch-qemu-img-map-regressio.patch [bz#1639374]
- Resolves: bz#1609327
  (qemu-kvm[37046]: Could not find keytab file: /etc/qemu/krb5.tab: Unknown error 49408)
- Resolves: bz#1636142
  (qemu NBD_CMD_CACHE flaws impacting non-qemu NBD clients)
- Resolves: bz#1637976
  (Crashes and hangs with iothreads vs. block jobs)
- Resolves: bz#1639374
  (qemu-img map 'Aborted (core dumped)' when specifying a plain file)- kvm-linux-headers-update.patch [bz#1508142]
- kvm-s390x-cpumodel-Set-up-CPU-model-for-AP-device-suppor.patch [bz#1508142]
- kvm-s390x-kvm-enable-AP-instruction-interpretation-for-g.patch [bz#1508142]
- kvm-s390x-ap-base-Adjunct-Processor-AP-object-model.patch [bz#1508142]
- kvm-s390x-vfio-ap-Introduce-VFIO-AP-device.patch [bz#1508142]
- kvm-s390-doc-detailed-specifications-for-AP-virtualizati.patch [bz#1508142]
- Resolves: bz#1508142
  ([IBM 8.0 FEAT] KVM: Guest-dedicated Crypto Adapters - qemu part)- kvm-Revert-hw-acpi-build-build-SRAT-memory-affinity-stru.patch [bz#1609235]
- kvm-add-udev-kvm-check.patch [bz#1552663]
- kvm-aio-posix-Don-t-count-ctx-notifier-as-progress-when-.patch [bz#1623085]
- kvm-aio-Do-aio_notify_accept-only-during-blocking-aio_po.patch [bz#1623085]
- kvm-aio-posix-fix-concurrent-access-to-poll_disable_cnt.patch [bz#1632622]
- kvm-aio-posix-compute-timeout-before-polling.patch [bz#1632622]
- kvm-aio-posix-do-skip-system-call-if-ctx-notifier-pollin.patch [bz#1632622]
- kvm-intel-iommu-send-PSI-always-even-if-across-PDEs.patch [bz#1450712]
- kvm-intel-iommu-remove-IntelIOMMUNotifierNode.patch [bz#1450712]
- kvm-intel-iommu-add-iommu-lock.patch [bz#1450712]
- kvm-intel-iommu-only-do-page-walk-for-MAP-notifiers.patch [bz#1450712]
- kvm-intel-iommu-introduce-vtd_page_walk_info.patch [bz#1450712]
- kvm-intel-iommu-pass-in-address-space-when-page-walk.patch [bz#1450712]
- kvm-intel-iommu-trace-domain-id-during-page-walk.patch [bz#1450712]
- kvm-util-implement-simple-iova-tree.patch [bz#1450712]
- kvm-intel-iommu-rework-the-page-walk-logic.patch [bz#1450712]
- kvm-i386-define-the-ssbd-CPUID-feature-bit-CVE-2018-3639.patch [bz#1633928]
- Resolves: bz#1450712
  (Booting nested guest with vIOMMU, the assigned network devices can not receive packets (qemu))
- Resolves: bz#1552663
  (81-kvm-rhel.rules is no longer part of initscripts)
- Resolves: bz#1609235
  (Win2016 guest can't recognize pc-dimm hotplugged to node 0)
- Resolves: bz#1623085
  (VM doesn't boot from HD)
- Resolves: bz#1632622
  (~40% virtio_blk disk performance drop for win2012r2 guest when comparing qemu-kvm-rhev-2.12.0-9 with qemu-kvm-rhev-2.12.0-12)
- Resolves: bz#1633928
  (CVE-2018-3639 qemu-kvm: hw: cpu: speculative store bypass [rhel-8.0])- kvm-block-for-jobs-do-not-clear-user_paused-until-after-.patch [bz#1635583]
- kvm-iotests-Add-failure-matching-to-common.qemu.patch [bz#1635583]
- kvm-block-iotest-to-catch-abort-on-forced-blockjob-cance.patch [bz#1635583]
- Resolves: bz#1635583
  (Quitting VM causes qemu core �x�������������w����X>0m�!����#��$3����������������#�"�$��ey <darren@cpanel.net> 5.6.6-5Darren Mobley <darren@cpanel.net> 5.6.6-4S. Kurt Newman <kurt.newman@cpanel.net> 5.6.6-3Dan Muey <dan@cpanel.net> 5.6.6-2S. Kurt Newman <kurt.newman@cpanel.net> - 5.6.6-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.6.6-0Trinity Quirk <trinity.quirk@cpanel.net> - 5.5.6-14Jan Kaluza <jkaluza@redhat.com> - 5.5.6-13Remi Collet <rcollet@redhat.com> - 5.5.6-12Remi Collet <rcollet@redhat.com> - 5.5.6-11Remi Collet <rcollet@redhat.com> - 5.5.6-10Remi Collet <rcollet@redhat.com> - 5.5.6-9Remi Collet <rcollet@redhat.com> - 5.5.6-8Remi Collet <rcollet@redhat.com> - 5.5.6-7Remi Collet <rcollet@redhat.com> - 5.5.6-6Remi Collet <rcollet@redhat.com> - 5.5.6-5Remi Collet <rcollet@redhat.com> - 5.5.6-4Remi Collet <rcollet@redhat.com> 5.5.6-3Remi Collet <rcollet@redhat.com> 5.5.6-2Remi Collet <rcollet@redhat.com> 5.5.6-0Remi Collet <rcollet@redhat.com> 5.5.5-1Remi Collet <rcollet@redhat.com> 5.5.4-1Remi Collet <rcollet@redhat.com> 5.5.3-1Remi Collet <rcollet@redhat.com> 5.5.1-1Remi Collet <rcollet@redhat.com> 5.4.16-6Remi Collet <rcollet@redhat.com> 5.4.16-5Remi Collet <rcollet@redhat.com> 5.4.16-4Remi Collet <rcollet@redhat.com> - 5.4.16-3Remi Collet <rcollet@redhat.com> 5.4.16-2Remi Collet <rcollet@redhat.com> 5.4.16-1Remi Collet <rcollet@redhat.com> 5.4.14-3Remi Collet <rcollet@redhat.com> 5.4.14-2Remi Collet <rcollet@redhat.com> 5.4.14-1Remi Collet <rcollet@redhat.com> 5.4.13-1Remi Collet <rcollet@redhat.com> 5.4.11-1Remi Collet <rcollet@redhat.com> 5.4.10-1Remi Collet <rcollet@redhat.com> 5.4.9-1Remi Collet <rcollet@redhat.com> 5.4.8-7Remi Collet <rcollet@redhat.com> 5.4.8-6Remi Collet <rcollet@redhat.com> 5.4.8-5Remi Collet <rcollet@redhat.com> 5.4.8-6Remi Collet <rcollet@redhat.com> 5.4.8-4Remi Collet <rcollet@redhat.com> 5.4.8-4Remi Collet <rcollet@redhat.com> 5.4.8-3Joe Orton <jorton@redhat.com> - 5.4.8-2Remi Collet <rcollet@redhat.com> 5.4.8-3Remi Collet <rcollet@redhat.com> 5.4.8-2.1Remi Collet <rcollet@redhat.com> 5.4.8-2Remi Collet <rcollet@redhat.com> 5.4.8-1.2Remi Collet <rcollet@redhat.com> 5.4.8-1Remi Collet <rcollet@redhat.com> 5.4.7-4Remi Collet <rcollet@redhat.com> 5.4.7-3Remi Collet <rcollet@redhat.com> 5.4.7-2Remi Collet <rcollet@redhat.com> 5.4.7-1Remi Collet <remi@fedoraproject.org> 5.4.7-10Remi Collet <remi@fedoraproject.org> 5.4.7-9Remi Collet <rcollet@redhat.com> 5.4.7-8Remi Collet <rcollet@redhat.com> 5.4.7-7Remi Collet <rcollet@redhat.com> 5.4.7-6Remi Collet <rcollet@redhat.com> 5.4.7-5Remi Collet <rcollet@redhat.com> 5.4.7-4Remi Collet <rcollet@redhat.com> 5.4.7-3Remi Collet <remi@fedoraproject.org> 5.4.7-2Remi Collet <remi@fedoraproject.org> 5.4.7-1Remi Collet <remi@fedoraproject.org> 5.4.6-2Remi Collet <remi@fedoraproject.org> 5.4.6-1Remi Collet <remi@fedoraproject.org> 5.4.5-1Remi Collet <remi@fedoraproject.org> 5.4.4-4Remi Collet <remi@fedoraproject.org> 5.4.4-3Remi Collet <remi@fedoraproject.org> 5.4.4-2Remi Collet <remi@fedoraproject.org> 5.4.4-1Remi Collet <remi@fedoraproject.org> 5.4.3-1Remi Collet <remi@fedoraproject.org> 5.4.2-1Remi Collet <remi@fedoraproject.org> 5.4.1-1Joe Orton <jorton@redhat.com> - 5.4.0-6Remi Collet <remi@fedoraproject.org> 5.4.0-5Joe Orton <jorton@redhat.com> - 5.4.0-4Joe Orton <jorton@redhat.com> - 5.4.0-3Joe Orton <jorton@redhat.com> - 5.4.0-2Remi Collet <remi@fedoraproject.org> 5.4.0-1Remi Collet <remi@fedoraproject.org> 5.4.0-0.4.RC8Remi Collet <remi@fedoraproject.org> 5.4.0-0.3.RC7Remi Collet <remi@fedoraproject.org> 5.4.0-0.2.RC6Remi Collet <remi@fedoraproject.org> 5.4.0-0.1.RC6Remi Collet <remi@fedoraproject.org> 5.3.8-4.4Remi Collet <remi@fedoraproject.org> 5.3.8-4.3Adam Jackson <ajax@redhat.com> - 5.3.8-4.2Marcela Mašláňová <mmaslano@redhat.com> - 5.3.8-3.2Peter Schiffer <pschiffe@redhat.com> - 5.3.8-3.1Remi Collet <remi@fedoraproject.org> 5.3.8-3Remi Collet <remi@fedoraproject.org> 5.3.8-2Remi Collet <remi@fedoraproject.org> 5.3.8-1Remi Collet <remi@fedoraproject.org> 5.3.7-1Joe Orton <jorton@redhat.com> - 5.3.6-4Rem�x��������������f����X�m���w����-�$/�����������������-'n�'�db5043482bf46412656a9a1ec316504126054ca2e4b976a94ce57c1f30e548855b91bb9e878473b73afe5ff34b93886eee72e712b9a42665788ac84d778ce21b2c261202ad922bdfafb9f337d648623c30442badfeaa365a6b4f820e73b91f2ea6c40fb93d1bad1560e176896ec5fc72cf5a64b6a9c71800871017e9ea7909d97e65658a3ba66a5a27eec4c6954dfc35b81b9e83c92d682c6228fa224c8d2e060d78fe75616f563587b69dbe08e3e8d31496dfc5c276a6ec77d968578e3b7d5082b2f6d636e9a33fec0b9bad8701d1b232a7694941d66bd9cca24702ba5c7e7ca5b19f6c80966be9cc305c2ebd444b74abf33312a2449993cb86376f2fbfc79a8ab2cde991e2c13927478458acfbd10c1cbfb1dbdefad1049f96c5c5cd80e9975d51b716d0e7748217b04a1049a66631943be5863f9921345ae21cb227cc059bcdb9a06910e7b77277cb34d4d201de20e34d298931c245922bde43d3489cb12e6a019ac83d093f043e9069b647e66ab9f982fb6faa2ffe9b168b9ae89b5afa3efb24df67fb8f9a25e75b98054a1ff3bea3a75f309aeb22916e622b9e767d2411c81aadfd941ed39a27e54f4673820acac441a0697fc5378a5e109e07cb4af8cd686936eda364313f28139bcdb2fc0c762756fcafa3c0fe7bda6c246f0267b303e455afb7c6636861efe1489c93809516bf04134c97cd45cd275f7d49ef454027959b44d07cd61575e92edad45daf800244e4406ed9ba11df2816f5fe93b6367b91e0fa192712ab6063aa765aa161e5db3018d86db470515163c02c891e6df1b1ea8334405b97af53db2f93a727a9b65e2d94da1a3f171aaa8deee5e99c4ed796c4f252f9bff8674f60b78ff54377c24362465f5930e66bf60ab7c9a9193b3e662cbee30ff4436815111affb006ed038f4d76c8523f7d699a536068e8891175232a5903978b157e07421044d58cfb6eac0de92067bf2ec4e7cb74e8e1ea1ba3b28d67fa8859dca0da9423fbb5354e9ff7a42bdb3bf777feaee7c439a83eb11f31985d7b9cf6564b3d2bf236deb718bc0d6ca20f107fa1d16bbc8e49f20ddfc8e7068eb2782d9b4d4f80d494f282dc48c1aabea2200704f9a502c0aaf5238e125defd2ee991ea27971ccb37e81b58fe1e8e8a94c47f51ef30260a7ce530d429691851d021ac0a6962eae2ae234fcc24ec0c211f076832f1cd99580b1cd90a7ddf069dd9bd04bd4c72e7c01d9c081056e8a18fa5c1beadd1f7398b6d00c9cc085434af84f8fdcf5e63fae58bae1938427229736638be8b04770513d08d72ed720b3726eef473a1383cfce1402fd8797495772887537f0937823ebcb86991d123be9021814a2a14ffcd5bc1490aa08c127d3f1ac4fe4db1df3633065b889a15171d9e58602b2f05d6480247b98f01bb16958e96bc127a6741a28cd5ad3c35719bfe68d8714dc86456b4d8d3c9caf546a5667939b281504fa3e5f9adec0da48fe6611a4feb6b6e9890f1ecb2e9cf24a215a6d5ad2d635b8c940a1675545492fbb87f369193a738b2d1af3509f2cce6825fb23900c473e18de1f070f846d9264ef04d21e9452260175b150ca0254ff9da960330eab4a1afe970aabc4316e0bbaec73526bbd635f839333cceaafed2ca6f181a069cabb3937cd0765d0964db136464a8359309cddb4ebce86a7f22356512eb95d2394817aad7c2d209063ed007e07c0bdabaf357050ad2b70f4c4a01f12d237bae0a78d349fe88ac96adec88c01c98ce3c15afa1cc3ae440d771bc8a5d4e2f3253d5edd3b1c6fc7cae9d1951dca4674619e09a46beb56d45ea37ec6b088db3c17d9d43468b9b4aa8df7a2ca485de4c289f02017be1d20e5c497288a135cd0cffff4db651514e4e1d38d82409ff8f43b3acd532043588b14ad72b54181c17e36ec152eeafb90f9b5b0235c4a7ebfc0d3f0313b2200d19c0a300f03a17bb71bb3007bf162d6691e2ff758b4ee75579715572e2ed5f04eb6864f391b985a8391800783f127e4d2882d8e51399cccc5b69689135a511287287016c80e827fb0d20f44c9c6cb3f4a6e0d19a630a00bbee49d8c508b68b8288ff292ae1d8c4f5e81651fe99de825ca5b44efd2fcd24787981a4fcf32cf16c65ffb17a2174c1d39777ddc599cc940a35450250813e4e033031f74bcd07a6a6e63c69c961afb92c7e45dda4466f9c06291cbf564b0a1b82f7d7669471d54f4757606b7768f3dee6ac05df7d40db8bbd07c191dfd27c454098263ab21a7a3d4ab1b4e813dee8450a8ea33e5c8093e3201289bdab35005decab76d72296d0005ddf2c6c0fb0d6e6db390b4a5e9b4dd162ca32af2de3382ae3d1845cb8fa4feb123391f70c9307113fe731a111cc501c0a286a20bb757d9a9e3319c967f98de38b3a15afa341d25113d1225614aef0be55893ef38498e474731c590f3695eb34d51ff4934547f4adf385ee62b60503221a5636f46e44830e44bf4af5c6a99879c2479264d676843f20ab721eefc03c64f45da90d7e45ad966dcdee35f20a911ad1e2b305e55056f792b296c90f5a897f0283855bfa774fa536c2514c399be7a780cd96ca9c516a42d9923b107b3c9bdaa141a28624a97b5de91824000cef72061f539e8b745ef0074c23fc7e8c789feb5572180a94acb56cf8975ba678010ce965c57bd00764bc492a0d01ea2a7d7440a09641dbecc9820bea8433256188eb4eb024b14ec5c0e2c45d9b9d1845da79abfdd7a8a447e2eaaa41f720ca06bef775c0f0d447a34963733be0a7d80e93411836ef43f865a050cd9d33dfe24513f80706ce49148ec4661a6bb993545df855d9�x�������������XV����X�Km��������(u�����$o��������������������|?8
�
F�
Q�
Z�	
c�	
��<�@�L�P�W�	z��(�X�Y�
H�thxmQINBF/9iQ4BEADguRE+cjShp7JujKkiVH3+ZYYD5ncX7IMh7Ig0DbDC8ldtm84k
4vi8266IIBLM3eRgkF9sgHciRikTPow50R+Ww7jJzehV9vjTkRzWr8ikog6X3ZPw
rh9QAqOdTOIn4bBSS6j5+xdxYKG7yEWXjADbkFVSiLvejp3FrLZGlNFdPCkGKFhC
vTCgbEKtAkXHx/jFDJCYbnJkzrecCSd+a3yQ4Ehp6TCxnywXdseX4WGyNT3E6Ppu
JRIXLKrVwP/5pZxqgBS9EDsQpaqxmkS8iJe9j8Bkzm4mL0K4Y8B5vApIyxRO0i0C
8Eb8UgLSoOwWsZjWpDcYtLgCTNT1CCaOe5lG6qy3HD6Y7LiXinnMgq5uXbfTEKxZ
rUyQ9Jepxe5hk5GJ1mTbQ6vEj0oYOWYWCwLZKOHucRh8BmvYEbhMBGsgBGcMruql
Na+gw1eVIMTknGCdGGwceb3DLNHXGolU3GDTKd8d6lEaXkFx9zXWBicOIDyG72tU
vZMj2RVzmgEhxcw1vKxoJIUOegjpdqBqTJRnM/tnimm4eE65hHhuqRYIngwHWqL0
K+Daxt+J+4l5Xo56AEYc+2i8JA1nGT/nw13KE/7S79wRVaJPzDccI7/mefDKcF3R
EGWG7f9jWqoCB+wvXD+0FpHDcp0TPgDcWTObUs3yBoySbgj8IXL3z2R64wARAQAB
tCJBbG1hTGludXggPHBhY2thZ2VyQGFsbWFsaW51eC5vcmc+iQI+BBMBAgAoBQJf
/YkOAhsBBQkFo5qABgsJCAcDAgYVCAIJCgsEFgIDAQIeAQIXgAAKCRBIj898Ors0
+IsjD/9/F/PIu7kSn4P8Ud9j/iyoO8hH53qXKMimarg920ugt2uUyl6SzaJqV0dK
ACrczvC0VmxrNaJ1jB31TGPpdJZpey5AJbefofu/RgAlxHN6o3QX0Br4bEHahF20
21q2eIjoMrq8eiz8X5D2wfx6CyOA6RZY96MVQ2whXjQHV+hwo65xyMUyjTuFx5Pb
nl7gdYr9EkH3EafdNrpuVurp+Zrgur+973nUrzKq8c2rlDiEQz/ZG+bgasTDYkcz
q6NUPP5OQ5BVpFCkuE9YuziZD+37hxN07P2gyz9NRrfAOZqBXj8er4vqNhpR/lLA
h5QF1erb0mjcMFEhkV8ETN0ceJzL/t829BlQ7MB7LdQ5v9kc5p5cwcsBly54ouI0
l9LjSN95Al0VPoWE8zgjnytecu2UN5+0k12bfcj0zjKdAxEVD3y9Id1MJIze7/PA
6v3LOk+SSs8M0ASmZEnDBTCbDRpXlDDUKEEmMIBRdvpTxjiUnwD2tHwhXR8m6vw6
749i+mdc8fgljTey8sJLKxTabbYNgTHLi9lCMdmPlKU2QJYsIwIBpqF2/eenNyZT
LvlW/aBUU7Li3etUnJeP9ig+V2LuDhyT6TlVPsFKCCruoy7faSjW2/2wlVcasGQp
YqqqqtQJyVDRud6ig7oH3EWSvUySEmywjBp5zfwrMw3jeWkwHbkBjQRf/YnGAQwA
tk5NBR7SCwYwEsmPDUX/SJ98eGHb1nux/cRaX+K2KgX7Yi3hhlFs/InkiiNKs+Au
0N5ZBIXltypguo5jE3MwXQxLr2MfJ74bdDXR7z3BmBB92BMaS+tHNJWroYnqiSQ7
2PXfWRF9PtlChF12NyK6SVrQg58IqJjf5MQ8hodgIk0t21qCvxe/IotktjKHy2Vn
gvKPjtT05qXpAK0CP8N5wtOc4WnFCxvNTI7e1KkYS4dvXHL6V+WvqL3saGIXY5Iy
0jYZW5xMxh691C+HvHQ8/Lof3Enenz3hDJR0X9wvzusxBJWwg/vqRIR8+YYKSHj1
VEFycTabqGLlnPpYpFqDOdqS2gDtdrD6FEsrSpy9pBd98XAzjkn6BW4Rf0PTaJ/z
b3paHsqxEnWbamANs5GYs1Y/1rEIl66jOhZB9Sua22/wfGd3PvfM6nxi825l4coO
bbivRY6U4/WtxQUcK8zdoF97zUlvbNNN0LsluZ0tBF44o5vt7f4aCGXZ8XMVIef1
ABEBAAGJA8QEGAECAA8FAl/9icYCGwIFCQWjmoABqQkQSI/PfDq7NPjA3SAEGQEC
AAYFAl/9icYACgkQUdZkfsIa1upqtQv/R9oLsG3g4Rg2MKDrXYSa94n1CBY5ESDL
1N0mZTWQ5nVdfIWWifnpe72VDBR3Y+r5ootnCHq09DbK+K3q82q2UmGEq968mR96
LKGjWuTS1rY/MCbQbW+jcrnju0T3bCcImggMJoYCzuUnBfIkexObwi/YidqgL92+
nw3NzqeWnq+gu/1Q2ngzhN8Ft4mwOcFr9H0px0476LLvR+7lrSu2HqGeHk+fUA4c
ZNwvsgGYgCAJhz8fPwKCoLrxsE82bkZ86JgUJEcMu0ki4UFo3rg6NmkDwnrYO61l
MOrBCxt/lPJz7d8L9oCLu9pJSBsKH9RNqO10NAoEMppKwnQSz6RQFRJj7WNW+OEs
mjZt7sNrTr0Y+udx58Sqd0C5k7lGUtYWKKGpLfdz0RLnBTTFmjnB3Y2uyOJFc4FS
g251yjk9ds1AFjdRThQ2kFpZzQAo5ei6zMBaZATg0E2uk4HAfpQ58CPGj4f1k3py
1N2hYUA+qksZIVxjFfwYr5LCv4tMZumZl6UP/je7EHh5IGkB1+Bpeyj3dudZblvM
lE6kdGridxInbiJvgqBSdprIksR8wm1Vy/Z1/lHEM6QnUODGyRAbjQHL3kPKloPj
lKr8TNAELbmVTZjBRJowsGw27rhYAaji/qEet/0ALfu2l3QuOQ38dyuPpxlDSTLY
WnajVIgvSJUU3Yl38Lp3UTuHdtdiNWgyHkLOA/11GK14RSWYsjZAamstlSpl24Op
yKLN5z+q4tNAs+tfQrWNRi3SMG7UDroxztJVkHGvuJ2DT/Q6tANigPzipLzSgOIO
8Wa2aQmqtQ4V0eB2S4DxcMckHti3+4fbrzBzeN/PFaIVLwUtdsUdBs+TtSZFdN9e
i0oLUChIYKDvVBGqgmIor6YgenNSSZni3rj+RRA3gQom7jyVrQPgUv7lsv/MLCmg
Ogpibxs3+SDbbZ6tP0D8uxdRnB4NVeENewlqw/ImacgjLtjBHaq+BebjWErIAkdX
VnjWoLdZoV3B4ComKsjFNf7sfbzV/T2Xpg/r/u1WkiSjvD0mkSZ+3seDjd6oL20s
p7jGLnSGZqGsUksJym0tWRvuyspgTELZlcjuMfHKuKmYudYFi+Y48+YsdJ7UetNT
kAIBinjtZwEEAP4GumNNy7f4l4tt1CBy1EgoYtYCcJC5SGyhWMee3L3hLhHe7Iwd
72EHtteVBoVn0eg6
gpg-pubkey3abb34f85ffd890egpg(AlmaLinux <packager@almalinux.org>)-----BEGIN PGP PUBLIC KEY BLOCK-----
Version: rpm-4.14.3 (NSS-3)

mQINBF/9iQ4BEADguRE+cjShp7JujKkiVH3+ZYYD5ncX7IMh7Ig0DbDC8ldtm84k
4vi8266IIBLM3eRgkF9sgHciRikTPow50R+Ww7jJzehV9vjTkRzWr8ikog6X3ZPw
rh9QAqOdTOIn4bBSS6j5+xdxYKG7yEWXjADbkFVSiLvejp3FrLZGlNFdPCkGKFh�x�������������pE����X��l���������z������i������$y����������������i�h�j��repos by priority and cost (Michael Mraka)
- spec: follow new packaging guidelines & make compatible with el7 (Igor
  Gnatenko)
- bash-completion: first try to set fallback to BASH_COMPLETION_COMPATDIR (Igor
  Gnatenko)
- updated copyrights for files changed this year (Michael Mraka)
- cli: fix warning from re.split() about non-empty pattern (RhBug:1286556)
  (Igor Gnatenko)
- update authors file (Michal Luscon)
- Define __hash__ method for YumHistoryPackage (RhBug:1245121) (Max Prokhorov)- refactor: repo: add md_expired property (Michal Domonkos)
- test: fix cachedir usage in LocalRepoTest (Michal Domonkos)
- clean: operate on all cached repos (RhBug:1278225) (Michal Domonkos)
- refactor: repo: globally define valid repoid chars (Michal Domonkos)
- RepoPersistor: only write to disk when requested (Michal Domonkos)
- clean: remove dead subcommands (Michal Domonkos)
- doc: --best in case of problem (RhBug:1309408) (Jan Silhan)
- Added fix for correct error message for group info (RhBug:1209649) (Abhijeet
  Kasurde)
- repo: don't get current timeout for librepo (RhBug:1272977) (Igor Gnatenko)
- doc: fix default timeout value (Michal Luscon)
- cli: inform only about nonzero md cache check interval (Michal Luscon)
- base: report errors in batch at the end of md downloading (Michal Luscon)
- repo: produce more sane error if md download fails (Michal Luscon)
- zanata update (RhBug:1322226) (Jan Silhan)
- doc: Fixed syntax of `assumeyes` and `defaultyes` ref lables in
  `conf_ref.rst` (Matt Sturgeon)
- Fix output headers for dnf history command (Michael Dunphy)
- doc: change example of 'dnf-command(repoquery)' (Jaroslav Mracek)
- makacache.service: shorten journal logs (RhBug:1315349) (Michal Luscon)
- config: improve UX of error msg (Michal Luscon)
- Added user friendly message for out of range value (RhBug:1214562) (Abhijeet
  Kasurde)
- doc: prefer repoquery to list (Jan Silhan)
- history: fix empty history cmd (RhBug:1313215) (Michal Luscon)
- Very minor tweak to the docs for `--assumeyes` and `--assumeno` (Matt
  Sturgeon)- Add `/etc/distro.repos.d` as a path owned by the dnf package (Neal Gompa
  (ニール・ゴンパ))
- Change order of search and add new default repodirs (RhBug:1286477) (Neal
  Gompa (ニール・ゴンパ))
- group: don't mark available packages as installed (RhBug:1305356) (Jan
  Silhan)
- history: adjust demands for particular subcommands (RhBug:1258503) (Michal
  Luscon)
- Added extension command for group list (RhBug:1283432) (Abhijeet Kasurde)
- perf: dnf repository-packages <repo> upgrade (RhBug:1306304) (Jan Silhan)
- sack: Pass base.conf.substitutions["arch"] to sack in build_sack() function.
  (Daniel Mach)
- build: make python2/3 binaries at build time (Michal Domonkos)
- fix dnf history traceback (RhBug:1303149) (Jan Silhan)
- cli: truncate expiration msg (RhBug:1302217) (Michal Luscon)- history: don't fail if there is no history (RhBug:1291895) (Michal Luscon)
- Allow dnf to use a socks5 proxy, since curl support it (RhBug:1256587)
  (Michael Scherer)
- output: do not log rpm info twice (RhBug:1287221) (Michal Luscon)
- dnf owns /var/lib/dnf dir (RhBug:1294241) (Jan Silhan)
- Fix handling of repo that never expire (RhBug:1289166) (Jaroslav Mracek)
- Filter out .src packages when multilib_proto=all (Jeff Smith)
- Enable string for translation (RhBug:1294355) (Parag Nemade)
- Let logging format messages on demand (Ville Skyttä)
- clean: include metadata of local repos (RhBug:1226322) (Michal Domonkos)
- completion: Install to where bash-completion.pc says (Ville Skyttä)
- spec: bash completion is not a %config file (Ville Skyttä)
- Change assertion handling for rpmsack.py (RhBug:1275878) (Jaroslav Mracek)
- cli: fix storing arguments in history (RhBug:1239274) (Ting-Wei Lan)- base: save group persistor only after successful transaction (RhBug:1229046)
  (Michal Luscon)
- base: do not clean tempfiles after remove transaction (RhBug:1282250) (Michal
  Luscon)
- base: clean packages that do not belong to any trans (Michal Luscon)
- upgrade: allow gro�x�������������H5����X�Ulp��B�����$��������������������writing-zero-buffers-to-empty-COW-.patch [bz#1772473]
- kvm-coroutine-Add-qemu_co_mutex_assert_locked.patch [bz#1772473]
- kvm-qcow2-Fix-corruption-bug-in-qcow2_detect_metadata_pr.patch [bz#1772473]
- Resolves: bz#1706759
  (qemu core dump when unplug a 16T GPT type disk from win2019 guest)
- Resolves: bz#1772473
  (Import fixes from 8.1.0 into 8.1.1 branch)- kvm-Revert-qcow2-skip-writing-zero-buffers-to-empty-COW-.patch [bz#1751934]
- kvm-coroutine-Add-qemu_co_mutex_assert_locked.patch [bz#1764721]
- kvm-qcow2-Fix-corruption-bug-in-qcow2_detect_metadata_pr.patch [bz#1764721]
- Resolves: bz#1751934
  (Fail to install guest when xfs is the host filesystem)
- Resolves: bz#1764721
  (qcow2 image corruption due to incorrect locking in preallocation detection)- kvm-nbd-server-attach-client-channel-to-the-export-s-Aio.patch [bz#1748253]
- kvm-virtio-blk-schedule-virtio_notify_config-to-run-on-m.patch [bz#1744955]
- Resolves: bz#1744955
  (Qemu hang when block resize a qcow2 image)
- Resolves: bz#1748253
  (QEMU crashes (core dump) when using the integrated NDB server with data-plane)- kvm-block-Use-QEMU_IS_ALIGNED.patch [bz#1745922]
- kvm-block-qcow2-Fix-corruption-introduced-by-commit-8ac0.patch [bz#1745922]
- kvm-block-qcow2-refactor-encryption-code.patch [bz#1745922]
- kvm-qemu-iotests-Add-test-for-bz-1745922.patch [bz#1745922]
- Resolves: bz#1745922
  (Luks-inside-qcow2 snapshot cannot boot after 'qemu-img rebase')- kvm-blockjob-update-nodes-head-while-removing-all-bdrv.patch [bz#1746631]
- kvm-hostmem-file-fix-pmem-file-size-check.patch [bz#1724008 bz#1736788]
- kvm-memory-fetch-pmem-size-in-get_file_size.patch [bz#1724008 bz#1736788]
- kvm-pr-manager-Fix-invalid-g_free-crash-bug.patch [bz#1753992]
- Resolves: bz#1724008
  (QEMU core dumped "memory_region_get_ram_ptr: Assertion `mr->ram_block' failed")
- Resolves: bz#1736788
  (QEMU core dumped if boot guest with nvdimm backed by /dev/dax0.0 and option pmem=off)
- Resolves: bz#1746631
  (Qemu core dump when do block commit under stress)
- Resolves: bz#1753992
  (core dump when testing persistent reservation in guest)- kvm-spapr-xive-Mask-the-EAS-when-allocating-an-IRQ.patch [bz#1748725]
- kvm-block-create-Do-not-abort-if-a-block-driver-is-not-a.patch [bz#1746267]
- kvm-virtio-blk-Cancel-the-pending-BH-when-the-dataplane-.patch [bz#1717321]
- kvm-Using-ip_deq-after-m_free-might-read-pointers-from-a.patch [bz#1749737]
- Resolves: bz#1717321
  (qemu-kvm core dumped when repeat "system_reset" multiple times during guest boot)
- Resolves: bz#1746267
  (qemu coredump: qemu-kvm: block/create.c:68: qmp_blockdev_create: Assertion `drv' failed)
- Resolves: bz#1748725
  ([ppc][migration][v6.3-rc1-p1ce8930]basic migration failed with "qemu-kvm: KVM_SET_DEVICE_ATTR failed: Group 3 attr 0x0000000000001309: Device or resource busy")
- Resolves: bz#1749737
  (CVE-2019-15890 qemu-kvm: QEMU: Slirp: use-after-free during packet reassembly [rhel-av-8])- kvm-migration-always-initialise-ram_counters-for-a-new-m.patch [bz#1734316]
- kvm-migration-add-qemu_file_update_transfer-interface.patch [bz#1734316]
- kvm-migration-add-speed-limit-for-multifd-migration.patch [bz#1734316]
- kvm-migration-update-ram_counters-for-multifd-sync-packe.patch [bz#1734316]
- kvm-spapr-pci-Consolidate-de-allocation-of-MSIs.patch [bz#1750200]
- kvm-spapr-pci-Free-MSIs-during-reset.patch [bz#1750200]
- Resolves: bz#1734316
  (multifd migration does not honour speed limits, consumes entire bandwidth of NIC)
- Resolves: bz#1750200
  ([RHEL8.1][QEMU4.1]boot up guest with vf device,then system_reset guest,error prompt(qemu-kvm: Can't allocate MSIs for device 2800: IRQ 4904 is not free))- kvm-migration-Do-not-re-read-the-clock-on-pre_save-in-ca.patch [bz#1747836]
- kvm-ehci-fix-queue-dev-null-ptr-dereference.patch [bz#1746790]
- kvm-spapr-Use-SHUTDOWN_CAUSE_SUBSYSTEM_RESET-for-CAS-reb.patch [bz#1743477]
- kvm-file-posix-Handle-undetectable-alignment.patch [bz#1749134]
- kvm-block-posix-Always-allocate-the-first-block.patch [bz#1749134]
- kvm-iotests-Test-allocate_first_block-with-O_DIRECT.p�x�������������`$����XN\l�2�0�����$�����������������	���#1518989]
- kvm-dirty-bitmaps-clean-up-bitmaps-loading-and-migration.patch [bz#1518989]
- kvm-iotests-improve-169.patch [bz#1518989]
- kvm-iotests-169-add-cases-for-source-vm-resuming.patch [bz#1518989]
- kvm-pc-dimm-turn-alignment-assert-into-check.patch [bz#1630116]
- Resolves: bz#1518989
  (RFE: QEMU Incremental live backup)
- Resolves: bz#1625173
  ([NVMe Device Assignment] Guest could not boot up with q35+iommu)
- Resolves: bz#1629616
  (boot guest with q35+vIOMMU+ device assignment, qemu terminal shows "qemu-kvm: VFIO_UNMAP_DMA: -22" when return assigned network devices from vfio driver to ixgbe in guest)
- Resolves: bz#1630116
  (pc_dimm_get_free_addr: assertion failed: (QEMU_ALIGN_UP(address_space_start, align) == address_space_start))
- Resolves: bz#1636185
  ([RFE] Report disk device name and serial number (qemu-guest-agent on Linux))- kvm-luks-Allow-share-rw-on.patch [bz#1629701]
- kvm-redhat-reenable-gluster-support.patch [bz#1599340]
- kvm-redhat-bump-libusb-requirement.patch [bz#1627970]
- Resolves: bz#1599340
  (Reenable glusterfs in qemu-kvm once BZ#1567292 gets fixed)
- Resolves: bz#1627970
  (symbol lookup error: /usr/libexec/qemu-kvm: undefined symbol: libusb_set_option)
- Resolves: bz#1629701
  ("share-rw=on" does not work for luks format image - Fast Train)- kvm-block-rbd-pull-out-qemu_rbd_convert_options.patch [bz#1635585]
- kvm-block-rbd-Attempt-to-parse-legacy-filenames.patch [bz#1635585]
- kvm-block-rbd-add-deprecation-documentation-for-filename.patch [bz#1635585]
- kvm-block-rbd-add-iotest-for-rbd-legacy-keyvalue-filenam.patch [bz#1635585]
- Resolves: bz#1635585
  (rbd json format of 7.6 is incompatible with 7.5)- kvm-vnc-call-sasl_server_init-only-when-required.patch [bz#1609327]
- kvm-nbd-server-fix-NBD_CMD_CACHE.patch [bz#1636142]
- kvm-nbd-fix-NBD_FLAG_SEND_CACHE-value.patch [bz#1636142]
- kvm-test-bdrv-drain-bdrv_drain-works-with-cross-AioConte.patch [bz#1637976]
- kvm-block-Use-bdrv_do_drain_begin-end-in-bdrv_drain_all.patch [bz#1637976]
- kvm-block-Remove-recursive-parameter-from-bdrv_drain_inv.patch [bz#1637976]
- kvm-block-Don-t-manually-poll-in-bdrv_drain_all.patch [bz#1637976]
- kvm-tests-test-bdrv-drain-bdrv_drain_all-works-in-corout.patch [bz#1637976]
- kvm-block-Avoid-unnecessary-aio_poll-in-AIO_WAIT_WHILE.patch [bz#1637976]
- kvm-block-Really-pause-block-jobs-on-drain.patch [bz#1637976]
- kvm-block-Remove-bdrv_drain_recurse.patch [bz#1637976]
- kvm-test-bdrv-drain-Add-test-for-node-deletion.patch [bz#1637976]
- kvm-block-Drain-recursively-with-a-single-BDRV_POLL_WHIL.patch [bz#1637976]
- kvm-test-bdrv-drain-Test-node-deletion-in-subtree-recurs.patch [bz#1637976]
- kvm-block-Don-t-poll-in-parent-drain-callbacks.patch [bz#1637976]
- kvm-test-bdrv-drain-Graph-change-through-parent-callback.patch [bz#1637976]
- kvm-block-Defer-.bdrv_drain_begin-callback-to-polling-ph.patch [bz#1637976]
- kvm-test-bdrv-drain-Test-that-bdrv_drain_invoke-doesn-t-.patch [bz#1637976]
- kvm-block-Allow-AIO_WAIT_WHILE-with-NULL-ctx.patch [bz#1637976]
- kvm-block-Move-bdrv_drain_all_begin-out-of-coroutine-con.patch [bz#1637976]
- kvm-block-ignore_bds_parents-parameter-for-drain-functio.patch [bz#1637976]
- kvm-block-Allow-graph-changes-in-bdrv_drain_all_begin-en.patch [bz#1637976]
- kvm-test-bdrv-drain-Test-graph-changes-in-drain_all-sect.patch [bz#1637976]
- kvm-block-Poll-after-drain-on-attaching-a-node.patch [bz#1637976]
- kvm-test-bdrv-drain-Test-bdrv_append-to-drained-node.patch [bz#1637976]
- kvm-block-linux-aio-acquire-AioContext-before-qemu_laio_.patch [bz#1637976]
- kvm-util-async-use-qemu_aio_coroutine_enter-in-co_schedu.patch [bz#1637976]
- kvm-job-Fix-nested-aio_poll-hanging-in-job_txn_apply.patch [bz#1637976]
- kvm-job-Fix-missing-locking-due-to-mismerge.patch [bz#1637976]
- kvm-blockjob-Wake-up-BDS-when-job-becomes-idle.patch [bz#1637976]
- kvm-aio-wait-Increase-num_waiters-even-in-home-thread.patch [bz#1637976]
- kvm-test-bdrv-drain-Drain-with-block-jobs-in-an-I-O-thre.patch [bz#1637976]
- kvm-test-blockjob-Acquire-AioContext-around-job_cancel_s.patch [bz#1637976]
-�x�������������8����X�9m�h�������'���,��$<����������������,�+�-��4 (CVE-2012-2143, CVE-2012-2386)
- use /usr/lib/tmpfiles.d instead of /etc/tmpfiles.d
- use /run/php-fpm instead of /var/run/php-fpm- update to 5.4.3 (CVE-2012-2311, CVE-2012-2329)- update to 5.4.2 (CVE-2012-1823)- update to 5.4.1- rebuild for new icu
- switch (conditionally) to libdb-devel- fix Loadmodule with MPM event (use ZTS if not MPM worker)
- split conf.d/php.conf + conf.modules.d/10-php.conf with httpd 2.4- rebuild for missing automatic provides (#807889)- really use _httpd_mmn- rebuild against httpd 2.4
- use _httpd_mmn, _httpd_apxs macros- update to PHP 5.4.0 finale- update to PHP 5.4.0RC8- update to PHP 5.4.0RC7
- provides env file for php-fpm (#784770)
- add patch to use system libzip (thanks to spot)
- don't provide INSTALL file- all binaries in /usr/bin with zts prefix- update to PHP 5.4.0RC6
  https://fedoraproject.org/wiki/Features/Php54- fix systemd unit- switch to systemd- Rebuild for new libpng- rebuild with new gmp without compat lib- rebuild with new gmp- revert is_a() to php <= 5.3.6 behavior (from upstream)
  with new option (allow_string) for new behavior- add mysqlnd sub-package
- drop patch4, use --libdir to use /usr/lib*/php/build
- add patch to redirect mysql.sock (in mysqlnd)- update to 5.3.8
  http://www.php.net/ChangeLog-5.php#5.3.8- update to 5.3.7
  http://www.php.net/ChangeLog-5.php#5.3.7
- merge php-zts into php (#698084)- rebuild for net-snmp SONAME bump- enable mhash extension (emulated by hash extension)- rebuild for new MySQL client library- update to 5.3.6
  http://www.php.net/ChangeLog-5.php#5.3.6
- fix php-pdo arch specific requires- disable zip extension per "No Bundled Libraries" policy (#551513)- rebuild for icu 4.6- fix systemd-units requires- add tmpfiles.d configuration for php-fpm
- add Arch specific requires/provides- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- update to 5.3.5
  http://www.php.net/ChangeLog-5.php#5.3.5
- clean duplicate configure options- rebuild against MySQL 5.5.8
- remove all RPM_SOURCE_DIR- security patch from upstream for #660517- update to 5.3.4
  http://www.php.net/ChangeLog-5.php#5.3.4
- move phpize to php-cli (see #657812)- ghost /var/run/php-fpm (see #656660)
- add filter_setup to not provides extensions as .so- use mysql_config in libdir directly to avoid biarch build failures- rebuild for new net-snmp- add php-fpm sub-package- PHP 5.3.3 released- garbage collector upstream  patches (#580236)- rebuild for icu 4.4- PHP 5.3.2 Released!
- remove mime_magic option (now provided by fileinfo, by emu)
- add patch for http://bugs.php.net/50578
- remove patch for libedit (upstream)
- add runselftest option to allow build without test suite- update to v7 of systzdata patch- fix build with autoconf 2.6x- update to 5.3.1
- remove openssl patch (merged upstream)
- add provides for php-pecl-json
- add prod/devel php.ini in doc- use libedit instead of readline to resolve licensing issues- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- rediff systzdata patch- update to v6 of systzdata patch; various fixes- update to v5 of systzdata patch; parses zone.tab and extracts
  timezone->{country-code,long/lat,comment} mapping table- update to 5.3.0
- remove ncurses, dbase, mhash extensions
- add enchant, sqlite3, intl, phar, fileinfo extensions
- raise sqlite version to 3.6.0 (for sqlite3, build with --enable-load-extension)
- sync with upstream "production" php.ini- update to 5.2.10
- add interbase sub-package- update to 5.2.9- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add recode support, -recode subpackage (#106755)
- add -zts subpackage with ZTS-enabled build of httpd SAPI
- adjust php.conf to use -zts SAPI build for worker MPM- fix patch fuzz, renumber patches- drop obsolete configure args
- drop -odbc patch (#483690)- split out sysvshm, sysvsem, sysvmsg, posix into php-process- move wddx to php-xml, build curl shared in -common
- remove BR for expat-devel, bogus configure option- reb�x������������������X�Yl@���X@��������$������������������
��-blockdev: auto-read-only is ineffective for drivers on read-only whitelist)- kvm-fdc-Revert-downstream-disablement-of-device-floppy.patch [bz#1664997]
- kvm-fdc-Restrict-floppy-controllers-to-RHEL-7-machine-ty.patch [bz#1664997]
- Resolves: bz#1664997
  (Restrict floppy device to RHEL-7 machine types)- kvm-Add-raw-qcow2-nbd-and-luks-iotests-to-run-during-the.patch [bz#1664855]
- kvm-Introduce-the-qemu-kvm-tests-rpm.patch [bz#1669924]
- Resolves: bz#1664855
  (Run iotests in qemu-kvm build %check phase)
- Resolves: bz#1669924
  (qemu-kvm packaging: Package the avocado_qemu tests and qemu-iotests in a new rpm)- kvm-doc-fix-the-configuration-path.patch [bz#1644985]
- Resolves: bz#1644985
  (The "fsfreeze-hook" script path shown by command "qemu-ga --help" or "man qemu-ga" is wrong - Fast Train)- kvm-Acceptance-tests-add-Linux-initrd-checking-test.patch [bz#1669922]
- kvm-mmap-alloc-unfold-qemu_ram_mmap.patch [bz#1671519]
- kvm-mmap-alloc-fix-hugetlbfs-misaligned-length-in-ppc64.patch [bz#1671519]
- kvm-BZ1653590-Require-at-least-64kiB-pages-for-downstrea.patch [bz#1653590]
- kvm-block-Fix-invalidate_cache-error-path-for-parent-act.patch [bz#1673014]
- kvm-virtio-scsi-Move-BlockBackend-back-to-the-main-AioCo.patch [bz#1656276 bz#1662508]
- kvm-scsi-disk-Acquire-the-AioContext-in-scsi_-_realize.patch [bz#1656276 bz#1662508]
- kvm-virtio-scsi-Forbid-devices-with-different-iothreads-.patch [bz#1656276 bz#1662508]
- Resolves: bz#1653590
  ([Fast train]had better stop qemu immediately while guest was making use of an improper page size)
- Resolves: bz#1656276
  (qemu-kvm core dumped after hotplug the deleted disk with iothread parameter)
- Resolves: bz#1662508
  (Qemu core dump when start guest with two disks using same drive)
- Resolves: bz#1669922
  (Backport avocado-qemu tests for QEMU 3.1)
- Resolves: bz#1671519
  (RHEL8.0 Snapshot3 - qemu doesn't free up hugepage memory when hotplug/hotunplug using memory-backend-file (qemu-kvm))
- Resolves: bz#1673014
  (Local VM and migrated VM on the same host can run with same RAW file as visual disk source while without shareable configured or lock manager enabled)- kvm-io-ensure-UNIX-client-doesn-t-unlink-server-socket.patch [bz#1665896]
- kvm-scsi-disk-Don-t-use-empty-string-as-device-id.patch [bz#1668248]
- kvm-scsi-disk-Add-device_id-property.patch [bz#1668248]
- Resolves: bz#1665896
  (VNC unix listener socket is deleted after first client quits)
- Resolves: bz#1668248
  ("An unknown error has occurred" when using cdrom to install the system with two blockdev disks.(when choose installation destination))- kvm-Fix-fsfreeze-hook-path-in-the-man-page.patch [bz#1644985]
- kvm-json-Fix-handling-when-not-interpolating.patch [bz#1668244]
- Resolves: bz#1644985
  (The "fsfreeze-hook" script path shown by command "qemu-ga --help" or "man qemu-ga" is wrong - Fast Train)
- Resolves: bz#1668244
  (qemu-img: /var/tmp/v2vovl9951f8.qcow2: CURL: Error opening file: The requested URL returned error: 404 Not Found)- kvm-throttle-groups-fix-restart-coroutine-iothread-race.patch [bz#1655947]
- kvm-iotests-add-238-for-throttling-tgm-unregister-iothre.patch [bz#1655947]
- Resolves: bz#1655947
  (qemu-kvm core dumped after unplug the device which was set io throttling parameters)- kvm-migration-rdma-unregister-fd-handler.patch [bz#1666601]
- kvm-s390x-tod-Properly-stop-the-KVM-TOD-while-the-guest-.patch [bz#1659127]
- kvm-hw-s390x-Fix-bad-mask-in-time2tod.patch [bz#1659127]
- Resolves: bz#1659127
  (Stress guest and stop it, then do live migration, guest hit call trace on destination end)
- Resolves: bz#1666601
  ([q35] dst qemu core dumped when do rdma migration with Mellanox IB QDR card)- kvm-i386-kvm-expose-HV_CPUID_ENLIGHTMENT_INFO.EAX-and-HV.patch [bz#1653511]
- kvm-i386-kvm-add-a-comment-explaining-why-.feat_names-ar.patch [bz#1653511]
- Resolves: bz#1653511
  (qemu doesn't report all support cpu features which cause libvirt cannot get the support status of hv_tlbflush)- kvm-spapr-Fix-ibm-max-associativity-domains-property-num.patch [bz#1653114]
- kvm-cpus-ignor�x�������������(������X�}jXi����������$�������������������G�h?�Xd��
��	�	L��������������	2�D�c�ip|	�
��
,8GVt���M(�8�"9":8�"G�LH�XI�dX�hY�p\��]��^��b��d�=e�Bf�El�Gt�`u�lv�xw��x��y���������T�h�l6����6
�����T�X�\g�`h�dCfile-devel5.3327.el8_10Libraries and header files for file developmentThe file-devel package contains the header files and libmagic library
necessary for developing programs using libmagic.h䳚x64-builder01.almalinux.org$tAlmaLinuxAlmaLinuxBSDAlmaLinux Packaging Team <packager@almalinux.org>Applications/Filehttp://www.darwinsys.com/file/linuxx86_64��������h䳘h䳘h䳙7c6b7eec208da5a31fb70f18fada180a0bc7a3b9a0c59096a4c7fe942e59809baa814bd08897a5f178e91ad404e2c2017a59fcc07a7f7ce5a885db0c93d0875alibmagic.so.1.0.0rootrootrootrootrootrootfile-5.33-27.el8_10.src.rpm������������file-develfile-devel(x86-64)@



filefile-libs(x86-64)libmagic.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)5.33-27.el8_105.33-27.el8_103.0.4-14.6.0-14.0-15.2-14.14.3g��e'�dA)@c��c�T@c��b��@`�7@`v�@`	l�^�@^Ǿ�^�m@]҇�]���]���]�c@]��[�0�[M�@[!@[�@[@Z�@Z�3@ZԐ@Z���Zz�@Zu�@Y�@@Y�(@Y��Y���Y�a�Y���Y�Y}�@Yx�@Yw2�Y%u�X��@X��X��X��@X��@X���X�@XO�XI@W�Q�W�@Wq@Wm �V��V��V��VO@V;D�U���U���U���U�a@T�s@T��T�	�TH�T�T�S�0�S�G�S�#@S���S���S�~@S1o�S0@S0@S��S��SK@R�x@R-�@R�@R�@Q��Q��Q��@Q��@Q�x�Q��Qb�@QU�@QP<@QLG�Q=�@Q�@P��P��@P*=�P��P��O��OKp@O�@O(@O�O�@O�@O�@N��@N�]�N:��M�M@M�M�M�L@M�z@Ml�MS�@MQ0@M5��M*�L�@Lu�Ls�@Lc�@LF�@L>�@L5��L)�@L%@KŮ@K�s�K���K���K��@KqN@Ka|@K]��KTM@K4�@K��K�K�J�J@J�@J��J��J��@Jz�Ji�@JhP�Jf�@JW-@J7�@J7�@J�J@J*@I�A@I�c�I�o@I�y�I��@I���I�U@I��Im�Ik0�IFF�I7�@I7�@I1.�H�,�H�O@H�N@H�z@HI&�HF��HE2@HE2@G�t@G�	�G�	�G��@G�@G�}�GW�@F��F���F\�E�@E��Eّ@E���E���D�C@D�D��@D��@D�A@DtJ�DH�@D�@D^�C�@C�C�@Cǖ@C�q�C�B�Cp�@Cf@CT�CA@C.�@C.�@B���B���B�T�B��B�S�B�$�BZf�B,B@B(M�B�@A��@A�3�A��A�1�A���Ak�@A
@@��@�n�@`&�@Dw@@,�@@
u@?��?�}�?���?�M�>��@>�^�>��@>]��>R @>L�@>5@>.��>!X�>��>�@=���=@<��<�p@<{x�<B�@<�@<��;E�@;7'�;5�@: �@9��@9��@9�j@9y��9l]�9Gs�8�@8��@8���7�7�7��@7��6�0�6��@6�<@6^�@6H*�5�U�5Q�@5+f�3���3?�@3��Vincent Mihalkovic <vmihalko@redhat.com> - 5.33-27Vincent Mihalkovic <vmihalko@redhat.com> - 5.33-26Vincent Mihalkovic <vmihalko@redhat.com> - 5.33-25Vincent Mihalkovic <vmihalko@redhat.com> - 5.33-24Vincent Mihalkovic <vmihalko@redhat.com> - 5.33-23Vincent Mihalkovic <vmihalko@redhat.com> - 5.33-22Vincent Mihalkovic <vmihalko@redhat.com> - 5.33-21Vincent Mihalkovic <vmihalko@redhat.com> - 5.33-20Vincent Mihalkovic <vmihalko@redhat.com> - 5.33-18Vincent Mihalkovic <vmihalko@redhat.com> - 5.33-17Vincent Mihalkovic <vmihalko@redhat.com> - 5.33-16Kamil Dudka <kdudka@redhat.com> - 5.33-15Vincent Mihalkovič <vmihalko@redhat.com> - 5.33-14 Kamil Dudka <kdudka@redhat.com> - 5.33-13Kamil Dudka <kdudka@redhat.com> - 5.33-12Kamil Dudka <kdudka@redhat.com> - 5.33-11Kamil Dudka <kdudka@redhat.com> - 5.33-10Kamil Dudka <kdudka@redhat.com�x��������������������X��l�����h������e��$u����������������e�f�d��n <jbj@redhat.com>Prospector System <bugs@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Erik Troan <ewt@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Erik Troan <ewt@redhat.com>- nss.c: shadow_logfd to stderr. Resolves: RHEL-83432
- pwck/grpck: only force nscd/sssd caches flush if anything was changed
  Resolves: RHEL-123912- salt: remove rounds from salt string. Resolves: RHEL-16668- login.defs: include SHA_CRYPT_MAX_ROUNDS. Resolves: RHEL-15024- gpasswd: fix password leak. Resolves: #2215947- Update patch to close label to reset libselinux state. Resolves: #1984740
- useradd: check if subid range exists for user. Resolves: #2012929
- find_new_[gu]id: Skip over IDs that are reserved for legacy reasons. Resolves: #1994269- subordinateio: also compare the owner ID. Resolves: #2093311
- Fix release sources
- Add subid requirement for subid-devel- getsubids: provide system binary and man page. Resolves: #2013016
- groupdel: fix SIGSEGV when passwd does not exist. Resolves: #1986782- Creation of subid and subid-devel subpackages (#2013009)
- libsubid: creation and nsswitch support
- libsubid: don't print error messages on stderr by default
- libsubid: libsubid_init return false if out of memory
- libsubid: don't return owner in list_owner_ranges API call
- libsubid: libsubid_init don't print messages on error
- libsubid: fix newusers when nss provides subids
- libsubid: make shadow_logfd not extern
- useradd: fix SUB_UID_COUNT=0
- man: mention NSS in new[ug]idmap manpages
- man: clarify subid delegation- usermod: allow all group types with -G option (#1967641)- man: Remove references to LOGIN_STRING in login.defs (#1884702)- lib/sssd: redirect warning message to file (#1749001)
- useradd: clarify valid usernames/groupnames (#1869432)
- login.defs: link login specific information to its own package (#1804766)- change UMASK value and add HOME_MODE in login.defs (#1777718)- check only local groups when adding new supplementary groups to a user- do not mistake a regular user process for a namespaced one (#1788696)
- add HOME_MODE support in login.defs (#1777718)- properly audit group password change
- do not add uid of a new (not yet added) user to the audit message
- use lckpwdf() again to disable concurrent edits of databases by
  other applications
- clarify chage manual page in regards to shadow and passwd
  inconsistency
- fix minor issues in groupadd and login.defs manual pages
- Ignore LOGIN_PLAIN_PROMPT variable in login.defs
- force regeneration of getdate.c otherwise the date parsing fix
  is not applied- usermod: guard against unsafe change of ownership of
  special home directories- drop trailing space from login.defs ENCRYPT_METHOD setting- use cap_setxid file capabilities for newxidmap instead of making them setuid
- limit the SYS_U/GID_MIN value to 1 as the algorithm does not work with 0
  and the 0 is always used by root anyway
- manual page improvements
- flush sssd caches - patch by Jakub Hrozek- fix some issues from Coverity scan- use itstool instead of xml2po- Update to current upstream release 4.6
- Raise limit for passwd and shadow entry length but also prevent
  writing longer entries (#1422497)- Add patch to include crypt.h, if present
- Use %make_{build,install} macros
- Refresh other patches for proper alignment- Rebuilt for switch to libxcrypt- fix regression caused by the userdel-chroot patch (#1509978)- fix userdel in chroot (#1316168)
- add useful chage -E example to chage manpage- do not allow "." and ".." user names- allow switching to secondary group without checking the membership
  explicitly (patch from upstream)- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- update to current upstream release 4.5- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- fix regression in useradd - not�x�������������������X��l������������ L�$0���������������� LL!L�ys true
- Fix bug #75673: SplStack::unserialize() behavior
- Fix bug #79199: curl_copy_handle() memory leak
- Fix bug #79200: Some iconv functions cut Windows-1258
- Fix bug #79296: ZipArchive::open fails on empty file (libzip 1.6.0)
- Fix bug #79330: shell_exec() silently truncates after a null byte
- Fix bug #79364: When copy empty array, next key is unspecified
- Fix bug #79393: Null coalescing operator failing with SplFixedArray
- Fix bug #79396: setting Date/Time during a forward DST transition
- Fix bug #79410: system() swallows last chunk if it is exactly 4095 bytes without newline
- Fix bug #79424: php_zip_glob uses gl_pathc after call to globfree
- Fix bug #79465: OOB Read in urldecode() (CVE-2020-7067)
- Fix bug #79468: SIGSEGV when closing stream handle with a stream filter appended- EA-8928: Updated the required version for ea-libcurl- Fix bug #77569: Write Access Violation in DomImplementation
- Fix bug #79078: Hypothetical use-after-free in curl_multi_add_handle
- Fix bug #79282: Use-of-uninitialized-value in exif (CVE-2020-7064)
- Fix bug #79329: get_headers silently truncates after a null byte (CVE-2020-7066)- Fix bug #79099: OOB read in php_strip_tags_ex (CVE-2020-7059)
- Fix bug #79037: global buffer-overflow in `mbfl_filt_conv_big5_wchar` (CVE-2020-7060)
- Fix bug #79082: Files added to tar with Phar::buildFromIterator have all-access permissions (CVE-2020-7063)
- Fix bug #79221: Null Pointer Dereference in PHP Session Upload Progress (CVE-2020-7062)- ZC-6270: Fix circular deps like EA-8854- ZC-6247: Remove multiple conflicts between php-fpm and other rpms- MODLS-735: Delete criu images for host/user when lsapi_backend_pgrp_max_crashes triggered- Fixed bug #78793 (Use-after-free in exif parsing under memory sanitizer)
- Fixed bug #78878 (Buffer underflow in bc_shift_addsub). (CVE-2019-11046)
- Fixed bug #78910 (Heap-buffer-overflow READ in exif). (CVE-2019-11047)
- Fixed bug #78863 (DirectoryIterator class silently truncates after a nullbyte). (CVE-2019-11045)
- Fixed bug #78862 (link() silently truncates after a null byte on Windows). (CVE-2019-11044)
- Updated Litespeed SAPI to 7.6- ZC-4361: Update ea-openssl requirement to v1.1.1 (ZC-5583)- EA-8762: Update litespeed from upstream to 7.6- Fix #76342: file_get_contents waits twice specified timeout
- Fix #76859 stream_get_line skips data if used with data-generating filter
- Fix #78413: php-fpm request_terminate_timeout does not take effect after fastcgi_finish_request
- Fix #78535: auto_detect_line_endings value not parsed as bool
- Fix #78579: mb_decode_numericentity: args number inconsistency
- Fix bug #78599 (env_path_info underflow can lead to RCE) (CVE-2019-11043)
- Fixed bug #78612
- Fix #78620: Out of memory error
- Fix #78641: addGlob can modify given remove_path value- Fixed CVE-2019-13224- Apply allow_coredump patch for MODLS-694- EA-8549: Build php-fpm with pcntl- MODLS-689: Apply crash_limit patch- Fix #69100: Bus error from stream_copy_to_stream
- Fix #75457: heap-use-after-free
- Fix #77946: Bad cURL resources returned by curl_multi_info_read
- Fix #78282: atime and mtime mismatch
- Fix #78326: improper memory deallocation on stream_get_contents
- Fix #78333: Exif crash (bus error) due to wrong alignment and invalid cast
- Fix #78342: Bus error in configure test for iconv //IGNORE
- Fix #78379: (Cast to object confuses GC, causes crash)- Fix bug #77124
- Fix #77919: Potential UAF in Phar RSHUTDOWN
- Fix #78173: XML-RPC mutates immutable objects during encoding
- Fix bug #78192 PDO SQLite SegFault when reuse statement after schema has changed
- Fix #78202: Opcache stats for cache hits are capped at 32bit NUM
- Fix #78212: Segfault in built-in webserver
- Fix bug #78222 (heap-buffer-overflow on exif_scan_thumbnail)
- Fix #78241: touch() does not handle dates after 2038 in PHP 64-bit
- Fix bug #78256 (heap-buffer-overflow on exif_process_user_comment)
- Fixed bug #78279
- Fix bug #78291 Missing opcache directives
- Fixed bug #78297- EA-8576: Update litespeed from upstream to 7.5- EA-8558: Update �x������@������0������X�$m((�������������$��������������������panel.net> - 7.4.5-3Tim Mullin <tim@cpanel.net> - 7.4.5-2Cory McIntire <cory@cpanel.net> - 7.4.5-1Julian Brown <julian.brown@cpanel.net> - 7.4.2-3Daniel Muey <dan@cpanel.net> - 7.4.2-2Daniel Muey <dan@cpanel.net> - 7.4.2-1Dan Muey <dan@cpanel.net> - 7.4.1-1- EA4D-797: revert to use system libxml2 lib for all platforms
- EA4D-808: fix Provides field in debian/control to use exact versions
- EA4D-811: remove libphp7.so from _root_httpd_moddir to fix file conflicts- Update php-fpm patch to v4 for per-domain resource isolation support- EA4D-793: Update php-fpm LVE patch- EA4D-789: Security fixes
- CVE-2025-14178: fix integer overflow in array_merge (ext/standard/array.c)
- CVE-2025-1736: fix for PHP SOAP extension- remove ea-mod_php provide and require- EA4D-773: Rebuild ea-php74 on rhel>=9 with system libxml2 as cPanel- Synchronize with cpanel but leave using ea-libxml2 on all OS- EA4D-746: Update php-fpm lve patch to extract doc_root from php_admin_values
  for CageFS per-domain isolation- EA4-136: Fix libxml2 v2.15.0 compatibility- EA4D-789: Security fixes
- CVE-2025-1220: fix null byte termination in hostnames
- CVE-2025-6491: fix NULL pointer dereference in PHP SOAP extension via large
  XML namespace prefix- EA4D-677: rebuild with new libtidy 5.8.0- EA4D-789: Security fixes
- CVE-2024-11235: use-after-free for ??= due to incorrect live-range calculation- EA4D-789: Security fixes
- CVE-2025-1219: fix wrong `content-type` on redirect in libxml streams
- CVE-2025-1217: http stream wrapper: fix handling folded headers
- CVE-2025-1734: http stream wrapper: fix handling headers with invalid name and no colon
- CVE-2025-1861: fix http redirect location truncation- EA4D-636: rebuild with ea-libicu 77- ZC-12614: Rolling “ea-php74” back to “2ae8a0c01d69dbc710734ff516c17a19a479fa13”: was not meant to be merged- ZC-12614: Build on Alma 9- EA4D-789: Security fixes
- CVE-2024-8929: fix various heap buffer over-reads for mysqlnd- EA4D-789: Security fixes
- CVE-2024-11234: fix HTTP fulluri CRLF injection
- CVE-2024-11233: fix single byte overread with convert.quoted-printable-decode
  filter
- CVE-2024-11236: prevent integer overflow in quoters causing OOB writes- ZC-12495: Do gcc like newer PHPs so that the libicu update won’t break the build- EA4D-789: Security fixes
- CVE-2024-8925: Fix data integrity violation while parsing multipart/form-data
  boundaries larger than the read buffer
- CVE-2024-9026: Fix possible altering of children logs
- CVE-2024-8927: Fix bypass of cgi.force_redirect configuration- ZC-12246: Correct conffiles for Ubuntu- ALTPHP-1839: Change lsapi naming- ZC-12153: make opcache INI a configfile for debs- ZC-12114: Apply fix for libxml2- Fix for hardened PHP
- CVE-2024-5458: Fix early-out for ipv6 hostname validation, ensure full check
  is performed- remove libbrolti requires for rhel<=7- Fix for hardened PHP
- CVE-2024-2756: fix __Host-/__Secure-cookie bypass due to partial
  CVE-2022-31629 fix
- CVE-2024-3096: Disallow null character in bcrypt password to fix bug causing
  password_verify to erroneously return true- EA-10753: Have snmp module require 'snmp-mibs-downloader' for deb- CVE-2022-4900: Prevent potential buffer overflow for php_cli_server_workers_max
- EA4D-470: build intl with system icu for RHEL >= 9- EA-11821: Patch to build with the latest ea-libxml2- ZC-11419: work around `%doc` and `PHP` behavior changes from C7 to c9- CVE-2023-3247: Fix missing randomness check for SOAP HTTP Digest- Fix for hardened PHP
- CVE-2023-3823: Fix external entity loading in XML without enabling by
  sanitizing libxml2 globals before parsing
- CVE-2023-3824: Fix buffer mismanagement in phar_dir_read()- EA-11447: Increase default php memory_limit for new installs from 32M to 128M- ZC-10931: Link with libc-client statically- ZC-10873: Do not build on Ubuntu 22- Fix for hardened PHP
- CVE-2023-0567: Fix validation of malformed BCrypt hashes
- CVE-2023-0568: Fix array overrun when appending slash to paths
- CVE-2023-0662: Fix DOS vulnerabality�x��������������������X��k��������0)��������$������������������F01.1121.1121.1121.1121.1121.1121.1121.1121.112-1.cp130~el81.1121.1121.1121.1121.1121.1121.1121.1121.1121.1121.1121.1121.1121.1121.112Dependency.pmItem.pmOrdered.pmSource.pmFile.pmHoA.pmInvert.pmWeight.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Algorithm//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Algorithm/Dependency//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Algorithm/Dependency/Source/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-87a13349920db85bdbeef3cda5f14387214c49fdfa7d61bcddbf3ec9e4bbd5b9d?����CtIt+=W�qVv�B���f83ff8220329cd4308a1b9a7a7a72914cd621f4b37e8e314583caa5f324f2536dafbfeab9ca4cecd1d62f1d27ab7bccba19131e7i?�y�<i?�son't place kexec images on IORESOURCE_MEM_DRIVER_MANAGED (Nico Pache) [2028988]
- mm/memory_hotplug: handle memblock_add_node() failures in add_memory_resource() (Nico Pache) [2028988]
- mm/memory_hotplug: introduce add_memory_driver_managed() (Nico Pache) [2028988]
- mm/memory_hotplug: handle memblocks only with CONFIG_ARCH_KEEP_MEMBLOCK (Nico Pache) [2028988]
- mm/memory_hotplug: set node_start_pfn of hotadded pgdat to 0 (Nico Pache) [2028988]
- mm/hotplug: reorder memblock_[free|remove]() calls in try_remove_memory() (Nico Pache) [2028988]
- mm: memblock: make keeping memblock memory opt-in rather than opt-out (Nico Pache) [2028988]
- [s390] s390/cpumf: add new extended counter set for IBM z16 (Mete Durlu) [2047728]- [s390] s390/qdio: clarify logical vs absolute in QIB's kerneldoc (Mete Durlu) [2043836]
- [s390] s390/qdio: remove unneeded sanity check in qdio_do_sqbs() (Mete Durlu) [2043836]
- [s390] s390/qdio: split do_QDIO() (Mete Durlu) [2043836]
- [s390] s390/qdio: split qdio_inspect_queue() (Mete Durlu) [2043836]
- [s390] s390/qdio: clarify handler logic for qdio_handle_activate_check() (Mete Durlu) [2043836]
- [s390] s390/qdio: clean up access to queue in qdio_handle_activate_check() (Mete Durlu) [2043836]
- [s390] s390/qdio: avoid allocating the qdio_irq with GFP_DMA (Mete Durlu) [2043836]
- [s390] s390/qdio: improve handling of CIWs (Mete Durlu) [2043836]
- [s390] s390/qdio: remove QDIO_SBAL_SIZE macro (Mete Durlu) [2043836]
- [s390] scsi: zfcp: fix kernel doc comments (Mete Durlu) [2043836]
- [s390] s390/qdio: remove unused support for SLIB parameters (Mete Durlu) [2043836]
- [s390] s390/qdio: consolidate QIB code (Mete Durlu) [2043836]
- [s390] s390/qdio: use dev_info() in qdio_print_subchannel_info() (Mete Durlu) [2043836]
- [s390] s390/qdio: fine-tune the queue sync (Mete Durlu) [2043836]
- [s390] s390/qdio: clean up SIGA capability tracking (Mete Durlu) [2043836]
- [s390] s390/qdio: remove unused sync-after-IRQ infrastructure (Mete Durlu) [2043836]
- [s390] s390/qdio: use absolute data address in ESTABLISH ccw (Mete Durlu) [2043836]
- [s390] s390/qdio: remove unused macros (Mete Durlu) [2043836]
- [s390] s390/qdio: clarify reporting of errors to the drivers (Mete Durlu) [2043836]
- [s390] s390/qdio: remove unneeded siga-sync for Output Queue (Mete Durlu) [2043836]
- [s390] s390/qdio: remove remaining tasklet & timer code (Mete Durlu) [2043836]
- ice: clear stale Tx queue settings before configuring (Petr Oros) [2079926]
- ice: fix crash when writing timestamp on RX rings (Petr Oros) [2079926]
- ice: Fix race during aux device (un)plugging (Petr Oros) [2079926]
- ice: fix PTP stale Tx timestamps cleanup (Petr Oros) [2079926]
- ice: ice_sched: fix an incorr�x�������������p������X��l���������L���L�$����������������LL L�r of parsed
  multipart body parts and printing upload limit exceed error message only once- Fix for Harden PHP
- CVE-2022-31631: Fix integer overflow that could cause PDO::quote() to return an improperly quoted string- Fix for harden PHP
- CVE-2022-31628: Fix potential infinite recursion in phar wrapper when using quine gzip file
- CVE-2022-31629: Add cookie integrity validation- Fix for Harden PHP
- CVE-2021-21705: add user name and password validation in filters module- ELS-189: Fix for Harden PHP
- CVE-2022-31625: Fix freeing of uninitialized memory leading to RCE
- CVE-2022-31626: Fix buffer overflow in mysqlnd driver leading to RCE- EA-10532: Update litespeed to 8.0.1- ZC-9589: Update DISABLE_BUILD to match OBS- CVE-2021-21703: fix error in php fpm shared memory organization leading to privilage escalation
- CVE-2021-21707: fix handling of paths with percent encoded NULL byte- ALTPHP-1190: Update hardened php- ALTPHP-1164: Update hardened php
- EA4D-293: Added unixIDBC requires- EA-9013: Disable %check section- ALTPHP-1132: Update hardened php- EA4D-266: Update hph-fpm lve patch 
- ALTPHP-1102: Update Litespeed patches for litespeed-7.9- EA-9625: Update litespeed to 7.9- ALTPHP-1053: Update move_override_ini patch
- ALTPHP-1038: Update litespeed log patch- Fix Bug #73809: Phar Zip parse crash - mmap fail
- Fix Bug #77322: PharData::addEmptyDir('/') Possible integer overflow
- Fix Bug #77961: Slow reqursive functions with MySQL
- Fix Bug #80366: Potential issue in ext/standard/iptc.c: Return Value Not Checked
- Fix Bug #80411: References to null-serialized object break serialize()- AAP-178: Added disable killing of PHP-FPM parent process in LVE when not enough of memory- Update to the latest version- ALTPHP-1017: revert #79825- ALTPHP-997: Fix Local-Master values after updating LiteSpeed- ZC-7893: Update DSO config to factor in PHP 8- EA-9390: Fix build with latest ea-brotli (v1.0.9)- Fix for build for CentOS 8- Fix bug #79699: PHP parses encoded cookie names so malicious `__Host-` cookies can be sent (CVE-2020-7070)
- Fix bug #79825: opcache.file_cache causes SIGSEGV when custom opcode handlers changed
- Fix bug #79986: str_ireplace bug with diacritics characters
- Fix bug #80007: Potential type confusion in unixtojd() parameter parsing
- Fix bug #80049: Memleak when coercing integers to string via variadic argument- MODLS-815: override_ini processing patch added
- MODLS-818: Litespeed SAPI updated to 7.8- EA-9281: Update litespeed from upstream to 7.8- Fix bug #62890: default_socket_timeout=-1 causes connection to timeout
- Fix bug #70362: Can't copy() large 'data://' with open_basedir
- Fix bug #73527: Invalid memory access in php_filter_strip
- Fix bug #74267: segfault with streams and invalid data
- Fix bug #79783: Segfault in php_str_replace_common
- Fix bug #79787: mb_strimwidth does not trim string
- Fix bug #79797: Use of freed hash key in the phar_parse_zipfile function (CVE-2020-7068)
- Fix bug #79877: getimagesize function silently truncates after a null byte- MODLS-741: Make LSCRIU log messages with timestamps
- MODLS-804: Improve mod_lsapi & lsphp error reporting in case of php memory limit reached- EA-9189: Update litespeed from upstream to 7.7- EA4D-197: Fix ea-php specs for using our litespeed patches- Fix bug #78221: DOMNode::normalize() doesn't remove empty text nodes
- Fix bug #78875: Long variables cause OOM and temp files are not cleaned (CVE-2019-11048)
- Fix bug #78876: Long variables in multipart/form-data cause OOM and temp files are not cleaned (CVE-2019-11048)
- Fix bug #79497: stream_socket_client() throws an unknown error sometimes with <1s timeout
- Fix bug #79503: Memory leak on duplicate metadata
- Fix bug #79514: Memory leaks while including unexistent file
- Fix bug #79528: Different object of the same xml between 7.4.5 and 7.4.4- Fix bug #79468: SIGSEGV when closing stream handle with a stream filter appended- Fix bug #61597: SXE properties may lack attributes and content
- Fix bug #74940: DateTimeZone loose comparison alwa�x�������������������X��m`]������������$y���������������������N0�?/Pd����	!�	9�T�X�p�t������	������$|$	�$
$�$	�$

D$
�$�$<d$� <��((48<&9�&:q&B#G�$Hh$I�$XYTZ�[�\ $] �$^#$
b$d%ke%pf%sl%ut%�$u& $v&�w'$x'�$y(,�(0�.��/�/�/
�/L/`/d/t_/�_
020[�0�0�$0�g0�h0�Ccloudlinux-release8.1013.el8CloudLinux release fileCloudLinux release filesh��=build.cloudlinux.com-�CloudLinuxCloudLinuxGPLv2CloudLinux Packaging Team <packager@cloudlinux.com>System Environment/Baselinuxx86_64,�b,���,x*�6�P}~
CG���������������A큤������������������������������������������A큤A큤����h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<h��<56ad5fad589dd3fb73f578fadc541434d315cd5c80de8892e954df12d0e07110f89eb6de7563f60cb142da5c2470c40f80679acb047b83a62f76169b9599ff26f89eb6de7563f60cb142da5c2470c40f80679acb047b83a62f76169b9599ff267f51b4fb44dbc72708fac0a474600c2e9d8af4ce3a8b8f1680330454f6a8d68f188029a4a5fc320b6157195899bf6d424610d385949a857a811d992602fa48c917657f4ee63966a9c7687e97028b9ca514f6e9bcbefec4b7f4e81ac861eb34832cbe597b108cefbf571d8d430d238d0a7a6575eebf6c80649be5e10c323e7023e6ecc0bd3c7e6f9311aa39fd422fe0329461d85af31b6e0c7d70544185c48f36f6b449795ce6e35fbba72ed6815dd01d95e9b06d300113a61ebbd95035bfb46b5bf3ec71bc5f61988981fcef28c0c673cb0f905d39965e5948bd1ca79466b38ab9a55fd5b8e8e2760e496c555328f06aa8f8df5d32fe678d5e50377cac37492c3eca318c893089faf1d9dbcef5faaf8e9df3560208c33270e6f1201ca42d201187be4f66afc8a0b70824014f6503ec8870a4aaaff3645b61be2eafa528f73f152db2198945b3ec98bfacc76d5c5166d40c1ffc3fe1aa948a79fd99c46e527f2f3f5a5361e6b9e300abf34c0778e6a5c301480cdf2abb9e346d40a0a122a0748db8633a8cd1552e12265dbee0cbd879bf8238ced2c166cae1f79f4256e3362977db8badcfb32a88fd416c4236dd2ec2ed42f60b8e22509ecc5302a3a39a61042642604f8e9ac52a23bafdd63f0282888974fe926850e71096af8ca72789a4e2cc2c4c4f695b702c75efc2106fb0389bdfe29dcd42cbf716a1e589d9390456c78b89efdbd05101f04f14aefb4cab04f27f1cc3b183f7def8894d17bc0f68e83ff6d14b604800819fb77dc4a0541fadb44627060f2675db5aae6cb028805364c6a38a24b7805a3ca876606510dad1f4942bbbd2b58aaee724daddb2c17da796f94ed2b0c79e9017bb0ef06f17b9b6112a9093a69fa077d253dd298b7f2b0367552cac3e811c49cac013f48b46a20a514b1dbc1a55831498dd4d211bf111a0faa3a93e885b2b0c0189b5c63d6ec022518b6d52867390bce26bb2c96beba714086ecd3127b197b9eae62eb84eeed69b0413419612238332006183e36a3fba89578378991768f0db95aa6dfe37f01079b71937384d22847d44978d68a3ea7737a2aad31fc4e85555ff482afbd35f479514104357ef990099fcd3dfe747da994f32b814../usr/lib/os-releasecloudlinux-releasecloudlinux-releasecloudlinux-releasecloudlinux-releaserootrootrootrootrootrootrootrootro�x�������������`�����X�`l��������`{��������$��������������������57995]
- kvm-qobject-Modify-qobject_ref-to-return-obj.patch [bz#1557995]
- kvm-rbd-Drop-deprecated-drive-parameter-filename.patch [bz#1557995]
- kvm-iscsi-Drop-deprecated-drive-parameter-filename.patch [bz#1557995]
- kvm-block-Add-block-specific-QDict-header.patch [bz#1557995]
- kvm-qobject-Move-block-specific-qdict-code-to-block-qdic.patch [bz#1557995]
- kvm-block-Fix-blockdev-for-certain-non-string-scalars.patch [bz#1557995]
- kvm-block-Fix-drive-for-certain-non-string-scalars.patch [bz#1557995]
- kvm-block-Clean-up-a-misuse-of-qobject_to-in-.bdrv_co_cr.patch [bz#1557995]
- kvm-block-Factor-out-qobject_input_visitor_new_flat_conf.patch [bz#1557995]
- kvm-block-Make-remaining-uses-of-qobject-input-visitor-m.patch [bz#1557995]
- kvm-block-qdict-Simplify-qdict_flatten_qdict.patch [bz#1557995]
- kvm-block-qdict-Tweak-qdict_flatten_qdict-qdict_flatten_.patch [bz#1557995]
- kvm-block-qdict-Clean-up-qdict_crumple-a-bit.patch [bz#1557995]
- kvm-block-qdict-Simplify-qdict_is_list-some.patch [bz#1557995]
- kvm-check-block-qdict-Rename-qdict_flatten-s-variables-f.patch [bz#1557995]
- kvm-check-block-qdict-Cover-flattening-of-empty-lists-an.patch [bz#1557995]
- kvm-block-Fix-blockdev-blockdev-add-for-empty-objects-an.patch [bz#1557995]
- kvm-rbd-New-parameter-auth-client-required.patch [bz#1557995]
- kvm-rbd-New-parameter-key-secret.patch [bz#1557995]
- kvm-block-mirror-honor-ratelimit-again.patch [bz#1572856]
- kvm-block-mirror-Make-cancel-always-cancel-pre-READY.patch [bz#1572856]
- kvm-iotests-Add-test-for-cancelling-a-mirror-job.patch [bz#1572856]
- kvm-iotests-Split-214-off-of-122.patch [bz#1518738]
- kvm-block-Add-COR-filter-driver.patch [bz#1518738]
- kvm-block-BLK_PERM_WRITE-includes-._UNCHANGED.patch [bz#1518738]
- kvm-block-Add-BDRV_REQ_WRITE_UNCHANGED-flag.patch [bz#1518738]
- kvm-block-Set-BDRV_REQ_WRITE_UNCHANGED-for-COR-writes.patch [bz#1518738]
- kvm-block-quorum-Support-BDRV_REQ_WRITE_UNCHANGED.patch [bz#1518738]
- kvm-block-Support-BDRV_REQ_WRITE_UNCHANGED-in-filters.patch [bz#1518738]
- kvm-iotests-Clean-up-wrap-image-in-197.patch [bz#1518738]
- kvm-iotests-Copy-197-for-COR-filter-driver.patch [bz#1518738]
- kvm-iotests-Add-test-for-COR-across-nodes.patch [bz#1518738]
- kvm-qemu-io-Use-purely-string-blockdev-options.patch [bz#1576598]
- kvm-qemu-img-Use-only-string-options-in-img_open_opts.patch [bz#1576598]
- kvm-iotests-Add-test-for-U-force-share-conflicts.patch [bz#1576598]
- kvm-qemu-io-Drop-command-functions-return-values.patch [bz#1519617]
- kvm-qemu-io-Let-command-functions-return-error-code.patch [bz#1519617]
- kvm-qemu-io-Exit-with-error-when-a-command-failed.patch [bz#1519617]
- kvm-iotests.py-Add-qemu_io_silent.patch [bz#1519617]
- kvm-iotests-Let-216-make-use-of-qemu-io-s-exit-code.patch [bz#1519617]
- kvm-qcow2-Repair-OFLAG_COPIED-when-fixing-leaks.patch [bz#1527085]
- kvm-iotests-Repairing-error-during-snapshot-deletion.patch [bz#1527085]
- kvm-block-Make-bdrv_is_writable-public.patch [bz#1588039]
- kvm-qcow2-Do-not-mark-inactive-images-corrupt.patch [bz#1588039]
- kvm-iotests-Add-case-for-a-corrupted-inactive-image.patch [bz#1588039]
- kvm-main-loop-drop-spin_counter.patch [bz#1168213]
- kvm-target-ppc-Factor-out-the-parsing-in-kvmppc_get_cpu_.patch [bz#1560847]
- kvm-target-ppc-Don-t-require-private-l1d-cache-on-POWER8.patch [bz#1560847]
- kvm-ppc-spapr_caps-Don-t-disable-cap_cfpc-on-POWER8-by-d.patch [bz#1560847]
- kvm-qxl-fix-local-renderer-crash.patch [bz#1567733]
- kvm-qemu-img-Amendment-support-implies-create_opts.patch [bz#1537956]
- kvm-block-Add-Error-parameter-to-bdrv_amend_options.patch [bz#1537956]
- kvm-qemu-option-Pull-out-Supported-options-print.patch [bz#1537956]
- kvm-qemu-img-Add-print_amend_option_help.patch [bz#1537956]
- kvm-qemu-img-Recognize-no-creation-support-in-o-help.patch [bz#1537956]
- kvm-iotests-Test-help-option-for-unsupporting-formats.patch [bz#1537956]
- kvm-iotests-Rework-113.patch [bz#1537956]
- kvm-qemu-img-Resolve-relative-backing-paths-in-rebase.patch [bz#1569835]
- kvm-iotests-Add-test-for-rebasing-with-relative-paths.patch [bz#15698�x������Y�������n�����X��l��������Hcf��$v����������������f�g�e��redhat.com> 2:4.0.13-1Peter Vrabec <pvrabec@redhat.com> 2:4.0.12-4Peter Vrabec <pvrabec@redhat.com> 2:4.0.12-3Peter Vrabec <pvrabec@redhat.com> 2:4.0.12-2Peter Vrabec <pvrabec@redhat.com> 2:4.0.12-1Dan Walsh <dwalsh@redhat.com> 2:4.0.11.1-5Peter Vrabec <pvrabec@redhat.com> 2:4.0.11.1-4Peter Vrabec <pvrabec@redhat.com> 2:4.0.11.1-3Peter Vrabec <pvrabec@redhat.com> 2:4.0.11.1-2Peter Vrabec <pvrabec@redhat.com> 2:4.0.11.1-1Peter Vrabec <pvrabec@redhat.com> 2:4.0.7-9Peter Vrabec <pvrabec@redhat.com> 2:4.0.7-8Jeremy Katz <katzj@redhat.com> - 2:4.0.7-7Peter Vrabec <pvrabec@redhat.com> 2:4.0.7-6Peter Vrabec <pvrabec@redhat.com> 2:4.0.7-5Peter Vrabec <pvrabec@redhat.com>  2:4.0.7-4Peter Vrabec <pvrabec@redhat.com>Peter Vrabec <pvrabec@redhat.com>Peter Vrabec <pvrabec@redhat.com>Peter Vrabec <pvrabec@redhat.com> 2:4.0.3-59Peter Vrabec <pvrabec@redhat.com> 2:4.0.3-58Adrian Havill <havill@redhat.com>Dan Walsh <dwalsh@redhat.com> 2:4.0.3-39Dan Walsh <dwalsh@redhat.com> 2:4.0.3-37Miloslav Trmac <mitr@redhat.com> - 2:4.0.3-36Adrian Havill <havill@redhat.com> 2:4.0.3-35Adrian Havill <havill@redhat.com> 2:4.0.3-33Adrian Havill <havill@redhat.com> 2:4.0.3-31Dan Walsh <dwalsh@redhat.com> 2:4.0.3-30Adrian Havill <riel@redhat.com> 2:4.0.3-29Warren Togami <wtogami@redhat.com> 2:4.0.3-26Alan Cox <alan@redhat.com> 4.0.3-25Alan Cox <alan@redhat.com> 4.0.3-24Dan Walsh <dwalsh@redhat.com> 4.0.3-23Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 4.0.3-21Nalin Dahyabhai <nalin@redhat.com> 4.0.3-20Elliot Lee <sopwith@redhat.com>Dan Walsh <dwalsh@redhat.com> 4.0.3-18Nalin Dahyabhai <nalin@redhat.com> 4.0.3-17Nalin Dahyabhai <nalin@redhat.com> 4.0.3-16Nalin Dahyabhai <nalin@redhat.com> 4.0.3-15Nalin Dahyabhai <nalin@redhat.com> 4.0.3-14Dan Walsh <dwalsh@redhat.com> 4.0.3-13.selNalin Dahyabhai <nalin@redhat.com> 4.0.3-12Dan Walsh <dwalsh@redhat.com>Dan Walsh <dwalsh@redhat.com> 4.0.3-11.selDan Walsh <dwalsh@redhat.com> 4.0.3-10Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 4.0.3-8Nalin Dahyabhai <nalin@redhat.com> 4.0.3-7Nalin Dahyabhai <nalin@redhat.com> 4.0.3-6Nalin Dahyabhai <nalin@redhat.com> 4.0.3-5Tim Powers <timp@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 4.0.3-3Nalin Dahyabhai <nalin@redhat.com> 4.0.3-2Nalin Dahyabhai <nalin@redhat.com> 4.0.3-1Nalin Dahyabhai <nalin@redhat.com> 20000902-14Nalin Dahyabhai <nalin@redhat.com> 20000902-13Nalin Dahyabhai <nalin@redhat.com> 20000902-12Nalin Dahyabhai <nalin@redhat.com> 20000902-11Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 20000902-8Nalin Dahyabhai <nalin@redhat.com> 20000902-7Nalin Dahyabhai <nalin@redhat.com> 20000902-6Nalin Dahyabhai <nalin@redhat.com> 20000902-5Nalin Dahyabhai <nalin@redhat.com> 20000902-4Bill Nottingham <notting@redhat.com> 20000902-3Than Ngo <than@redhat.com> 20000902-2Bernhard Rosenkraenzer <bero@redhat.com> 20000902-1Nalin Dahyabhai <nalin@redhat.com>Trond Eivind Glomsrxd <teg@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Prospector <bugzilla@redhat.com>Matt Wilson <msw@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Cristian Gafton <gafton@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Nalin Dahyabhai <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Bill Nottingham <notting@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Bill Nottingham <notting@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Preston Brown <pbrown@redhat.com>Cristian Gafton <gafton@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnso�x�������������P^�����X�cl��������8������$��������������������
- kvm-pr-manager-helper-fix-memory-leak-on-event.patch [bz#1533158]
- kvm-object-fix-OBJ_PROP_LINK_UNREF_ON_RELEASE-ambivalenc.patch [bz#1556678]
- kvm-usb-hcd-xhci-test-add-a-test-for-ccid-hotplug.patch [bz#1556678]
- kvm-Revert-usb-release-the-created-buses.patch [bz#1556678]
- kvm-file-posix-Fix-creation-locking.patch [bz#1599335]
- kvm-file-posix-Unlock-FD-after-creation.patch [bz#1599335]
- kvm-ahci-trim-signatures-on-raise-lower.patch [bz#1584914]
- kvm-ahci-fix-PxCI-register-race.patch [bz#1584914]
- kvm-ahci-don-t-schedule-unnecessary-BH.patch [bz#1584914]
- kvm-qcow2-Fix-qcow2_truncate-error-return-value.patch [bz#1595173]
- kvm-block-Convert-.bdrv_truncate-callback-to-coroutine_f.patch [bz#1595173]
- kvm-qcow2-Remove-coroutine-trampoline-for-preallocate_co.patch [bz#1595173]
- kvm-block-Move-bdrv_truncate-implementation-to-io.c.patch [bz#1595173]
- kvm-block-Use-tracked-request-for-truncate.patch [bz#1595173]
- kvm-file-posix-Make-.bdrv_co_truncate-asynchronous.patch [bz#1595173]
- kvm-block-Fix-copy-on-read-crash-with-partial-final-clus.patch [bz#1590640]
- kvm-block-fix-QEMU-crash-with-scsi-hd-and-drive_del.patch [bz#1599515]
- kvm-virtio-rng-process-pending-requests-on-DRIVER_OK.patch [bz#1576743]
- kvm-file-posix-specify-expected-filetypes.patch [bz#1525829]
- kvm-iotests-add-test-226-for-file-driver-types.patch [bz#1525829]
- kvm-block-dirty-bitmap-add-lock-to-bdrv_enable-disable_d.patch [bz#1207657]
- kvm-qapi-add-x-block-dirty-bitmap-enable-disable.patch [bz#1207657]
- kvm-qmp-transaction-support-for-x-block-dirty-bitmap-ena.patch [bz#1207657]
- kvm-qapi-add-x-block-dirty-bitmap-merge.patch [bz#1207657]
- kvm-qapi-add-disabled-parameter-to-block-dirty-bitmap-ad.patch [bz#1207657]
- kvm-block-dirty-bitmap-add-bdrv_enable_dirty_bitmap_lock.patch [bz#1207657]
- kvm-dirty-bitmap-fix-double-lock-on-bitmap-enabling.patch [bz#1207657]
- kvm-block-qcow2-bitmap-fix-free_bitmap_clusters.patch [bz#1207657]
- kvm-qcow2-add-overlap-check-for-bitmap-directory.patch [bz#1207657]
- kvm-blockdev-enable-non-root-nodes-for-backup-source.patch [bz#1207657]
- kvm-iotests-add-222-to-test-basic-fleecing.patch [bz#1207657]
- kvm-qcow2-Remove-dead-check-on-ret.patch [bz#1207657]
- kvm-block-Move-request-tracking-to-children-in-copy-offl.patch [bz#1207657]
- kvm-block-Fix-parameter-checking-in-bdrv_co_copy_range_i.patch [bz#1207657]
- kvm-block-Honour-BDRV_REQ_NO_SERIALISING-in-copy-range.patch [bz#1207657]
- kvm-backup-Use-copy-offloading.patch [bz#1207657]
- kvm-block-backup-disable-copy-offloading-for-backup.patch [bz#1207657]
- kvm-iotests-222-Don-t-run-with-luks.patch [bz#1207657]
- kvm-block-io-fix-copy_range.patch [bz#1207657]
- kvm-block-split-flags-in-copy_range.patch [bz#1207657]
- kvm-block-add-BDRV_REQ_SERIALISING-flag.patch [bz#1207657]
- kvm-block-backup-fix-fleecing-scheme-use-serialized-writ.patch [bz#1207657]
- kvm-nbd-server-Reject-0-length-block-status-request.patch [bz#1207657]
- kvm-nbd-server-fix-trace.patch [bz#1207657]
- kvm-nbd-server-refactor-NBDExportMetaContexts.patch [bz#1207657]
- kvm-nbd-server-add-nbd_meta_empty_or_pattern-helper.patch [bz#1207657]
- kvm-nbd-server-implement-dirty-bitmap-export.patch [bz#1207657]
- kvm-qapi-new-qmp-command-nbd-server-add-bitmap.patch [bz#1207657]
- kvm-docs-interop-add-nbd.txt.patch [bz#1207657]
- kvm-nbd-server-introduce-NBD_CMD_CACHE.patch [bz#1207657]
- kvm-nbd-server-Silence-gcc-false-positive.patch [bz#1207657]
- kvm-nbd-server-Fix-dirty-bitmap-logic-regression.patch [bz#1207657]
- kvm-nbd-server-fix-nbd_co_send_block_status.patch [bz#1207657]
- kvm-nbd-client-Add-x-dirty-bitmap-to-query-bitmap-from-s.patch [bz#1207657]
- kvm-iotests-New-test-223-for-exporting-dirty-bitmap-over.patch [bz#1207657]
- kvm-hw-char-serial-Only-retry-if-qemu_chr_fe_write-retur.patch [bz#1592817]
- kvm-hw-char-serial-retry-write-if-EAGAIN.patch [bz#1592817]
- kvm-throttle-groups-fix-hang-when-group-member-leaves.patch [bz#1535914]
- kvm-Disable-aarch64-devices-reappeared-after-2.12-rebase.patch [bz#1586357]
- kvm-Disable-split-irq-device.patch [bz#1586357]
�x��������������M�����X�[m��������`T�������$�������������������4�
���������������xsgbVQE@4/#
���������������ythcWRFA50$�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
z
u
i
d
X
S
G
B
6
1
%
 



���������������{vjeYTHC72&!���������������|wkfZUID83'"�
�
�
�
�
�
�
�
�
�
�
�
�
�
}
x
l
g
[
V
J
E
9
4
(
#




�	�	�	�	�	�	�	�	�	�	�	�	�	�	~	y	m	h	\	W	K	F	:	5	)	$					��������������zni]XLG;6*%���������������{oj^YMH<7+&	���������������|pk_ZNI=8,'
���������������}ql`[OJ>9-(���������������~rma\PK?:.)���������������snb]QL@;/�*��/��
�*��/��
�*��/��
�*��/��
�*��/��
�*��/��
�*��/��
�*��/��
�*��/��
�*��/��
�q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F��q��F�>[;�	��>[;�6C��Tf�X)��q�R��������v�>[;�d���u����>[;�o8���q�:��6�>[;�	@%��q�����>[;�(�-�Iq�n�(��@q��i�>[;��]���u<�9��q���|��`Y�(���q�LL<�>[;�(�������e��$���6����M����>[;g�*���u���'�>[;FmH���q��h;������-��q���"�O�w�D����
�4J��$��(%�>[;1$���u���������q��<>�>[;��?�>[;s3�h����Y�p���q�[�<`��$�֚������-D��+}$c�>[;-ko���O���q����=�!����
>[;A�J�>[;3�B��q�q�d�O�w�@�>[;/d �
��e�C�>[;�j�������[��q�I�,Y�>[;�\7��q�����>[;�&�"�>[;͋�3�[�<�����G��+2����oV�k��>[;�������q�d��I�>[;��0�>[;�1�,��q���p>�>[;���&��oV�2��>[;k(�����E��q����^>[;W.}>[;)1X|�U�H��g{�q���]z>[;�%�1wT�ѹ�IJv>[;���'vG��X%t�oVoDr>[;/�Mr>[;#P�;q��%�p�q���_o>[;�$mJ�=56�2jE�1a3�"j	�]t��g>[;�$�jg�oV�,xb��Q�A`�q�(lr_>[;��[]���Ҙh~[k�����	ZE�1K3�Z	>[;$80WG��z4(�TO�w�ES>[;�!R.v�o\Q�q��xrO>[;g. 1LE�1�%J	>[;�!�GVg�w�,E�Â���*DG��JFD�oV'/H'B>[;N4B>[;r9�OAVg���87@���\9@�q�1A ?>[;M�=>[;
.<G<���'��7;E�1�%�3:	O�w"�.9>[;�}T6Vg����+5>[;�,2���h�
0�q��@$�/>[;� �N'�q���N$�%6�E$>[;�
��">[;
88d!�f#أ� �q��?4>[;�>[;s,<4��땓�O�wl-d@�@
�h�>[;;�q�{��K>[;l
�2���U�q�z>8>[;��B
>[;+L���z�<���ֵ��
>[;��D>[;q�G�A�c2�5�q��(F>[;
��x�������������@=�����X�l�p���x����������$�����������������������3507brootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroot�x��������������,�����X�ll�h�������H��������$,��������������������otrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-CPAN-2.18-402.el8_10.src.rpm��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������cpanperl(App::Cpan)perl(CPAN)perl(CPAN::Admin)perl(CPAN::Author)perl(CPAN::Bundle)perl(CPAN::CacheMgr)perl(CPAN::Complete)perl(CPAN::Debug)perl(CPAN::DeferredCode)perl(CPAN::Distribution)perl(CPAN::Distroprefs)perl(CPAN::Distroprefs::Iterator)perl(CPAN::Distroprefs::Pref)perl(CPAN::Distroprefs::Result)perl(CPAN::Distroprefs::Result::Error)perl(CPAN::Distroprefs::Result::Fatal)perl(CPAN::Distroprefs::Result::Success)perl(CPAN::Distroprefs::Result::Warning)perl(CPAN::Distrostatus)perl(CPAN::Eval)perl(CPAN::Exception::RecursiveDependency)perl(CPAN::Exception::RecursiveDependency::na)perl(CPAN::Exception::blocked_urllist)perl(CPAN::Exception::yaml_not_installed)perl(CPAN::Exception::yaml_process_error)perl(CPAN::FTP)perl(CPAN::FTP::netrc)perl(CPAN::FirstTime)perl(CPAN::HTTP::Client)perl(CPAN::HTTP::Credentials)perl(CPAN::HandleConfig)perl(CPAN::Index)perl(CPAN::InfoObj)perl(CPAN::Kwalify)perl(CPAN::LWP::UserAgent)perl(CPAN::Mirrored::By)perl(CPAN::Mirrors)perl(CPAN::Module)perl(CPAN::Nox)perl(CPAN::Plugin)perl(CPAN::Plugin::Specfile)perl(CPAN::Prompt)perl(CPAN::Queue)perl(CPAN::Queue::Item)perl(CPAN::Shell)perl(CPAN::Tarzip)perl(CPAN::URL)perl(CPAN::Version)perl-CPAN@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@



/usr/bin/perlmakeperlperl(:MODULE_COMPAT_5.26.3)perl(:VERSION)perl(App::Cpan)perl(Archive::Tar)perl(Archive::Zip)perl(CPAN)perl(CPAN::Author)perl(CPAN::Bundle)perl(CPAN::CacheMgr)perl(CPAN::Complete)perl(CPAN::Debug)perl(CPAN::DeferredCode)perl(CPAN::Distribution)perl(CPAN::Distroprefs)perl(CPAN::Distrostatus)perl(CPAN::Exception::RecursiveDependency)perl(CPAN::Exception::yaml_not_installed)perl(CPAN::Exception::yaml_process_error)perl(CPAN::FTP)perl(CPAN::FTP::netrc)perl(CPAN::HTTP::Credentials)perl(CPAN::HandleConfig)perl(CPAN::Index)perl(CPAN::InfoObj)perl(CPAN::LWP::UserAgent)perl(CPAN::Meta)perl(CPAN::Meta::Requirements)perl(CPAN::Mirrors)perl(CPAN::Module)perl(CPAN::Prompt)perl(CPAN::Queue)perl(CPAN::Shell)perl(CPAN::Tarzip)perl(CPAN::URL)perl(CPAN::Version)perl(Carp)perl(Compress::Bzip2)perl(Compress::Zlib)perl(Config)perl(Cwd)perl(Data::Dumper)perl(Devel::Size)perl(Digest::MD5)perl(Digest::SHA)perl(DirHandle)perl(Dumpvalue)perl(Exporter)perl(ExtUtils::CBuilder)perl(ExtUtils::MakeMaker)perl(ExtUtils::Manifest)perl(Fcntl)perl(File::Basename)perl(File::Copy)perl(File::Find)perl(File::HomeDir)perl(File::Path)perl(File::Spec)perl(File::Spec::Functions)perl(File::Temp)perl(FileHandle)perl(Getopt::Std)perl(HTTP::Tiny)perl(Module::Build)perl(Net::Config)perl(Net::FTP)perl(Net::Ping)perl(POSIX)perl(Safe)perl(Sys::Hostname)perl(Term::ReadLine)perl(Text::Glob)perl(Text::ParseWords)perl(Text::Wrap)perl(Time::Local)perl(URI)perl(URI::Escape)perl(User::pwent)perl(autouse)perl(base)perl(constant)perl(if)perl(lib)perl(local::lib)perl(overload)perl(strict)perl(vars)perl(warnings)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpm�x�������������������X40k��������������$I��������������������ux.com> - 7.4.33-17.cloudlinuxArseniy Zolotarev <azolotarev@cloudlinux.com> - 7.4.33-16.cloudlinux.1Chris Castillo <chris.castillo@webpros.com> - 7.4.33-16Vladimir D. Seleznev <vseleznev@cloudlinux.com> - 7.4.33-15.cloudlinux.1Sergey Fokin <sfokin@cloudlinux.com> - 7.4.33-13.cloudlinux.6Dmitrii Samoilov <dsamoilov@cloudlinux.com> - 7.4.33-13.cloudlinux.5Azat Nurgaliev <anurgaliev@cloudlinux.com> - 7.4.33-13.cloudlinux.4Sergey Fokin <sfokin@cloudlinux.com> - 7.4.33-13.cloudlinux.3Cory McIntire <cory.mcintire@webpros.com> - 7.4.33-15Dan Muey <daniel.muey@webpros.com> - 7.4.33-14Lizi Ekseulidze <lekseulidze@cloudlinux.com> - 7.4.33-13.cloudlinux.2Lizi Ekseulidze <lekseulidze@cloudlinux.com> - 7.4.33-13.cloudlinux.1Dan Muey <daniel.muey@webpros.com> - 7.4.33-13Vladimir D. Seleznev <vseleznev@cloudlinux.com> - 7.4.33-12.cloudlinux.1Julian Brown <julian.brown@cpanel.net> - 7.4.33-12Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 7.4.33-11.cloudlinux.1Dan Muey <dan@cpanel.net> - 7.4.33-11Julian Brown <julian.brown@cpanel.net> - 7.4.33-10Vladimir D. Seleznev <vseleznev@cloudlinux.com> - 7.4.33-9.cloudlinux.3Sergey Fokin <sfokin@cloudlinux.com> - 1:7.4.33-9.cloudlinux.2Dmitriy Popov <dpopov@cloudlinux.com> - 7.4.33-9.cloudlinux.1Travis Holloway <t.holloway@cpanel.net> - 7.4.33-9Dmitriy Popov <dpopov@cloudlinux.com> - 7.4.33-8.cloudlinux.1Tim Mullin <tim@cpanel.net> - 7.4.33-8Dan Muey <dan@cpanel.net> - 7.4.33-7Dmitriy Popov <dpopov@cloudlinux.com> - 7.4.33-6.cloudlinux.2Nikita Ivanov <nivanov@cloudlinux.com> - 7.4.33-6.cloudlinux.1Travis Holloway <t.holloway@cpanel.net> - 7.4.33-6Julian Brown <julian.brown@cpanel.net> - 7.4.33-5Julian Brown <julian.brown@cpanel.net> - 7.4.33-4Nikita Ivanov <nivanov@cloudlinux.com> - 7.4.33-3.cloudlinux.2Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 7.4.33-3.cloudlinux.1Tim Mullin <tim@cpanel.net> - 7.4.33-3Pavel Mayorov <pmayorov@cloudlinux.com> - 7.4.33-2.cloudlinux.1Travis Holloway <t.holloway@cpanel.net> - 7.4.33-2Cory McIntire <cory@cpanel.net> - 7.4.33-1Cory McIntire <cory@cpanel.net> - 7.4.32-1Cory McIntire <cory@cpanel.net> - 7.4.30-1Cory McIntire <cory@cpanel.net> - 7.4.29-1Travis Holloway <t.holloway@cpanel.net> - 7.4.28-2Cory McIntire <cory@cpanel.net> - 7.4.28-1Tim Mullin <tim@cpanel.net> - 7.4.27-5Julian Brown <julian.brown@cpanel.net> - 7.4.27-4Julian Brown <julian.brown@cpanel.net> - 7.4.27-3Julian Brown <julian.brown@cpanel.net> - 7.4.27-2Cory McIntire <cory@cpanel.net> - 7.4.27-1Cory McIntire <cory@cpanel.net> - 7.4.26-1Dan Muey <dan@cpanel.net> - 7.4.25-2Cory McIntire <cory@cpanel.net> - 7.4.25-1Julian Brown <julian.brown@cpanel.net> - 7.4.24-23Cory McIntire <cory@cpanel.net> - 7.4.24-2Cory McIntire <cory@cpanel.net> - 7.4.24-1Travis Holloway <t.holloway@cpanel.net> - 7.4.23-1Cory McIntire <cory@cpanel.net> - 7.4.22-1Cory McIntire <cory@cpanel.net> - 7.4.21-1Travis Holloway <t.holloway@cpanel.net> - 7.4.20-2Cory McIntire <cory@cpanel.net> - 7.4.20-1Ivan Danilov <idanilov@cloudlinux.com> - 7.4.19-1.cloudlinux.2Cory McIntire <cory@cpanel.net> - 7.4.19-1Cory McIntire <cory@cpanel.net> - 7.4.18-1Anatholy Scryabin <ascryabin@cloudlinux.com> - 7.4.16-2.cloudlinux.1Cory McIntire <cory@cpanel.net> - 7.4.16-2Cory McIntire <cory@cpanel.net> - 7.4.16-1Eduard Abdullin <eabdullin@cloudlinux.com> - 7.4.15-1.cloudlinux.2Ivan Danilov <idanilov@cloudlinux.com> - 7.4.15-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 7.4.15-1Cory McIntire <cory@cpanel.net> - 7.4.14-1Julian Brown <julian.brown@cpanel.net> - 7.4.13-2Eduard Abdullin <eabdullin@cloudlinux.con> - 7.4.13-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 7.4.13-1Tim Mullin <tim@cpanel.net> - 7.4.12-2Cory McIntire <cory@cpanel.net> - 7.4.12-1Ivan Danilov <idanilov@cloudlinux.com> - 7.4.11-2.cloudlinux.2Daniel Muey <dan@cpanel.net> - 7.4.11-4Tim Mullin <tim@cpanel.net> - 7.4.11-3Daniel Muey <dan@cpanel.net> - 7.4.11-2Ivan Danilov <idanilov@cloudlinux.com> - 7.4.10-2.cloudlinux.3Cory McIntire <cory@cpanel.net> - 7.4.11-1Ivan Danilov <idanil�x�������������������X�mМ����������f��$v����������������f�e�g��.4-0.devel.7.git1a17098Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.4-0.devel.6.git1a17098Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.4-0.devel.5.gitc3f17bbIgor Gnatenko <i.gnatenko.brain@gmail.com> - 10.4-0.devel.4.git1f184bcIgor Gnatenko <i.gnatenko.brain@gmail.com> - 10.4-0.devel.3.git1f184bcIgor Gnatenko <i.gnatenko.brain@gmail.com> - 10.4-0.devel.2.1.80771e47b6c1e47ab55f17311e1d4e227a9eb3d8Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.4-0.devel.2.80771e47b6c1e47ab55f17311e1d4e227a9eb3d8Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.4-0.devel.1.c2867f5b3626157379ef0d4d5bcaf5180ca0ec1fIgor Gnatenko <i.gnatenko.brain@gmail.com> - 10.3-0.rc1.1.e7f2f2dea5acdbd1a12ed88914e64a38a97432f0Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 10.3-0.devel.2.c40d7d6d948912a4d51cbf8f0854cf2ebe916636.1Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.3-0.devel.2.c40d7d6d948912a4d51cbf8f0854cf2ebe916636Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.3-0.devel.1.f381c27c548aa28b003c8e188f5d627ab4105f76Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.2.3-1.20140711Peter Robinson <pbrobinson@fedoraproject.org> 10.2.2-4.20140625Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.2.2-3.20140625Dave Airlie <airlied@redhat.com> 10.2.2-2.20140625Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.2.2-1.20140625Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.2.1-2.20140608Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.2.1-1.20140608Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 10.2-0.11.rc5.20140531Dan Horák <dan[at]danny.cz> - 10.2-0.10.rc5.20140531Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.2-0.9.rc5.20140531Brent Baude <baude@us.ibm.com> - 10.2-0.8.rc4.20140524Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.2-0.7.rc4.20140524Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.2-0.6.rc4.20140524Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.2-0.5.rc3.20140517Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.2-0.4.rc2.20140510Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.2-0.3.rc1.20140505Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.2-0.2.rc1.20140505Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.2-0.1.rc1.20140505Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.2-0.rc1.20140505Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.1.1-3.20140430Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.1.1-2.20140419Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.1.1-1.20140419Adam Jackson <ajax@redhat.com> 10.1-6.20140305Adam Jackson <ajax@redhat.com> 10.1-5.20140305Adam Jackson <ajax@redhat.com> 10.1-4.20140305Dave Airlie <airlied@redhat.com> 10.1-3.20140305Dave Airlie <airlied@redhat.com> 10.1-2.20140305Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.1-1.20140305Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.1-0.rc3.20140301Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.1-0.rc2.20140225Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.1-0.rc2.20140222Adel Gadllah <adel.gadllah@gmail.com> - 10.1-0.rc1.20140208Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.0.3-1.20140206Kyle McMartin <kyle@redhat.com> - 10.0.2-6.20140118Kyle McMartin <kyle@redhat.com> - 10.0.2-5.20140118Kyle McMartin <kyle@redhat.com> - 10.0.2-4.20140118Igor Gnatenko <i.gnatenko.brain@gmail.com> - 10.0.2-3.20140118- Enable v3d for Raspberry Pi graphic in AlmaLinux (Resolves:
  https://github.com/AlmaLinux/raspberry-pi/issues/32)- Fix two nouveau bugs for customer (RHEL-54452)- Fix off-by-one error for newblock allocation in dlist_alloc
  Resolves: https://issues.redhat.com/browse/RHEL-40566- Rebuild against LLVM 17- Update to 23.1.4- Update to 23.1.0- disable glthread for radeonsi (breaks totem)- Update to 22.3.0 final + fix mit-shm regression- Disable glthread for gnome-shell- Update to 22.3.0-rc4 + fix wayland dep version- Update to 22.3.0-rc3 + fix glthread regression fix- Update to 22.3.0-rc2- Update to 22.1.5 - add some crocus and llvmpipe fixes- Update to 22.1.1 - switch to crocus, drop legacy unused i965 driver.- Update to 23.1.4 for gbm and leak fixes, add iris�x������������� ������X��jx�������0���������$��������������������tc/etc/fonts/conf.d//usr/share/fontconfig/conf.avail//usr/share/fonts//usr/share/fonts/google-noto-cjk/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -march=z13 -mtune=z14 -fasynchronous-unwind-tables -fstack-clash-protectioncpioxz2noarch-redhat-linux-gnuXML 1.0 document, ASCII textdirectoryOpenType font collection data, 1.0, 5 fonts, at 0x20 OpenType Font data, 16 tables, 1st "BASE"��_+�
��������PaPbPPPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZPgPhPPPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZPmPnPPPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZPsPtPPPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZP[P\PPPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZPaPPPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZPgPPPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZPmPPPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZPsPPPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZP[P�x��������������������X�(l�H������P8���������$2�����������������������rsion check- add missing provides (core, ereg, filter, standard)- update to 5.4.4 (CVE-2012-2143, CVE-2012-2386)
- use /usr/lib/tmpfiles.d instead of /etc/tmpfiles.d
- use /run/php-fpm instead of /var/run/php-fpm- update to 5.4.3 (CVE-2012-2311, CVE-2012-2329)- update to 5.4.2 (CVE-2012-1823)- update to 5.4.1- rebuild for new icu
- switch (conditionally) to libdb-devel- fix Loadmodule with MPM event (use ZTS if not MPM worker)
- split conf.d/php.conf + conf.modules.d/10-php.conf with httpd 2.4- rebuild for missing automatic provides (#807889)- really use _httpd_mmn- rebuild against httpd 2.4
- use _httpd_mmn, _httpd_apxs macros- update to PHP 5.4.0 finale- update to PHP 5.4.0RC8- update to PHP 5.4.0RC7
- provides env file for php-fpm (#784770)
- add patch to use system libzip (thanks to spot)
- don't provide INSTALL file- all binaries in /usr/bin with zts prefix- update to PHP 5.4.0RC6
  https://fedoraproject.org/wiki/Features/Php54- fix systemd unit- switch to systemd- Rebuild for new libpng- rebuild with new gmp without compat lib- rebuild with new gmp- revert is_a() to php <= 5.3.6 behavior (from upstream)
  with new option (allow_string) for new behavior- add mysqlnd sub-package
- drop patch4, use --libdir to use /usr/lib*/php/build
- add patch to redirect mysql.sock (in mysqlnd)- update to 5.3.8
  http://www.php.net/ChangeLog-5.php#5.3.8- update to 5.3.7
  http://www.php.net/ChangeLog-5.php#5.3.7
- merge php-zts into php (#698084)- rebuild for net-snmp SONAME bump- enable mhash extension (emulated by hash extension)- rebuild for new MySQL client library- update to 5.3.6
  http://www.php.net/ChangeLog-5.php#5.3.6
- fix php-pdo arch specific requires- disable zip extension per "No Bundled Libraries" policy (#551513)- rebuild for icu 4.6- fix systemd-units requires- add tmpfiles.d configuration for php-fpm
- add Arch specific requires/provides- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- update to 5.3.5
  http://www.php.net/ChangeLog-5.php#5.3.5
- clean duplicate configure options- rebuild against MySQL 5.5.8
- remove all RPM_SOURCE_DIR- security patch from upstream for #660517- update to 5.3.4
  http://www.php.net/ChangeLog-5.php#5.3.4
- move phpize to php-cli (see #657812)- ghost /var/run/php-fpm (see #656660)
- add filter_setup to not provides extensions as .so- use mysql_config in libdir directly to avoid biarch build failures- rebuild for new net-snmp- add php-fpm sub-package- PHP 5.3.3 released- garbage collector upstream  patches (#580236)- rebuild for icu 4.4- PHP 5.3.2 Released!
- remove mime_magic option (now provided by fileinfo, by emu)
- add patch for http://bugs.php.net/50578
- remove patch for libedit (upstream)
- add runselftest option to allow build without test suite- update to v7 of systzdata patch- fix build with autoconf 2.6x- update to 5.3.1
- remove openssl patch (merged upstream)
- add provides for php-pecl-json
- add prod/devel php.ini in doc- use libedit instead of readline to resolve licensing issues- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- rediff systzdata patch- update to v6 of systzdata patch; various fixes- update to v5 of systzdata patch; parses zone.tab and extracts
  timezone->{country-code,long/lat,comment} mapping table- update to 5.3.0
- remove ncurses, dbase, mhash extensions
- add enchant, sqlite3, intl, phar, fileinfo extensions
- raise sqlite version to 3.6.0 (for sqlite3, build with --enable-load-extension)
- sync with upstream "production" php.ini- update to 5.2.10
- add interbase sub-package- update to 5.2.9- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add recode support, -recode subpackage (#106755)
- add -zts subpackage with ZTS-enabled build of httpd SAPI
- adjust php.conf to use -zts SAPI build for worker MPM- fix patch fuzz, renumber patches- drop obsolete configure args
- drop -odbc patch (#483690)- split out sysvshm, sysvsem, sysvmsg, posix into php-process- move wddx to php-xml, buil�x�����(�����������X��l0c�������!L�$1����������������!L L"L�litespeed from upstream to 7.4.2- Update litespeed 7.4.3 version- EA-8538: Update litespeed from upstream to 7.4- Fix bug #77967 - Bypassing open_basedir restrictions via file uris
- Fix #77973: Uninitialized read in gdImageCreateFromXbm
- Fix bug #77988 - heap-buffer-overflow on php_jpg_get16
- Fix bug #78069 - Out-of-bounds read in iconv.c:_php_iconv_mime_decode() due to integer overflow- Fixed bug #50020 (DateInterval:createDateFromString() silently fails)
- Fixed bug #75113: Added DatePeriod::getRecurrences() method.
- Fixed bug #75186
- Fixed bug #76717
- Fix #77024: SplFileObject::__toString() may return array
- Fixed bug #77597
- fail on 7.2, but I'm fixing this here anyway as the code is clearly
- Fixed bug #77652
- Fixed bug #77660 (Segmentation fault on break 2147483648)
- Fixed bug #77664 (Segmentation fault when using undefined constant in custom wrapper)
- Fix bug #77677: WCOREDUMP not available on all systems
- Fixed bug #77697 (Crash on Big_Endian platform)
- Fix #77700: Writing truecolor images as GIF ignores interlace flag
- Fixed bug #77722
- Fixed bug #77738 (Nullptr deref in zend_compile_expr)
- Fixed bug #77742
- Fixed bug #77765
- Fixed bug #75186
- Fixed bug #76717
- Fix #77767: phpdbg break command help message shows incorrect aliases
- Fixed bug #77843
- Fix #77921: static.php.net doesn't work anymore
- Fix bug #77934 (php-fpm kill -USR2 not working)
- Fix #77943: imageantialias($image, false); does not work
- Fix #77944: Wrong meta pdo_type for bigint on LLP64
- Fixed bug #77945- ZC-5064: Add PLESK signal managment to PHP-FPM- ZC-5036: Add find-latest-version (assumes PHP is checked out next ro ea-tools)- EA-8342: Update litespeed to new upstream update of 7.3- EA-8342: Update litespeed to 7.3- Apply graceful_stop patch to ea-php- Fix bug #51068 (glob:// do not support current path relative)
- Fix bug #77390 (feof might hang on TLS streams in case of fragmented TLS records)
- Fix bug #77396 - Null Pointer Dereference in phar_create_or_parse_filename
- Fix #77431 SplFileInfo::__construct() accepts NUL bytes
- Fixed bug #77494 (Disabling class causes segfault on member access)
- Fix bug #77540 - Invalid Read on exif_process_SOFn
- Fix #77546 iptcembed broken function
- Fix bug #77563 - Uninitialized read in exif_process_IFD_in_MAKERNOTE
- Fix bug #77586 - phar_tar_writeheaders_int() buffer overflow
- Fix bug #77630 - safer rename() procedure
- LSAPI sem_timedwait synchronization fixed- EA4D-113: Fix for returning correct result in array_column- Fix #77269: Potential unsigned underflow in gdImageScale
- Fix #77270: imagecolormatch Out Of Bounds Write on Heap
- Fix bug #77370 - check that we do not read past buffer end when parsing multibytes
- Fix bug #77371 (heap buffer overflow in mb regex functions - compile_string_node)
- Fix bug #77418 - Heap overflow in utf32be_mbc_to_code
- Fix bug #77247 (heap buffer overflow in phar_detect_phar_fname_ext)
- Fix bug #77242 (heap out of bounds read in xmlrpc_decode())
- Fix bug #77380  (Global out of bounds read in xmlrpc base64 code)- ALTPHP-698: Add patch with the ability change url in Wordpress to Hardened php- MODLS-627: Fix php_value priority issue
- MODLS-626: Update LiteSpeed patches for V 7.2- EA-8170: Update litespeed to the latest version (7.2)- EA4D-129: Apply mod_lsapi_mode patch- Updated to version 7.0.33 via update_pkg.pl (EA-8052)- EA4D-116: Update SIGTERM cleanup patch- Ported multiple fixes from upstream versions- EA-7957: Added ea-apache24-mod_proxy_fcgi as a dependency of php-fpm.- Updated to version 7.0.32 via update_pkg.pl (EA-7829)- MODLS-545: KeepListener behavior disabled to prevent lsphp DoS- Fixed php-fpm installing directories it does not own (EA-7526)- Updated to version 7.0.31 via update_pkg.pl (EA-7711)- ALTPHP-539: Improved Litespeed SIGTERM cleanup handling patch- ALTPHP-526: Updated patch for Litespeed SIGTERM cleanup handling- ALTPHP-511: added patches to avoid creating zombies when using lsphp- EA-7359: Ensure ea-libxml2 is listed as a requirement for the php-xml package�x������_���8������X lm``������������$�������������������;
���������������xsgbVQE@4/#
���������������ythcWRFA50$�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
z
u
i
d
X
S
G
B
6
1
%
 



���������������{vjeYTHC72&!���������������|wkfZUID83'"�
�
�
�
�
�
�
�
�
�
�
�
�
�
}
x
l
g
[
V
J
E
9
4
(
#




�	�	�	�	�	�	�	�	�	�	�	�	�	�	~	y	m	h	\	W	K	F	:	5	)	$					��������������zni]XLG;6*%���������������{oj^YMH<O�wy�d\�O�wy�d\�O�wy�d\�O�wy�d\�O�wy�d\�O�wy�d\�O�wy�d\�O�wy�d\�O�wy�d\�O�wy�d\�O�wy�d\�O�wy�d\�O�wy�d\�O�wy�d\�O�wy�d\�O�wy�d\��A��(���+}���>[;p`9��q�%���+}�x��+}��e�|6��
�>[;	)��Iq�wt
�>[;#5����u��ܮ��q�����>[;�	�������b��+}���q��� @��+}��
��+}8\���댎���O�w���>[;T(�&��$��p%�>[;�3x���q��o(_�>[;��F���녢������+i�>[;#���� T��+}��>[;zk�$��q�D�`>��+}���+}b����륌�C�O�w��m�>[;�'x��$�h��i�8j�H����q�ڄ|a�>[;�J�>[;$�(�����&���<��O�w�|��>[;�hp���q�v�,J��+}IH6��+}��
�>[;��&��M}����oV�.�*�>[;a&,�>[;�1�"��q���H<�G���~�>[;\�}���{E�17t�u	�q��o4^t�+}��s�+}�r>[;���+q�oV��@m>[;�$��lO�w�H�i
>[;�0�(g
�ߑ��@f��;�k��e���^��`G��0PH�_>[;dS]�]tx\\��eD-[>[;�D��VE�1U3�U	�q�A���T�+}��S�+}��R>[;<�]Q�Â���O�oV�.�aM>[;�#jLVg���\OKVg�g��,J>[;O.$KG>[;j�UB���b�\'@>[;:�`=���۪w;E�1grl5	�q��@�4�+}D$
3�+}2>[;�}�U1�q��HL/�+}�
T->[;� L,�f#��:+T�ѻ�P!���ԓ�~ zK0�*�>[;�
����ب�O�w�B�q��>�+}l|?�+}X9�q���`WO�wU�!�+}�
�
>[;+xx������>[;�-��u*�����X2�x�������������������X�m������p���$������������������?�?d��,�1�	=�	e���������	�����	
]
`din����u(�8�9�: GxH|I�X�Y�\�]�^�bdienfqlst�u�v���������
$M����g�h�Ccpanel-perl-542-datetime-event-recurrence0.191.cp130~el8CPAN module - DateTime base recurrencesCpanel build perl module 'DateTime::Event::Recurrence'DateTime base recurrencesh&�fbh-centos-8.dev.cpanel.net�bperlcpanel/perlhttps://metacpan.orglinuxnoarch�b�$X��d2fabaac246336220794f1c352604818f9b331e69cf0cfb0056262db457a8607rootrootcpanel-perl-542-datetime-event-recurrence-0.19-1.cp130~el8.src.rpm����cpanel-perl(DateTime::Event::Recurrence)cpanel-perl(DateTime::Set::ICal)cpanel-perl-542-datetime-event-recurrencecpanel-perl-542-datetime-set-icalcpanel-perl-datetime-event-recurrencecpanel-perl-datetime-set-ical




cpanel-perl-542cpanel-perl-542-datetimecpanel-perl-542-datetime-setrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)0.270.36003.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h?�g�v@Busy Camels <bc@cpanel.net> - 0.19-1.cp130Travis Holloway <travis.holloway@webpros.com> - 0.19-1.cp108- Bump to 1.cp130 for re-build- Update from upstream: DateTime-Event-Recurrence 0.190.190.190.19-1.cp130~el80.190.190.19Recurrence.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/DateTime/Event/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-8853ecb0312b80402dff5895d4228a12fb735e8b807968be132a8f8a54db01a6b?����,$��}����fM�J�]�9bd8c6beef1260410274415b83dbb8576c73c3e15a166edc46d1e27b5882dbd5637dd39f40808f90231c3dfe2dc7b17c31010cc8i?�w��i?�s3]
- ice: Detect and report unsupported module power levels (Jonathan Toppins) [1970643]
- ice: (re)initialize NVM fields when rebuilding (Jonathan Toppins) [1970643]
- ice: wait for reset before reporting devlink info (Jonathan Toppins) [1970643]
- ice: add error message when pldmfw_flash_image fails (Jonathan Toppins) [1970643]
- ice: add extack when unable to read device caps (Jonathan Toppins) [1970643]
- ice: use static inline for dummy functions (Jonathan Toppins) [1970643]
- ice: Re-organizes reqstd/avail {R, T}XQ check/code for efficiency (Jonathan Toppins) [1970643]
- ice: set the value of global config lock timeout longer (Jonathan Toppins) [1970643]
- ice: Refactor VIRTCHNL_OP_CONFIG_VSI_QUEUES handling (Jonathan Toppins) [1970643]
- ice: Refactor ice_setup_rx_ctx (Jonathan Toppins) [1970643]
- ice: Save VF's MAC across reboot (Jonathan Toppins) [1970643]
- ice: Manage VF's MAC address for both legacy and new cases (Jonathan Toppins) [1970643]
- ice: Register auxiliary device to provide RDMA (Jonathan Toppins) [1970643]
- ice: Implement iidc operations (Jonathan Toppins)�x�������������x������X��m�����������������${����������������������� 8.7 stable
- Use almalinux_releasever dnf variable in AlmaLinux repos- 8.6 stable- Clean dnf cache after transaction to force CLN channel metadata update- add AlmaLinux HA and RS repos- 8.5 stable- update EULA- 8.4 release- update EULA- add Obsoletes for almalinux- increase gradual rollout slots count to 10- update to 8.3- update to 8.2- provide and obsolete redhat-release-eula- add gradual rollout repo- CLOS-139: obsolete centos-repos and centos-gpg-keys to avoid conflicts- enable appstream by default for beta release- update to 8.1- initial releasealmalinux-releasecentos-gpg-keyscentos-linux-releasecentos-linux-reposcentos-releasecentos-reposredhat-releaseredhat-release-eularocky-gpg-keysrocky-releaserocky-repos	

 !"#$8.10-13.el88.108.10-13.el88.108.1088.108.10-13.el88.10-13.el88.10-13.el88.10-13.el88.10-13.el88.10-13.el88	
	cloudlinux-releasealmalinux_releasevercloudlinux_releasevercloudlinux_systemidissueissue.netos-releaserpm-gpgRPM-GPG-KEY-AlmaLinuxRPM-GPG-KEY-CloudLinuxredhat-releasemacros.distsystem-releasesystem-release-cpealmalinux-appstream.repoalmalinux-baseos.repoalmalinux-devel.repoalmalinux-extras.repoalmalinux-ha.repoalmalinux-powertools.repoalmalinux-resilientstorage.repocloudlinux-compat.repocloudlinux-imunify360.repocloudlinux-rollout.repocloudlinux.reporhn-update-hook.shos-release85-display-manager.preset90-default.preset99-default-disable.presetcloudlinux-releaseEULAcloudlinux-releaseGPLredhat-releaseredhat-release/etc//etc/dnf/vars//etc/pki//etc/pki/rpm-gpg//etc/rpm//etc/yum.repos.d//opt/cloudlinux/rhn_hooks/post.d//usr/lib//usr/lib/systemd/system-preset//usr/share//usr/share/cloudlinux-release//usr/share/doc//usr/share/doc/cloudlinux-release/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnuASCII textdirectoryBourne-Again shell script, ASCII text executableUTF-8 Unicode textR# Clean dnf cache to force CLN channel metadata update
rm -fr /var/cache/dnf/* || :

# Clean auto-excludes from cldeploy with downgrade, if any
for config_file in '/etc/yum.conf' '/etc/dnf/dnf.conf' ; do
    if [ -f $config_file ] && grep -q 'CloudLinux automatic exclude list' $config_file; then
        # get the recorded list of auto-excludes
        AUTOEXCL=$(sed -n 's/# CloudLinux automatic exclude list: \(.*\)/\1/p' $config_file)
        # escape asterisks so we can properly pass it to sed
        ESCAPED_AUTOEXCL=$(printf '%s' "$AUTOEXCL" | sed 's/\*/\\\*/g')

        # remove the auto-excludes from the exclude list, don't touch anything else
        #�x�������������������X��khy������81������?3�$/����������������?3>3@3�@@@@@@@@@@@@@@@@@@@



@/bin/sh/bin/sh/bin/sh/bin/sh/bin/sh/sbin/nologin/usr/sbin/groupadd/usr/sbin/groupdel/usr/sbin/useradd/usr/sbin/userdelchkconfigconfig(cyrus-sasl)cyrus-sasl-lib(x86-64)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.8)(64bit)libcom_err.so.2()(64bit)libcrypt.so.1()(64bit)libcrypt.so.1(XCRYPT_2.0)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libdb-5.3.so()(64bit)libdl.so.2()(64bit)libgssapi_krb5.so.2()(64bit)libk5crypto.so.3()(64bit)libkrb5.so.3()(64bit)libkrb5.so.3(krb5_3_MIT)(64bit)liblber-2.4.so.2()(64bit)libldap-2.4.so.2()(64bit)libpam.so.0()(64bit)libpam.so.0(LIBPAM_1.0)(64bit)libresolv.so.2()(64bit)libsasl2.so.3()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)systemdsystemdsystemdsystemd2.1.27-6.el8_52.1.27-6.el8_53.0.4-14.6.0-14.0-15.2-12114.14.3/usr/bin/systemd-sysv-convert --save saslauthd >/dev/null 2>&1 || :
/sbin/chkconfig --del saslauthd >/dev/null 2>&1 || :
/bin/systemctl try-restart saslauthd.service >/dev/null 2>&1 || :cyrus-sasl2.1.23-32b8�^�U@^�U@^�U@^�U@]�@]:�[^��[Xf@Z�1@Zz�@Zc/@Y��Y���Yx�@X�Q@X���X��X���X��@X l�V��U���U�a@UhT�U�U�T�	�S�G�S��S���R۾@R��Rs��R].@R-�@R%�@Q��Q�4�Q��Q�a�Q&@Q�@Q�@Q
\�Q
\�P��P��P��@PS@P�@PS�O�@O�	�O|7�Oz�@O2c�O
�N��NBr�N-Z�N�M�)�M��@M�L@M�V�M���M�m�M��Mg��MQ0@K��K��K��@K���K�q�K{�@Kl@J�`@J�_@J�
�J��@J|@Ji�@J@I��I��@I�&@Iy�@H��HǶ�H��Ht�@Hj@H6��H5`@G��G�-@G��@GV��G1��G1��F�E��E݅�E՜�Eu_@E
�D�{�D��@Dq��Di��DP�@C��@C�@C�C���C�q�Cx|@Cu�@Cp�@C!y@C�@CJ@C��C��B]	�B$Y@A�T@A�T@A�%@A��Ab��Ab��A$�@@���@��@�X�@�d@@�c@@V�@@Q�@@L`@@Dw@@,�@@�@@��@��?��?��@?�@?��?��@?��?r�?e��?D�@?D�@?�?�?�@>��@>��@>�F�>�i@>.��>�@=�z@=�=�=��@=�@=��@=sR�=S��=5\@=@=�@=��<��@<�@<��@<i�<f`�<a�<Y1�<W�@<N��;�;�D�;��@;y�;j�@:�_@:h,@:.*@9�n@9��@9�@9ݾ�9�m@9��@9���9��@9x;@9l]�9X�@9N@9?��8���81G@8)^@7�r@7��Simo Sorce <simo@redhat.com> - 2.1.27-6Simo Sorce <simo@redhat.com> - 2.1.27-5Simo Sorce <simo@redhat.com> - 2.1.27-4Simo Sorce <simo@redhat.com> - 2.1.27-3Simo Sorce <simo@redhat.com> - 2.1.27-2Simo Sorce <simo@redhat.com> - 2.1.27-1Simo Sorce <simo@redhat.com> - 2.1.27-0.4rc7Florian Weimer <fweimer@redhat.com> - 2.1.27-0.3rc7Petr Kubat <pkubat@redhat.com> - 2.1.27-0.2rc7Jakub Jelen <jjelen@redhat.com> - 2.1.27-0.1rc7Fedora Release Engineering <releng@fedoraproject.org> - 2.1.26-37Björn Esser <besser82@fedoraproject.org> - 2.1.26-36Jakub Jelen <jjelen@redhat.com> - 2.1.26-35Fedora Release Engineering <releng@fedoraproject.org> - 2.1.26-34Fedora Release Engineering <releng@fedoraproject.org> - 2.1.26-33Jakub Jelen <jjelen@redhat.com> - 2.1.26-32Jakub Jelen <jjelen@redhat.com> - 2.1.26-31Petr Šabata <contyk@redhat.com> - 2.1.26-30Jakub Jelen <jjelen@redhat.com> - 2.1.26-29Fedora Release Engineering <releng@fedoraproject.org> - 2.1.26-28Jakub Jelen <jjelen@redhat.com> - 2.1.26-27Fedora Release Engineering <releng@fedoraproject.org> - 2.1.26-26.2Jakub Jelen <jjelen@redhat.com> 2.1.26-25.2Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.1.26-24Jakub Jelen <jjelen@redhat.com> 2.1.26-23Jakub Jelen <jjelen@redhat.com> 2.1.26-22Jakub Jelen <jjelen@redhat.com> 2.1.26-21Petr Lautrbach <plautrba@redhat.com> 2.1.26-20Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.1.26-19Tom Callaway <spot@fedoraproject.org> - 2.1.26-18Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.1.26-17Ville Skyttä <ville.skytta@iki.fi> - 2.1.26-16Petr Lautrbach <plautrba@redhat.com> 2.1.26-15Petr Lautrbach <plautrba@redhat.com> 2.1.26-14Karsten Hopp <karsten@redhat.com> 2.1.26-13Petr Lautrbach <plautrba@redh�x������x���������X^Zm�����(�������$s�������������������xG9GQzgABPrm6NDd1t9j7w1L7uwBvMB1wgpirRTPVfnUS
Cd+025PEF+wTcBhfnzLtFj5xD7mNsmDmeHkF/sDfNOfAzTE1v2wq0ndYU60xbL6/
yl/Nipyr7WiQjCG0m3WfkjjVDTfs7/DXUqHFDOu4WMF9v+oqwpJXmAeGhQTWZC/Q
hWtrjrNJAgwKpp263gDSdW70ekhRzsok1HJwX1SfxHJYCMFs2aH6ppzNsQARAQAB
tDZNeVNRTCBSZWxlYXNlIEVuZ2luZWVyaW5nIDxteXNxbC1idWlsZEBvc3Mub3Jh
Y2xlLmNvbT6JAlQEEwEIAD4WIQSFm+jXxYb1OEMLGcJGe5QtOnm9KQUCYbi6twIb
AwUJA8JnAAULCQgHAgYVCgkICwIEFgIDAQIeAQIXgAAKCRBGe5QtOnm9KUewD/99
2sS31WLGoUQ6NoL7qOB4CErkqXtMzpJAKKg2jtBGG3rKE1/0VAg1D8AwEK4LcCO4
07wohnH0hNiUbeDck5x20pgS5SplQpuXX1K9vPzHeL/WNTb98S3H2Mzj4o9obED6
Ey52tTupttMF8pC9TJ93LxbJlCHIKKwCA1cXud3GycRN72eqSqZfJGdsaeWLmFmH
f6oee27d8XLoNjbyAxna/4jdWoTqmp8oT3bgv/TBco23NzqUSVPi+7ljS1hHvcJu
oJYqaztGrAEf/lWIGdfl/kLEh8IYx8OBNUojh9mzCDlwbs83CBqoUdlzLNDdwmzu
34Aw7xK14RAVinGFCpo/7EWoX6weyB/zqevUIIE89UABTeFoGih/hx2jdQV/NQNt
hWTW0jH0hmPnajBVAJPYwAuO82rx2pnZCxDATMn0elOkTue3PCmzHBF/GT6c65aQ
C4aojj0+Veh787QllQ9FrWbwnTz+4fNzU/MBZtyLZ4JnsiWUs9eJ2V1g/A+RiIKu
357Qgy1ytLqlgYiWfzHFlYjdtbPYKjDaScnvtY8VO2Rktm7XiV4zKFKiaWp+vuVY
pR0/7Adgnlj5Jt9lQQGOr+Z2VYx8SvBcC+by3XAtYkRHtX5u4MLlVS3gcoWfDiWw
CpvqdK21EsXjQJxRr3dbSn0HaVj4FJZX0QQ7WZm6WLkCDQRhuLq3ARAA6RYjqfC0
YcLGKvHhoBnsX29vy9Wn1y2JYpEnPUIB8X0VOyz5/ALv4Hqtl4THkH+mmMuhtndo
q2BkCCk508jWBvKS1S+Bd2esB45BDDmIhuX3ozu9Xza4i1FsPnLkQ0uMZJv30ls2
pXFmskhYyzmo6aOmH2536LdtPSlXtywfNV1HEr69V/AHbrEzfoQkJ/qvPzELBOjf
jwtDPDePiVgW9LhktzVzn/BjO7XlJxw4PGcxJG6VApsXmM3t2fPN9eIHDUq8ocbH
dJ4en8/bJDXZd9ebQoILUuCg46hE3p6nTXfnPwSRnIRnsgCzeAz4rxDR4/Gv1Xpz
v5wqpL21XQi3nvZKlcv7J1IRVdphK66De9GpVQVTqC102gqJUErdjGmxmyCA1OOO
RqEPfKTrXz5YUGsWwpH+4xCuNQP0qmreRw3ghrH8potIr0iOVXFic5vJfBTgtcuE
B6E6ulAN+3jqBGTaBML0jxgj3Z5VC5HKVbpg2DbB/wMrLwFHNAbzV5hj2Os5Zmva
0ySP1YHB26pAW8dwB38GBaQvfZq3ezM4cRAo/iJ/GsVE98dZEBO+Ml+0KYj+ZG+v
yxzo20sweun7ZKT+9qZM90f6cQ3zqX6IfXZHHmQJBNv73mcZWNhDQOHs4wBoq+FG
QWNqLU9xaZxdXw80r1viDAwOy13EUtcVbTkAEQEAAYkCPAQYAQgAJhYhBIWb6NfF
hvU4QwsZwkZ7lC06eb0pBQJhuLq3AhsMBQkDwmcAAAoJEEZ7lC06eb0pSi8P/iy+
dNnxrtiENn9vkkA7AmZ8RsvPXYVeDCDSsL7UfhbS77r2L1qTa2aB3gAZUDIOXln5
1lSxMeeLtOequLMEV2Xi5km70rdtnja5SmWfc9fyExunXnsOhg6UG872At5CGEZU
0c2Nt/hlGtOR3xbt3O/Uwl+dErQPA4BUbW5K1T7OC6oPvtlKfF4bGZFloHgt2yE9
YSNWZsTPe6XJSapemHZLPOxJLnhs3VBirWE31QS0bRl5AzlO/fg7ia65vQGMOCOT
LpgChTbcZHtozeFqva4IeEgE4xN+6r8WtgSYeGGDRmeMEVjPM9dzQObf+SvGd58u
2z9f2agPK1H32c69RLoA0mHRe7Wkv4izeJUc5tumUY0e8OjdenZZjT3hjLh6tM+m
rp2oWnQIoed4LxUw1dhMOj0rYXv6laLGJ1FsW5eSke7ohBLcfBBTKnMCBohROHy2
E63Wggfsdn3UYzfqZ8cfbXetkXuLS/OM3MXbiNjg+ElYzjgWrkayu7yLakZx+mx6
sHPIJYm2hzkniMG29d5mGl7ZT9emP9b+CfqGUxoXJkjs0gnDl44bwGJ0dmIBu3aj
VAaHODXyY/zdDMGjskfEYbNXCAY2FRZSE58tgTvPKD++Kd2KGplMU2EIFT7JYfKh
HAB5DGMkx92HUMidsTSKHe+QnnnoFmu4gnmDU31i
=Xqbo
-----END PGP PUBLIC KEY BLOCK-----
a���localhostpubkeyMySQL Release Engineering <mysql-build@oss.oracle.com>Public Keys(none)gpg(MySQL Release Engineering <mysql-build@oss.oracle.com>)gpg(3a79bd29)gpg(67dac346)4.14.34:467b942d3a79bd29-61b8bab74:467b942d3a79bd29-61b8bab74:bc02960967dac346-61b8bab7?����1460661dbc4a48b47794881edd35efde541edaa3i0<�i0<� !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJPerl script text executableELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=df0b11694b6112f0aa2badf1260d68219700da8f, not strippedPerl5 module source textawk or perl script, ASCII textPerl POD document, ASCII textASCII textHTML document, ASCII textPerl5 module source, ASCII textAlgol 68 source, ASCII textC source, ASCII textPerl POD document, ASCII text, with very long linesPerl POD document, UTF-8 Unicode textASCII text, with very long linesOS/2 REXX batch file, UTF-8 Unicode textOS/2 REXX batch file, ASCII textPython script, ASCII text executable, with very long linesUTF-8 Unicode textHTML document, U�x��������������v�����XCl�����������!��$1����������������!�"� ��ert IBM-specific Ubuntu-compatibility machine type for 8.6-AV GA [rhel-8.7.0])
- Resolves: bz#2060843
  ([virtual network][vDPA] qemu crash after hot unplug vdpa device [rhel-8.7.0])
- Resolves: bz#2062610
  (Do operation to disk will hang in the guest of target host after hotplugging and migrating [rhel-8.7.0])
- Resolves: bz#2065207
  (Win11 (q35+edk2) guest broke after install wsl2 through 'wsl --install -d Ubuntu-20.04' [rhel-8.7.0])
- Resolves: bz#2062611
  (Guest can not start with SLIC acpi table [rhel-8.7.0])- kvm-block-nbd-Delete-reconnect-delay-timer-when-done.patch [bz#2035185]
- kvm-block-nbd-Assert-there-are-no-timers-when-closed.patch [bz#2035185]
- kvm-iotests.py-Add-QemuStorageDaemon-class.patch [bz#2035185]
- kvm-iotests-281-Test-lingering-timers.patch [bz#2035185]
- kvm-block-nbd-Move-s-ioc-on-AioContext-change.patch [bz#2035185]
- kvm-iotests-281-Let-NBD-connection-yield-in-iothread.patch [bz#2035185]
- Resolves: bz#2035185
  (Qemu core dump when start guest with nbd node or do block jobs to nbd node)- kvm-numa-Enable-numa-for-SGX-EPC-sections.patch [bz#1518984]
- kvm-numa-Support-SGX-numa-in-the-monitor-and-Libvirt-int.patch [bz#1518984]
- kvm-doc-Add-the-SGX-numa-description.patch [bz#1518984]
- kvm-Enable-SGX-RH-Only.patch [bz#1518984]
- kvm-qapi-Cleanup-SGX-related-comments-and-restore-sectio.patch [bz#1518984]
- kvm-block-io-Update-BSC-only-if-want_zero-is-true.patch [bz#2041480]
- kvm-iotests-block-status-cache-New-test.patch [bz#2041480]
- Resolves: bz#1518984
  ([Intel 8.6 Feat] qemu-kvm: SGX 1.5 (SGX1 + Flexible Launch Control) support)
- Resolves: bz#2041480
  ([incremental_backup] Inconsistent block status reply in qemu-nbd)- kvm-virtiofsd-Drop-membership-of-all-supplementary-group.patch [bz#2046198]
- kvm-softmmu-fix-device-deletion-events-with-device-JSON-.patch [bz#2033279]
- kvm-block-backend-prevent-dangling-BDS-pointers-across-a.patch [bz#2021778 bz#2036178]
- kvm-iotests-stream-error-on-reset-New-test.patch [bz#2021778 bz#2036178]
- kvm-block-rbd-fix-handling-of-holes-in-.bdrv_co_block_st.patch [bz#2037135]
- kvm-block-rbd-workaround-for-ceph-issue-53784.patch [bz#2037135]
- Resolves: bz#2046198
  (CVE-2022-0358 virt:av/qemu-kvm: QEMU: virtiofsd: potential privilege escalation via CVE-2018-13405 [rhel-8.6])
- Resolves: bz#2033279
  ([wrb][qemu-kvm 6.2] The hot-unplugged device can not be hot-plugged back)
- Resolves: bz#2021778
  (Qemu core dump when do full backup during system reset)
- Resolves: bz#2036178
  (Qemu core dumped when do block-stream to a snapshot node on non-enough space storage)
- Resolves: bz#2037135
  (Booting from Local Snapshot Core Dumped Whose Backing File Is Based on RBD)- kvm-acpi-validate-hotplug-selector-on-access.patch [bz#2036580]
- kvm-x86-Add-q35-RHEL-8.6.0-machine-type.patch [bz#2031035]
- Resolves: bz#2036580
  (CVE-2021-4158 virt:rhel/qemu-kvm: QEMU: NULL pointer dereference in pci_write() in hw/acpi/pcihp.c [rhel-8])
- Resolves: bz#2031035
  (Add rhel-8.6.0 machine types for RHEL 8.6 [x86])- kvm-hw-arm-virt-Register-iommu-as-a-class-property.patch [bz#2031039]
- kvm-hw-arm-virt-Register-its-as-a-class-property.patch [bz#2031039]
- kvm-hw-arm-virt-Rename-default_bus_bypass_iommu.patch [bz#2031039]
- kvm-hw-arm-virt-Add-8.6-machine-type.patch [bz#2031039]
- kvm-hw-arm-virt-Check-no_tcg_its-and-minor-style-changes.patch [bz#2031039]
- kvm-rhel-machine-types-x86-set-prefer_sockets.patch [bz#2029582]
- Resolves: bz#2031039
  (Add rhel-8.6.0 machine types for RHEL 8.6 [aarch64])
- Resolves: bz#2029582
  ([8.6] machine types: 6.2: Fix prefer_sockets)- kvm-redhat-Add-rhel8.6.0-machine-type-for-s390x.patch [bz#2005325]
- kvm-redhat-Define-pseries-rhel8.6.0-machine-type.patch [bz#2031041]
- Resolves: bz#2005325
  (Fix CPU Model for new IBM Z Hardware - qemu part)
- Resolves: bz#2031041
  (Add rhel-8.6.0 machine types for RHEL 8.6 [ppc64le])- Rebase to qemu-kvm 6.2.0
- Resolves bz#2027716- kvm-e1000-fix-tx-re-entrancy-problem.patch [bz#1930092]
- kvm-hw-scsi-scsi-disk-MODE_PAGE_ALLS-not-allowed-in-MODE.patch [bz#2020720]
- Reso�x�������������Xf�����X�l�T�����h���c��$s����������������c�b�d��_interactive'
- Resolves: rhbz#1237349 - dnf autoremove not removing what dnf list extras shows
- Resolves: rhbz#1470050 - the 'priority=' option in /etc/yum.repos.d/*.repo is not respected
- Resolves: rhbz#1347927 - dnf --cacheonly downloads packages
- Resolves: rhbz#1478115 - [abrt] dnf: _hcmd_undo(): __init__.py:888:_hcmd_undo:IndexError: list index out of range
- Resolves: rhbz#1461171 -  RFE: support --advisory= with install
- Resolves: rhbz#1448874 - "dnf needs-restarting" vanished from bash completion
- Resolves: rhbz#1495116 - Dnf version fails with traceback in container- Fix problem with dnf.Package().remote_location() (RhBug:1476215) (Jaroslav
  Mracek)
- Change behavior of -C according to documentation (RhBug:1473964) (Jaroslav
  Mracek)
- It should prevent to ask attribute of None (RhBug:1359482) (Jaroslav Mracek)
- Solve a problems with --arch options (RhBug:1476834) (Jaroslav Mracek)
- Use security plugin code for dnf-automatic (Jaroslav Mracek)
- Fix unicode error for python2 (Jaroslav Mracek)
- Inform about packages installed for group (Jaroslav Mracek)
- Provide info if pkg is removed due to dependency (RhBug:1244755) (Jaroslav
  Mracek)
- Unify format of %{_mandir} paths in dnf.spec (Jaroslav Mracek)
- Remove test_yumlayer.py as unneeded test (Jaroslav Mracek)
- Provide yum4 package for rhel7 build (Jaroslav Mracek)
- Make yum compatible layer very minimal (RhBug:1476748) (Jaroslav Mracek)
- Remove metadata_expire from yum compatible layer (Jaroslav Mracek)
- Remove keepcache from yum compatibility layer (Jaroslav Mracek)
- Remove options from yum conf (Jaroslav Mracek)
- Remove unused functionality from  yum compatible layer (Jaroslav Mracek)
- Add deplist command for dnf (Jaroslav Mracek)
- Fix problems with --downloaddir options (RhBug:1476464) (Jaroslav Mracek)
- Move description of --forcearch into proper place (Jaroslav Mracek)
- Provide description of --downloaddir option (Jaroslav Mracek)
- Fix if in spec file (Jaroslav Mracek)
- Add description of "test" tsflags (Jaroslav Mracek)
- Enable import gpg_keys with tsflag test (RhBug:1464192) (Jaroslav Mracek)
- Keep old reason when undoing erase (RhBug:1463107) (Eduard Čuba)
- spec: eliminate other weak dependencies for el<=7 (Igor Gnatenko)
- spec: do not strongly require inhibit plugin (Igor Gnatenko)
- Inform that packages are only downloaded (RhBug:1426196) (Jaroslav Mracek)
- Move releasever check after the etc/dnf/vars substitutions. (Alexander
  Kanavin)
- Provide substitution for Repodict.add_new_repo() (RhBug:1457507) (Jaroslav
  Mracek)- Remove autodeglob optimization (Jaroslav Rohel)
- Integrate --destdir with --destdir from download plugin (Ondřej Sojka)
- Add CLI option --destdir (RhBug:1279001) (Ondřej Sojka)
- Add myself to the AUTHORS file (Nathaniel McCallum)
- Add the --forcearch CLI flag (Nathaniel McCallum)
- Add 'ignorearch' option (Nathaniel McCallum)
- Provide an API for setting 'arch' and 'basearch' (Nathaniel McCallum)
- Add nevra forms for repoquery command (Jaroslav Rohel)
- Fix UnicodeDecodeError during checkSig() on non UTF-8 locale (RhBug:1397848)
  (Jaroslav Rohel)
- Add dnf option --noautoremove (RhBug:1361424) (Jaroslav Mracek)
- Add group argument for mark command (Jaroslav Mracek)
- Report problems for each pkg during gpgcheck (RhBug:1387925) (Jaroslav
  Mracek)
- fix minor spelling mistakes (René Genz)
- Print warning when wrong delimiter in cache (RhBug:1332099) (Vítek Hoch)
- Fix the loading of config for dnf-automatic command_email (RhBug:1470116)
  (Jaroslav Rohel)
- Enable download progress bar if redirected output (RhBug:1161950) (Jaroslav
  Mracek)
- Support short abbrevations of commands (RhBug:1320254) (Vítek Hoch)
- Remove unused variables kwargs (Jaroslav Mracek)
- Not reinstall packages if install from repository-pkgs used (Jaroslav Mracek)
- bump dnf version to 2.6.0 (Igor Gnatenko)
- spec: use python2- prefix for hawkey (Igor Gnatenko)
- spec: use sphinx-build binary rather than package name (Igor Gnatenko)
- spec: python-bugzilla is not needed for building (Igor Gn�x��������������U�����X�lp���������(�$3�����������������(�(Rse to favour standalone package- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Specfile autogenerated by cpanspec 1.78.	

��3.153.133.15-396.el83.15-396.el8		

.build-id20ee296cc9a01690c3ff399a1a725fb60f6438a9MIMEBase64.pmQuotedPrint.pmMIMEBase64Base64.soperl-MIME-Base64ChangesREADMEMIME::Base64.3pm.gzMIME::QuotedPrint.3pm.gz/usr/lib//usr/lib/.build-id//usr/lib/.build-id/20//usr/lib64/perl5/vendor_perl//usr/lib64/perl5/vendor_perl/MIME//usr/lib64/perl5/vendor_perl/auto//usr/lib64/perl5/vendor_perl/auto/MIME//usr/lib64/perl5/vendor_perl/auto/MIME/Base64//usr/share/doc//usr/share/doc/perl-MIME-Base64//usr/share/man/man3/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryPerl5 module source textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=20ee296cc9a01690c3ff399a1a725fb60f6438a9, strippedASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)
PRRR	R
PRRR	R
RRRRRRutf-868d71974c6712e77feb339af76cf99941ff2241a5799aec39ad8a20de2610374?���d���`�
	Q�d~���J@�X�Ty�j6�8�Pb�ą�-VI[��0����ǂ�e�Y��9Ī�B	!Ō2UJ�|����m��0pR�V�wd9݌cހ�R㪱S@~�r�4|����R�ʳ�롓��@�_�T&K7&�"�w��1E �Ъ�j�8�SZ�^�ڈT��ҋ��n��b�5Lw&�
����8R<���Ȩ*���ņ��#�)��f����yb,R_`
??&\��-C�%+j��2�sۂo�
I�,�ii-#�����W��4���|�W����gAr	�?_	��7'�S%`�|dc��E-{�:� pf��I��r�n%�s1�øl�!�ڿ�W����BKi�l�c/�r=Ij��OQej� ���7�,sNJ#a��Vh���Y��o��q3�%I��`�
	Q�d~����T�zHv�t�ݟvep��f�7g�hmj0��������<%y]�S���e���
���,����
�5��M�2$��~��0r����[s5E�6
�a���0
�|��T�o�V�f������2W���0�G�โ��w��9E�fB��w�%����-�\ҋ_�I��ؕ�������[
�$���+�./�h�G쉢�b��l���z�:�Q�q4��Ӂ��tƣ�w�L��$Ғ��
�C���7���J�-�=5,)k��x��轫���'Z*m�KS^L�ڦ��ْ�@��͸�d3Ց�&�^�6�2&�8J؞m�
�qo@�X"P���|�YШl]#$yPQGv|��!�.�l�����df��M`�"I�e36250590cab3af1393b20a1ea5b7d1dc94be627ccfe3478917ca2181bd57a9f7f6d5166222b76c48ca1bef5c8911307140e7dc7i/'��i/&�d50-system-google.quirksefc3950-system-dell.quirksc2750-system-cyborg.quirks�c1550-system-chicony.quirks6c0250-system-asus.quirksc/850-system-apple.quirksc.650-system-acer.quirks�<50-pid-max.conf69U950-nss-softokn.conf2e22d
50-local.d �950-libkcapi-optmem_max.confa1?450-edk2-ovmf.json?50-edk2-ovmf-cc.jsonB850-dracut.install?50-depmod.install1f50-default.rules0�e50-default.conf80�750-coredump.conf7PL}�K!A7���6�(��i50and��5.3d77#05.2c4!�7&4f6f79a993ff858ad5b876e121b7cc8b4f5ce5234L�r&4f481f92ce28312904d77d2e6a9d35a633c0a2mf-�9&4f3a4b788b48c25fef6abc850092ad454605c6bc5|4&4f2c0691fbf92c4654bec27d1dd0c8914d81487O2f&4f29c29d2b06fb3b6f5e1d1cde6dc8e41ad076�L&B&4f0a593cfe08283d68aa299889ecd0a789fe72(�y}lu/s4fd�x�������������HE�����X$l������������������$�����������������������ttp://bugs.php.net/70436
-   security bug #72633: Create an Unexpected Object and Don't Invoke __wakeup() in Deserialization (core)
    http://bugs.php.net/72663
-   security bug #72681: PHP Session Data Injection Vulnerability (core)
    http://bugs.php.net/72681
-   security bug #72807: integer overflow in curl_escape caused heap corruption (curl)
    http://bugs.php.net/72807
-   security bug #72838: Integer overflow lead to heap corruption in sql_regcase (ereg)
    http://bugs.php.net/72838
-   security bug #72697: select_colors write out-  of-   bounds (gd)
    http://bugs.php.net/7- 2697
-   security bug #72730: imagegammacorrect allows arbitrary write access (gd)
    http://bugs.php.net/72730
-   security bug #72708: php_snmp_parse_oid integer overflow in memory allocation (snmp)
    http://bugs.php.net/72708
-   security bug #72836: integer overflow in base64_decode caused heap corruption (standard)
    http://bugs.php.net/72836
-   security bug #72848: integer overflow in quoted_printable_encode caused heap corruption (standard)
    http://bugs.php.net/72848
-   security bug #72849: integer overflow in urlencode caused heap corruption (standard)
    http://bugs.php.net/72849
-   security bug #72850: integer overflow in php_uuencode caused heap corruption (standard)
    http://bugs.php.net/72850
-   security bug #72771: ftps:// wrapper is vulnerable to protocol downgrade attack (streams)
    http://bugs.php.net/72771
-   security bug #72749: wddx_deserialize allows illegal memory access (wddx)
    http://bugs.php.net/72749
-   security bug #72750: wddx_deserialize null dereference (wddx)
    http://bugs.php.net/72750
-   security bug #72790: wddx_deserialize null dereference with invalid xml (wddx)
    http://bugs.php.net/72790
-   security bug #72799: wddx_deserialize null dereference in php_wddx_pop_element (wddx)
    http://bugs.php.net/72799
-   CVE-2016-5399: Inadequate error handling in bzread()
    http://bugs.php.net/72613
-   CVE-2016-6288: php_url_parse_ex() buffer overflow read
    http://bugs.php.net/70480
-   CVE-2016-6289: Stack-based buffer overflow vulnerability in virtual_file_ex
    http://bugs.php.net/72513
-   CVE-2016-6290: Use After Free in unserialize() with Unexpected Session Deserialization
    http://bugs.php.net/72562
-   CVE-2016-6291: Out of bound read in exif_process_IFD_in_MAKERNOTE
    http://bugs.php.net/72603
-   CVE-2016-6292: NULL Pointer Dereference in exif_process_user_comment
    http://bugs.php.net/72618
-   CVE-2016-6294: locale_accept_from_http out-of-bounds access
    http://bugs.php.net/72533
-   CVE-2015-8879: PHP segfaults when accessing nvarchar(max) defined columns
    http://bugs.php.net/69975
-   CVE-2016-6295: Use After Free Vulnerability in SNMP with GC and unserialize()
    http://bugs.php.net/72479
-   CVE-2016-6296: heap-buffer-overflow (write) simplestring_addn simplestring.c
    http://bugs.php.net/72606
-   CVE-2016-6297: Stack-based buffer overflow vulnerability in php_stream_zip_opener
    http://bugs.php.net/72520
-   CVE-2016-5766: Integer Overflow in _gd2GetHeader() resulting in heap overflow
    https://bugs.php.net/bug.php?id=72339
-   CVE-2016-5768: _php_mb_regex_ereg_replace_exec - double free
    https://bugs.php.net/bug.php?id=72402
-   CVE-2016-5771: Use After Free Vulnerability in PHP's GC algorithm and unserialize
    https://bugs.php.net/bug.php?id=72433
-   CVE-2016-5772: Double Free Corruption in wddx_deserialize
    https://bugs.php.net/bug.php?id=72340
-   CVE-2016-5773: ZipArchive class Use After Free Vulnerability in PHP's GC algorithm and unserialize
    https://bugs.php.net/bug.php?id=72434
-   CVE-2015-8874: Stack overflow with imagefilltoborder
    https://bugs.php.net/bug.php?id=66387
-   CVE-2016-4343: (phar) uninitialized pointer in phar_make_dirstream()
    https://bugs.php.net/71331
-   CVE-2016-5093: (intl) get_icu_value_internal out-of-bounds read
    https://bugs.php.net/72241
-   CVE-2016-5094: (core) integer overflow in php_html_entities
    https://bugs.php.net/72135
-   CVE-2016-5096: (core) in�x��������������4�����X�l������)L�$9����������������)L(LD7f63c9ca75fa63871d28454f0409e7d26cdb97ef795ea9eiݵL� iݵ1e <cory@cpanel.net> - 5.5.38-13Cory McIntire <cory@cpanel.net> - 5.5.38-12Dmtriy Kasyanov <dkasyanov@cloudlinux.com> - 5.5.38-11.cloudlinux.3Eugene Zamriy <ezamriy@cloudlinux.com> - 5.5.38-11.cloudlinux.2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.5.38-11.cloudlinux.1Dan Muey <dan@cpanel.net> - 5.5.38-11Dan Muey <dan@cpanel.net> - 5.5.38-10Dan Muey <dan@cpanel.net> - 5.5.38-9Dmitriy Kasyanov <dkasyanov@cloudlinux.com> 5.5.38-8.cloudlinux.3Dmitriy Kasyanov <dkasyanov@cloudlinux.com> 5.5.38-8.cloudlinux.2Dmitriy Kasyanov <dkasyanov@cloudlinux.com> 5.5.38-8.cloudlinux.1Dan Muey <dan@cpanel.net> - 5.5.38-8Matt Dees <matt.dees@cpanel.net> 5.5.38-7S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.38-6Edwin Buck <e.buck@cpanel.net> 5.5.38-5Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.5.38-4.cloudlinux.3Dmitriy Kasyanov <dkasyanov@cloudlinux.com> - 5.5.38-4.cloudlinux.2Dmitry Kasyanov <dkasyanov@cloudlinux.com> - 5.5.38-4.cloudlinux.1Anatholy Scryabin <ascryabin@cloudlinux.com> - 5.5.38-4.cloudlinuxJacob Perkins <jacob.perkins@cpanel.net> 5.5.38-4Matt Dees <matt@cpanel.net> - 5.5.38-3S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.38-2Eugene Zamriy <ezamriy@cloudlinux.com> - 5.5.38-1.cloudlinux.1Edwin Buck <e.buck@cpanel.net> - 5.5.38-1Darren Mobley <darren@cpanel.net> - 5.5.37-7Julian Brown <julian.brown@cpanel.net> - 5.5.37-6Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.37-1Dan Muey <dan@cpanel.net> - 5.5.36-5S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.36-4Jacob Perkins <jacob.perkins@cpanel.net> 5.5.36-3Alexey Berezhok <aberezhok@cloudlinux.com> - 1:5.5.36-2.cloudlinux.1Jacob Perkins <jacob.perkins@cpanel.net> 5.5.36-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.36-1Sergey Fokin <sfokin@cloudlinux.com> - 1:5.5.35-1.cloudlinux.1Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.35-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.34-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.34-1Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.33-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.32-3S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.32-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.32-1David Nielson <david.nielson@cpanel.net> - 5.5.31-2Sergey Fokin <sfokin@cloudlinux.com> - 1:5.5.31-1.2.cloudlinux.1Eugene Zamriy <ezamriy@cloudlinux.com> - 1:5.5.31-1.2.cloudlinuxJacob Perkins <jacob.perkins@cpanel.net> - 5.5.31-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.30-7Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.30-6S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.30-5Dan Muey <dan@cpanel.net> - 5.5.30-4S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.30-3Dan Muey <dan@cpanel.net> - 5.5.30-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.30-1Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.29-1Kurt Newman <kurt.newman@cpanel.net> - 5.5.28-1Trinity Quirk <trinity.quirk@cpanel.net> - 5.5.22-6Darren Mobley <darren@cpanel.net> 5.5.22-5Darren Mobley <darren@cpanel.net> 5.5.22-4S. Kurt Newman <kurt.newman@cpanel.net> 5.5.22-3Dan Muey <dan@cpanel.net> 5.5.22-2S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.22-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.22-0Trinity Quirk <trinity.quirk@cpanel.net> - 5.5.6-14Jan Kaluza <jkaluza@redhat.com> - 5.5.6-13Remi Collet <rcollet@redhat.com> - 5.5.6-12Remi Collet <rcollet@redhat.com> - 5.5.6-11Remi Collet <rcollet@redhat.com> - 5.5.6-10Remi Collet <rcollet@redhat.com> - 5.5.6-9Remi Collet <rcollet@redhat.com> - 5.5.6-8Remi Collet <rcollet@redhat.com> - 5.5.6-7Remi Collet <rcollet@redhat.com> - 5.5.6-6Remi Collet <rcollet@redhat.com> - 5.5.6-5Remi Collet <rcollet@redhat.com> - 5.5.6-4Remi Collet <rcollet@redhat.com> 5.5.6-3Remi Collet <rcollet@redhat.com> 5.5.6-2Remi Collet <rcollet@redhat.com> 5.5.6-0Remi Collet <rcollet@redhat.com> 5.5.5-1Remi Collet <rcollet@redhat.com> 5.5.4-1Remi Collet <rcollet@redhat.com> 5.5.3-1Remi Collet <rcollet@redhat.com> 5.5.1-1Remi Collet <rcollet@redhat.com> 5.4.16-6Remi Collet <rcollet@redhat.com> 5.4.16-5Remi�x�������������8$�����X�j 1�������W�����$��������������������PPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZPaPcPPPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZPgPiPPPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZPmPoPPPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZPsPuPPPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZP[P]PPPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZPaPdPPPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZPgPjPPPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZPmPpPPPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZPsPvPPPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZP[P^PPPPPPPPP	P
PPP
PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;P<P=P>P?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZPaPePPPPPP�x�������������������X"m�����k��$�������������������E?�?>$d����0�	4�	q�����������
��	B�X�l�r|�	�
��=
�����T
�
�
(@8Hj9�j:|jG:H:0I:DX:LY:X\:�]:�^;
b;�d<�e<�f<�l<�t=u=v=0�=��=��=��> >4>8>H_>�_
??/�?p?t?|g?�h?�Cea-php74-php-bz27.4.3318.el8.cloudlinux.5A module for PHP applications that interface with .bz2 filesThe php-bz2 package delivers a module which will allow PHP scripts to
interface with .bz2 files.i�xwbuild.cloudlinux.comu�CloudLinuxCloudLinuxPHPCloudLinux Packaging Team <packager@cloudlinux.com>Development/Languageshttp://www.php.net/linuxx86_64/u�A����A�A�i�xi�xi�x9i�x9i�x9b14ce0e0e58c0584530424a436c42138edc772f35ad91fbb1fc7902a67c6a6beee3d87aeb8fb6019aba0c56a717c0096392e09bdf8be1e8f78918b0cd21a4bae../../../../opt/cpanel/ea-php74/root/usr/lib64/php/modules/bz2.sorootrootrootrootrootrootrootrootrootrootea-php74-php-7.4.33-18.el8.cloudlinux.5.src.rpm��������������������config(ea-php74-php-bz2)ea-php74-php-bz2ea-php74-php-bz2(x86-64)@@@@@



@config(ea-php74-php-bz2)ea-php74-php-cli(x86-64)ea-php74-php-common(x86-64)libbz2.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)1:7.4.33-18.el8.cloudlinux.51:7.4.33-18.el8.cloudlinux.51:7.4.33-18.el8.cloudlinux.53.0.4-14.6.0-14.0-15.2-14.14.3i�q@i���i��i�5�i�A@i��@i��@ix��h��h�C�ht�@h4W�h#4@g�g�v@g��@g��@g��@g~h�g�g�@f�X@f�o@f�@f��f_�f:�e�4@ehy@ehy@ed��ej�d�]@du�@db�d,@dJ�c�U@c��@c�G�cs@cc�@c5��b��bX�b\@b�@b[@a�d�a�@a���a�{�a�@@a�@as�@a]��aV�@aM��a'�@a�@`ݮ@`ٹ�`��`�!@`��@`��@`[)�`B@`@�`:4@`8�`�_���_�0@_��_Í@_��@_�F@_��_���_�]@_�"�_���_u�_Wr@_R,@_P�_O�@_+�_*�@_�@_�^��^��^�n@^��@^�x�^�2�^���^��@^�1�^�H�^|�@^f/�^:�@^��Sergey Fokin <sfokin@cloudlinux.com> - 7.4.33-18.cloudlinux.5Razmik Manvelyan <rmanvelyan@cloudlinux.com> - 1:7.4.33-18.cloudlinux.4Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 1:7.4.33-18.cloudlinux.3Levon Matshkalyan <lmatshkalyan@cloudlinux.com> - 1:7.4.33-18.cloudlinux.2Sergey Fokin <sfokin@cloudlinux.com> - 1:7.4.33-18.cloudlinux.1Razmik Manvelyan <rmanvelyan@cloudlinux.com> - 7.4.33-18.cloudlinuxSergey Fokin <sfokin@cloudlinux.com> - 7.4.33-17.cloudlinuxArseniy Zolotarev <azolotarev@cloudlinux.com> - 7.4.33-16.cloudlinux.1Chris Castillo <chris.castillo@webpros.com> - 7.4.33-16Vladimir D. Seleznev <vseleznev@cloudlinux.com> - 7.4.33-15.cloudlinux.1Sergey Fokin <sfokin@cloudlinux.com> - 7.4.33-13.cloudlinux.6Dmitrii Samoilov <dsamoilov@cloudlinux.com> - 7.4.33-13.cloudlinux.5Azat Nurgaliev <anurgaliev@cloudlinux.com> - 7.4.33-13.cloudlinux.4Sergey Fokin <sfokin@cloudlinux.com> - 7.4.33-13.cloudlinux.3Cory McIntire <cory.mcintire@webpros.com> - 7.4.33-15Dan Muey <daniel.muey@webpros.com> - 7.4.33-14Lizi Ekseulidze <lekseulidze@cloudlinux.com> - 7.4.33-13.cloudlinux.2Lizi Ekseulidze <lekseulidze@cloudlinux.com> - 7.4.33-13.cloudlinux.1Dan Mue�x�������������(�����X�l�kh�b��$r����������������b�a�c��ge version to 4.0.version.
- [cache] Clean transaction temp files after successfull transaction
- [log] Log messages from libdnf logger
- [transaction] Add states to report rpm transaction progress
- [transaction] Cache TransactionItem during handling of RPM callback (RhBug:1599597)
- [systemd] dnf-makecache.timer: move to multi-user to fix loop- Bug fix release- Update to 3.0.2-1- Update to 3.0.1-1
- Support of MODULES - new DNF command `module`
- Add attribute dnf.conf.Conf.proxy_auth_method
- New repoquery option `--depends` and `--whatdepends`
- Enhanced support of variables
- Enhanced documentation
- Resolves: rhbz#1565599
- Resolves: rhbz#1508839
- Resolves: rhbz#1506486
- Resolves: rhbz#1506475
- Resolves: rhbz#1505577
- Resolves: rhbz#1505574
- Resolves: rhbz#1505573
- Resolves: rhbz#1480481
- Resolves: rhbz#1496732
- Resolves: rhbz#1497272
- Resolves: rhbz#1488100
- Resolves: rhbz#1488086
- Resolves: rhbz#1488112
- Resolves: rhbz#1488105
- Resolves: rhbz#1488089
- Resolves: rhbz#1488092
- Resolves: rhbz#1486839
- Resolves: rhbz#1486839
- Resolves: rhbz#1486827
- Resolves: rhbz#1486816
- Resolves: rhbz#1565647
- Resolves: rhbz#1583834
- Resolves: rhbz#1576921
- Resolves: rhbz#1270295
- Resolves: rhbz#1361698
- Resolves: rhbz#1369847
- Resolves: rhbz#1368651
- Resolves: rhbz#1563841
- Resolves: rhbz#1387622
- Resolves: rhbz#1575998
- Resolves: rhbz#1577854
- Resolves: rhbz#1387622
- Resolves: rhbz#1542416
- Resolves: rhbz#1542416
- Resolves: rhbz#1496153
- Resolves: rhbz#1568366
- Resolves: rhbz#1539803
- Resolves: rhbz#1552576
- Resolves: rhbz#1545075
- Resolves: rhbz#1544359
- Resolves: rhbz#1547672
- Resolves: rhbz#1537957
- Resolves: rhbz#1542920
- Resolves: rhbz#1507129
- Resolves: rhbz#1512956
- Resolves: rhbz#1512663
- Resolves: rhbz#1247083
- Resolves: rhbz#1247083
- Resolves: rhbz#1247083
- Resolves: rhbz#1519325
- Resolves: rhbz#1492036
- Resolves: rhbz#1391911
- Resolves: rhbz#1391911
- Resolves: rhbz#1479330
- Resolves: rhbz#1505185
- Resolves: rhbz#1305232- Improve performance for excludes and includes handling (RHBZ #1500361)
- Fixed problem of handling checksums for local repositories (RHBZ #1502106)
- Fix traceback when using dnf.Base.close() (RHBZ #1503575)- Update to 2.7.4-1
- Enhanced performance for excludes and includes handling
- Solved memory leaks at time of closing of dnf.Base()
- Resolves: rhbz#1480979 - I thought it abnormal that dnf crashed.
- Resolves: rhbz#1461423 - Memory leak in python-dnf
- Resolves: rhbz#1499564 - dnf list installed crashes
- Resolves: rhbz#1499534 - dnf-2 is much slower than dnf-1 when handling groups
- Resolves: rhbz#1499623 - Mishandling stderr vs stdout (dnf search, dnf repoquery)- Fix URL detection (RHBZ #1472847)
- Do not remove downloaded files with --destdir option (RHBZ #1498426)
- Fix handling of conditional packages in comps (RHBZ #1427144)- Update to 2.7.2-1
- Added new option ``--comment=<comment>`` that adds a comment to transaction in history
- :meth:`dnf.Base.pre_configure_plugin` configure plugins by running their pre_configure() method
- Added pre_configure() methotd for plugins and commands to configure dnf before repos are loaded
- Resolves: rhbz#1421478 - dnf repository-packages: error: unrecognized arguments: -x rust-rpm-macros
- Resolves: rhbz#1491560 - 'dnf check' reports spurious "has missing requires of" errors
- Resolves: rhbz#1465292 - DNF remove protected duplicate package
- Resolves: rhbz#1279001 - [RFE] Missing dnf --downloaddir option
- Resolves: rhbz#1212341 - [RFE] Allow plugins to override the core configuration
- Resolves: rhbz#1299482 - mock --init fails with message "Failed calculating RPMDB checksum"
- Resolves: rhbz#1488398 - dnf upstream tests failures on f26
- Resolves: rhbz#1192811 - dnf whatprovides should show which provides matched a pattern
- Resolves: rhbz#1288845 - "dnf provides" wildcard matching is unreliable (not all packages with matches listed)
- Resolves: rhbz#1473933 - [abrt] dnf-automatic: resolved(): rpm_conf.py:58:resolved:AttributeError: 'Rpmconf' object has no attribute '�x��������������������Xum�������������w�$g����������������w�4?�
�"�-�6�	?�	u������	P\c(�X�Y�
�,h0mI0EXwatywEEANL8zal7BoTMc2Aq7BeRy4nJtAGSACrbb+gkhTxl63TDDHGdFEBw
8vnKWHtRxHaozyn5GifpRly1/j1mK5g0sEsC1Kdg626dKmazbDuE8SSKCm3tMtfu
509IRhaOJKNrjGKyCc3U08Lm2DGKfCXHUkewp6QnQLwq1x6atW1nZpE/ABEBAAG0
MFdvcmRQcmVzcyBUb29sa2l0IGZvciBjUGFuZWwgPHN1cHBvcnRAcGxlc2suY29t
PojOBBMBCAA4FiEE8y5Xzo8i0m0IZOPBujOKptkXD4AFAl8GrcsCGy8FCwkIBwIG
FQgJCgsCBBYCAwECHgECF4AACgkQujOKptkXD4APcAQA0jOcQkEp2sm0tqP0fUT9
P2WdaSsPPFIxdFAcA6fgI+xOup3yVSR47TX22c3ZpitHmrvUGLBj+cakBIuJUjXL
SgQeZMls92dyWRtBwP7qmU/M73YLpdolHYVBzeKA/WxM9mCV2moSZcYIoViUTUdl
obZu/boCCGKag2QU69odbkg=
gpg-pubkeyd9170f805f06adcbgpg(WordPress Toolkit for cPanel <support@plesk.com>)-----BEGIN PGP PUBLIC KEY BLOCK-----
Version: rpm-4.14.3 (NSS-3)

mI0EXwatywEEANL8zal7BoTMc2Aq7BeRy4nJtAGSACrbb+gkhTxl63TDDHGdFEBw
8vnKWHtRxHaozyn5GifpRly1/j1mK5g0sEsC1Kdg626dKmazbDuE8SSKCm3tMtfu
509IRhaOJKNrjGKyCc3U08Lm2DGKfCXHUkewp6QnQLwq1x6atW1nZpE/ABEBAAG0
MFdvcmRQcmVzcyBUb29sa2l0IGZvciBjUGFuZWwgPHN1cHBvcnRAcGxlc2suY29t
PojOBBMBCAA4FiEE8y5Xzo8i0m0IZOPBujOKptkXD4AFAl8GrcsCGy8FCwkIBwIG
FQgJCgsCBBYCAwECHgECF4AACgkQujOKptkXD4APcAQA0jOcQkEp2sm0tqP0fUT9
P2WdaSsPPFIxdFAcA6fgI+xOup3yVSR47TX22c3ZpitHmrvUGLBj+cakBIuJUjXL
SgQeZMls92dyWRtBwP7qmU/M73YLpdolHYVBzeKA/WxM9mCV2moSZcYIoViUTUdl
obZu/boCCGKag2QU69odbkg=
=EwtP
-----END PGP PUBLIC KEY BLOCK-----
_��localhostpubkeyWordPress Toolkit for cPanel <support@plesk.com>Public Keys(none)gpg(WordPress Toolkit for cPanel <support@plesk.com>)gpg(d9170f80)4.14.34:ba338aa6d9170f80-5f06adcb4:ba338aa6d9170f80-5f06adcb?����005f4ff7b79d77a19cc9a2158ef1bb6a5c9eb4f2icic�x������������X��l����������4��$$����������������4�5�3��tref_math2.pngaltref_math3.pngaltref_math4.pngaltref_math5.pngaltref_math6.pngaltref_math7.pngaltref_math8.pngaltref_math9.pngaltref_table1.pngcfl_appendix_fig1.pngcfl_appendix_math1.pngcfl_appendix_math10.pngcfl_appendix_math11.pngcfl_appendix_math2.pngcfl_appendix_math3.pngcfl_appendix_math4.pngcfl_appendix_math5.pngcfl_appendix_math6.pngcfl_appendix_math7.pngcfl_appendix_math8.pngcfl_appendix_math9.pngcfl_appendix_table3.pngcomp_mode_pred_fig1.pngcomp_mode_pred_fig10.pngcomp_mode_pred_fig11.pngcomp_mode_pred_fig12.pngcomp_mode_pred_fig13.pngcomp_mode_pred_fig2.pngcomp_mode_pred_fig3.pngcomp_mode_pred_fig4.pngcomp_mode_pred_fig5.pngcomp_mode_pred_fig6.pngcomp_mode_pred_fig7.pngcomp_mode_pred_fig8.pngcomp_mode_pred_fig9.pngcomp_mode_pred_table1.pngcomp_mode_pred_table2.pngcomp_mode_pred_table3.pngcomp_mode_pred_table4.pngcsifsa_fig1.pngcsifsa_fig2.pngcsifsa_fig3.pngcsifsa_fig4.pngcsifsa_table6.pngdecoder_5_threads.pngdecoder_LF_horz.pngdecoder_LF_vert.pngdecoder_Nbr.pngdecoder_NbrOffset.pngdecoder_TileRowMT.pngdecoder_cdef_filter.pngdecoder_cdef_stage.pngdecoder_flow.pngdecoder_loop_filter_stage.pngdecoder_loop_restoration_stage.pngdecoder_main_thread.pngdecoder_parse_stage.pngdecoder_reconstruction_stage.pngdecoder_tile_parallel_l_gt_t.pngdecoder_tile_parallel_l_lt_t.pngdecoder_worker_thread.pngdesktop.inidlf_fig1.pngdlf_fig2.pngdlf_fig3.pngdlf_fig4.pngdlf_table5.pngfilm_grain_fig1.pngfilm_grain_fig2.pngfilm_grain_fig3.pngfilter_intra_fig0.pngfilter_intra_fig1.pngfilter_intra_fig2.pngfilter_intra_fig3.pngfilter_intra_fig4.pngfilter_intra_table-2.pnggm_fig1.pnggm_fig2.pnggm_fig3.pnggm_math1.pnggm_math2.pnggm_math3.pnggm_math4.pnggm_math5.pnggm_math6.pngimage1.pngimage10.pngimage11.pngimage12.pngimage13.pngimage14.pngimage15.pngimage16.pngimage17.pngimage18.pngimage19.pngimage2.pngimage20.pngimage21.pngimage22.pngimage23.pngimage24.pngimage25.pngimage26.pngimage27.pngimage28.pngimage29.pngimage3.pngimage4.pngimage5.pngimage6.pngimage7.pngimage8.pngimage9.pngintra_block_copy_fig1.pngintra_block_copy_fig2.pngl_arrow.pnglocal_warped_motion_fig1.pnglocal_warped_motion_fig2.pnglocal_warped_motion_fig3.pnglocal_warped_motion_fig4.pnglocal_warped_motion_fig5.pnglocal_warped_motion_fig6.pnglocal_warped_motion_math1.pnglocal_warped_motion_math10.pnglocal_warped_motion_math11.pnglocal_warped_motion_math12.pnglocal_warped_motion_math13.pnglocal_warped_motion_math14.pnglocal_warped_motion_math15.pnglocal_warped_motion_math16.pnglocal_warped_motion_math17.pnglocal_warped_motion_math18.pnglocal_warped_motion_math19.pnglocal_warped_motion_math2.pnglocal_warped_motion_math20.pnglocal_warped_motion_math21.pnglocal_warped_motion_math22.pnglocal_warped_motion_math23.pnglocal_warped_motion_math24.pnglocal_warped_motion_math25.pnglocal_warped_motion_math26.pnglocal_warped_motion_math27.pnglocal_warped_motion_math28.pnglocal_warped_motion_math29.pnglocal_warped_motion_math3.pnglocal_warped_motion_math30.pnglocal_warped_motion_math31.pnglocal_warped_motion_math32.pnglocal_warped_motion_math33.pnglocal_warped_motion_math4.pnglocal_warped_motion_math5.pnglocal_warped_motion_math6.pnglocal_warped_motion_math7.pnglocal_warped_motion_math8.pnglocal_warped_motion_math9.pnglocal_warped_motion_table3.pngmath1.pngmath10.pngmath11.pngmath12.pngmath13.pngmath14.pngmath15.pngmath16.pngmath17.pngmath18.pngmath19.pngmath2.pngmath20.pngmath21.pngmath22.pngmath23.pngmath24.pngmath3.pngmath4.pngmath5.pngmath6.pngmath7.pngmath8.pngmath9.pngnsq_fig1.pngobmc_fig1.pngobmc_fig2.pngobmc_fig3.pngobmc_fig4.pngobmc_fig5.pngpalette_prediction_fig1.pngpalette_prediction_fig2.pngpalette_prediction_table4.pngr_arrow.pngrestoration_filter_fig1.pngrestoration_filter_fig2.pngrestoration_filter_math1.pngrestoration_filter_math10.pngrestoration_filter_math11.pngrestoration_filter_math12.pngrestoration_filter_math13.pngrestoration_filter_math14.pngrestoratio�x��������������������X
�l��������������2��$"����������������2�3�1�� dynamically linked, BuildID[sha1]=7a46d6cf59d34293d06439c6e6f7b1960ac38ba5, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f160c524839fc83167bd262d1d4a1b6356e1d2ba, strippedASCII textASCII text, with very long linesAlgol 68 source, UTF-8 Unicode text, with very long linesUTF-8 Unicode text, with very long linesexported SGML document, UTF-8 Unicode text, with very long linesexported SGML document, ASCII text, with very long linesPNG image data, 702 x 237, 8-bit/color RGB, non-interlacedPNG image data, 824 x 197, 8-bit/color RGB, non-interlacedPNG image data, 352 x 164, 8-bit/color RGB, non-interlacedPNG image data, 91 x 347, 8-bit/color RGBA, non-interlacedPNG image data, 808 x 47, 8-bit/color RGBA, non-interlacedPNG image data, 354 x 162, 8-bit/color RGB, non-interlacedPNG image data, 935 x 216, 8-bit colormap, non-interlacedPNG image data, 823 x 255, 8-bit colormap, non-interlacedPNG image data, 800 x 400, 8-bit/color RGB, non-interlacedPNG image data, 626 x 171, 8-bit colormap, non-interlacedPNG image data, 661 x 696, 8-bit/color RGB, non-interlacedPNG image data, 354 x 23, 4-bit colormap, non-interlacedPNG image data, 268 x 25, 4-bit colormap, non-interlacedPNG image data, 368 x 64, 8-bit colormap, non-interlacedPNG image data, 57 x 18, 4-bit colormap, non-interlacedPNG image data, 39 x 14, 8-bit gray+alpha, non-interlacedPNG image data, 422 x 54, 4-bit colormap, non-interlacedPNG image data, 47 x 14, 8-bit gray+alpha, non-interlacedPNG image data, 113 x 20, 4-bit colormap, non-interlacedPNG image data, 504 x 25, 4-bit colormap, non-interlacedPNG image data, 263 x 17, 4-bit colormap, non-interlacedPNG image data, 456 x 85, 8-bit colormap, non-interlacedPNG image data, 19 x 15, 8-bit gray+alpha, non-interlacedPNG image data, 20 x 18, 8-bit gray+alpha, non-interlacedPNG image data, 33 x 16, 8-bit gray+alpha, non-interlacedPNG image data, 227 x 20, 4-bit colormap, non-interlacedPNG image data, 170 x 28, 4-bit colormap, non-interlacedPNG image data, 980 x 523, 8-bit colormap, non-interlacedPNG image data, 1274 x 422, 8-bit colormap, non-interlacedPNG image data, 262 x 20, 4-bit colormap, non-interlacedPNG image data, 79 x 15, 4-bit colormap, non-interlacedPNG image data, 375 x 19, 4-bit colormap, non-interlacedPNG image data, 94 x 19, 4-bit colormap, non-interlacedPNG image data, 81 x 15, 4-bit colormap, non-interlacedPNG image data, 11 x 8, 8-bit gray+alpha, non-interlacedPNG image data, 11 x 16, 8-bit gray+alpha, non-interlacedPNG image data, 103 x 15, 4-bit colormap, non-interlacedPNG image data, 107 x 15, 4-bit colormap, non-interlacedPNG image data, 32 x 11, 8-bit gray+alpha, non-interlacedPNG image data, 32 x 16, 8-bit gray+alpha, non-interlacedPNG image data, 888 x 407, 8-bit colormap, non-interlacedPNG image data, 615 x 485, 8-bit/color RGBA, non-interlacedPNG image data, 808 x 95, 8-bit colormap, non-interlacedPNG image data, 1170 x 585, 8-bit colormap, non-interlacedPNG image data, 788 x 145, 8-bit colormap, non-interlacedPNG image data, 869 x 119, 8-bit colormap, non-interlacedPNG image data, 559 x 285, 8-bit gray+alpha, non-interlacedPNG image data, 793 x 375, 8-bit colormap, non-interlacedPNG image data, 710 x 535, 8-bit/color RGB, non-interlacedPNG image data, 1211 x 775, 8-bit colormap, non-interlacedPNG image data, 1294 x 179, 8-bit colormap, non-interlacedPNG image data, 1474 x 281, 8-bit colormap, non-interlacedPNG image data, 1123 x 203, 8-bit colormap, non-interlacedPNG image data, 1018 x 295, 8-bit colormap, non-interlacedPNG image data, 761 x 140, 8-bit colormap, non-interlacedPNG image data, 834 x 161, 8-bit colormap, non-interlacedPNG image data, 720 x 74, 8-bit colormap, non-interlacedPNG image data, 1321 x 457, 8-bit colormap, non-interlacedPNG image data, 1579 x 446, 8-bit colormap, non-interlacedPNG image data, 299 x 130, 8-bit colormap, non-interlacedPNG image data, 443 x 258, 8-bit colormap, non-interlacedPNG image data, 1520 x 1189, 8-bit colormap�x��������������������X#m!@�������$
��������������������y <daniel.muey@webpros.com> - 7.4.33-13Vladimir D. Seleznev <vseleznev@cloudlinux.com> - 7.4.33-12.cloudlinux.1Julian Brown <julian.brown@cpanel.net> - 7.4.33-12Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 7.4.33-11.cloudlinux.1Dan Muey <dan@cpanel.net> - 7.4.33-11Julian Brown <julian.brown@cpanel.net> - 7.4.33-10Vladimir D. Seleznev <vseleznev@cloudlinux.com> - 7.4.33-9.cloudlinux.3Sergey Fokin <sfokin@cloudlinux.com> - 1:7.4.33-9.cloudlinux.2Dmitriy Popov <dpopov@cloudlinux.com> - 7.4.33-9.cloudlinux.1Travis Holloway <t.holloway@cpanel.net> - 7.4.33-9Dmitriy Popov <dpopov@cloudlinux.com> - 7.4.33-8.cloudlinux.1Tim Mullin <tim@cpanel.net> - 7.4.33-8Dan Muey <dan@cpanel.net> - 7.4.33-7Dmitriy Popov <dpopov@cloudlinux.com> - 7.4.33-6.cloudlinux.2Nikita Ivanov <nivanov@cloudlinux.com> - 7.4.33-6.cloudlinux.1Travis Holloway <t.holloway@cpanel.net> - 7.4.33-6Julian Brown <julian.brown@cpanel.net> - 7.4.33-5Julian Brown <julian.brown@cpanel.net> - 7.4.33-4Nikita Ivanov <nivanov@cloudlinux.com> - 7.4.33-3.cloudlinux.2Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 7.4.33-3.cloudlinux.1Tim Mullin <tim@cpanel.net> - 7.4.33-3Pavel Mayorov <pmayorov@cloudlinux.com> - 7.4.33-2.cloudlinux.1Travis Holloway <t.holloway@cpanel.net> - 7.4.33-2Cory McIntire <cory@cpanel.net> - 7.4.33-1Cory McIntire <cory@cpanel.net> - 7.4.32-1Cory McIntire <cory@cpanel.net> - 7.4.30-1Cory McIntire <cory@cpanel.net> - 7.4.29-1Travis Holloway <t.holloway@cpanel.net> - 7.4.28-2Cory McIntire <cory@cpanel.net> - 7.4.28-1Tim Mullin <tim@cpanel.net> - 7.4.27-5Julian Brown <julian.brown@cpanel.net> - 7.4.27-4Julian Brown <julian.brown@cpanel.net> - 7.4.27-3Julian Brown <julian.brown@cpanel.net> - 7.4.27-2Cory McIntire <cory@cpanel.net> - 7.4.27-1Cory McIntire <cory@cpanel.net> - 7.4.26-1Dan Muey <dan@cpanel.net> - 7.4.25-2Cory McIntire <cory@cpanel.net> - 7.4.25-1Julian Brown <julian.brown@cpanel.net> - 7.4.24-23Cory McIntire <cory@cpanel.net> - 7.4.24-2Cory McIntire <cory@cpanel.net> - 7.4.24-1Travis Holloway <t.holloway@cpanel.net> - 7.4.23-1Cory McIntire <cory@cpanel.net> - 7.4.22-1Cory McIntire <cory@cpanel.net> - 7.4.21-1Travis Holloway <t.holloway@cpanel.net> - 7.4.20-2Cory McIntire <cory@cpanel.net> - 7.4.20-1Ivan Danilov <idanilov@cloudlinux.com> - 7.4.19-1.cloudlinux.2Cory McIntire <cory@cpanel.net> - 7.4.19-1Cory McIntire <cory@cpanel.net> - 7.4.18-1Anatholy Scryabin <ascryabin@cloudlinux.com> - 7.4.16-2.cloudlinux.1Cory McIntire <cory@cpanel.net> - 7.4.16-2Cory McIntire <cory@cpanel.net> - 7.4.16-1Eduard Abdullin <eabdullin@cloudlinux.com> - 7.4.15-1.cloudlinux.2Ivan Danilov <idanilov@cloudlinux.com> - 7.4.15-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 7.4.15-1Cory McIntire <cory@cpanel.net> - 7.4.14-1Julian Brown <julian.brown@cpanel.net> - 7.4.13-2Eduard Abdullin <eabdullin@cloudlinux.con> - 7.4.13-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 7.4.13-1Tim Mullin <tim@cpanel.net> - 7.4.12-2Cory McIntire <cory@cpanel.net> - 7.4.12-1Ivan Danilov <idanilov@cloudlinux.com> - 7.4.11-2.cloudlinux.2Daniel Muey <dan@cpanel.net> - 7.4.11-4Tim Mullin <tim@cpanel.net> - 7.4.11-3Daniel Muey <dan@cpanel.net> - 7.4.11-2Ivan Danilov <idanilov@cloudlinux.com> - 7.4.10-2.cloudlinux.3Cory McIntire <cory@cpanel.net> - 7.4.11-1Ivan Danilov <idanilov@cloudlinux.com> - 7.4.10-2.cloudlinux.2Tim Mullin <tim@cpanel.net> - 7.4.10-2Cory McIntire <cory@cpanel.net> - 7.4.10-1Ivan Danilov <idanilov@cloudlinux.com> - 7.4.9-1.cloudlinux.2Cory McIntire <cory@cpanel.net> - 7.4.9-1Darya Malyavkina <dmalyavkina@cloudlinux.com> - 7.4.8-2.cloudlinux.1Tim Mullin <tim@cpanel.net> - 7.4.8-2Cory McIntire <cory@cpanel.net> - 7.4.8-1Julian Brown <julian.brown@cpanel.net> - 7.4.7-2Darya Malyavkina <dmalyavkina@cloudlinux.com> - 7.4.7-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 7.4.7-1Tim Mullin <tim@cpanel.net> - 7.4.6-3Tim Mullin <tim@cpanel.net> - 7.4.6-2Cory McIntire <cory@cpanel.net> - 7.4.6-1Anatholy Scryabin <ascryabin@cloudlinux.com> - 7.4.5-2.cloudlinuxDaniel Muey <dan@c�x������P������0������XOl�������0�������$��������������������.patch [bz#1817621]
- kvm-backup-don-t-acquire-aio_context-in-backup_clean.patch [bz#1817621]
- kvm-block-backend-Reorder-flush-pdiscard-function-defini.patch [bz#1817621]
- kvm-block-Increase-BB.in_flight-for-coroutine-and-sync-i.patch [bz#1817621]
- kvm-block-Fix-blk-in_flight-during-blk_wait_while_draine.patch [bz#1817621]
- Resolves: bz#1817621
  (Crash and deadlock with block jobs when using io-threads)- kvm-block-pass-BlockDriver-reference-to-the-.bdrv_co_cre.patch [bz#1816007]
- kvm-block-trickle-down-the-fallback-image-creation-funct.patch [bz#1816007]
- kvm-Revert-mirror-Don-t-let-an-operation-wait-for-itself.patch [bz#1794692]
- kvm-mirror-Wait-only-for-in-flight-operations.patch [bz#1794692]
- Resolves: bz#1794692
  (Mirror block job stops making progress)
- Resolves: bz#1816007
  (qemu-img convert failed to convert with block device as target)- kvm-migration-Rate-limit-inside-host-pages.patch [bz#1814336]
- kvm-build-sys-do-not-make-qemu-ga-link-with-pixman.patch [bz#1811670]
- Resolves: bz#1811670
  (Unneeded qemu-guest-agent dependency on pixman)
- Resolves: bz#1814336
  ([POWER9] QEMU migration-test triggers a kernel warning)- kvm-block-nbd-Fix-hang-in-.bdrv_close.patch [bz#1640894]
- kvm-block-Generic-file-creation-fallback.patch [bz#1640894]
- kvm-file-posix-Drop-hdev_co_create_opts.patch [bz#1640894]
- kvm-iscsi-Drop-iscsi_co_create_opts.patch [bz#1640894]
- kvm-iotests-Add-test-for-image-creation-fallback.patch [bz#1640894]
- kvm-block-Fix-leak-in-bdrv_create_file_fallback.patch [bz#1640894]
- kvm-iotests-Use-complete_and_wait-in-155.patch [bz#1790482 bz#1805143]
- kvm-block-Introduce-bdrv_reopen_commit_post-step.patch [bz#1790482 bz#1805143]
- kvm-block-qcow2-Move-bitmap-reopen-into-bdrv_reopen_comm.patch [bz#1790482 bz#1805143]
- kvm-iotests-Refactor-blockdev-reopen-test-for-iothreads.patch [bz#1790482 bz#1805143]
- kvm-block-bdrv_reopen-with-backing-file-in-different-Aio.patch [bz#1790482 bz#1805143]
- kvm-block-Versioned-x-blockdev-reopen-API-with-feature-f.patch [bz#1790482 bz#1805143]
- kvm-block-Make-bdrv_get_cumulative_perm-public.patch [bz#1790482 bz#1805143]
- kvm-block-Relax-restrictions-for-blockdev-snapshot.patch [bz#1790482 bz#1805143]
- kvm-iotests-Fix-run_job-with-use_log-False.patch [bz#1790482 bz#1805143]
- kvm-iotests-Test-mirror-with-temporarily-disabled-target.patch [bz#1790482 bz#1805143]
- kvm-block-Fix-cross-AioContext-blockdev-snapshot.patch [bz#1790482 bz#1805143]
- kvm-iotests-Add-iothread-cases-to-155.patch [bz#1790482 bz#1805143]
- kvm-qapi-Add-allow-write-only-overlay-feature-for-blockd.patch [bz#1790482 bz#1805143]
- kvm-exec-rom_reset-Free-rom-data-during-inmigrate-skip.patch [bz#1809380]
- Resolves: bz#1640894
  (Fix generic file creation fallback for qemu-img nvme:// image creation support)
- Resolves: bz#1790482
  (bitmaps in backing images can't be modified)
- Resolves: bz#1805143
  (allow late/lazy opening of backing chain for shallow blockdev-mirror)
- Resolves: bz#1809380
  (guest hang during reboot process after migration from RHEl7.8 to RHEL8.2.0.)- kvm-hw-smbios-set-new-default-SMBIOS-fields-for-Windows-.patch [bz#1782529]
- kvm-migration-multifd-clean-pages-after-filling-packet.patch [bz#1738451]
- kvm-migration-Make-sure-that-we-don-t-call-write-in-case.patch [bz#1738451]
- kvm-migration-multifd-fix-nullptr-access-in-terminating-.patch [bz#1738451]
- kvm-migration-multifd-fix-destroyed-mutex-access-in-term.patch [bz#1738451]
- kvm-multifd-Make-sure-that-we-don-t-do-any-IO-after-an-e.patch [bz#1738451]
- kvm-qemu-file-Don-t-do-IO-after-shutdown.patch [bz#1738451]
- kvm-migration-Don-t-send-data-if-we-have-stopped.patch [bz#1738451]
- kvm-migration-Create-migration_is_running.patch [bz#1738451]
- kvm-migration-multifd-fix-nullptr-access-in-multifd_send.patch [bz#1738451]
- kvm-migration-Maybe-VM-is-paused-when-migration-is-cance.patch [bz#1738451]
- kvm-virtiofsd-Remove-fuse_req_getgroups.patch [bz#1797064]
- kvm-virtiofsd-fv_create_listen_socket-error-path-socket-.patch [bz#1797064]
- kvm-virtiofsd-load_capng-missing-unlock.patch �x�������������������X
m�������������&�$
�����������������&�'�&�5b8ad799172fe15e0215d4279c983557c95a1dfde8e2cd9e44c34e3b26130aa893132c74a4790466075ee2ff9101c27246c372a688aab74e31b53e32507c1377fa06feae0e86de7f871816bb2440649e5a863cc0b0578c815d79ba06ac284ac9fe724a0052993809e527fe011ace01a37b9cdcef0688ef48c688b85c1c2eda2083967f3552116c879bb25b4150441d3b66a54333d1ee1e963f8f92b29e07b53d94d9de916365d81dd48988dd1110e6691b0355b89395ac9addcc74924940b1c6c080925fc414b0c908ddf15bb2d1c37beb29d470e7ecdf5a34adda2aa17b21e94b3ce75b73fcc40afc4f47865a7a50d8a28eb6437ff2635ba9df5118c393cb43c699d5a9bfced88f47542e3f2c2e783a0e221570ee01ac37fb99a856a8f47118aeca70be988ebe4841b60c4c4dfdcac508cf9b3790a3a887f33159ace3d95eb34dbf71c2a7c0ac98db668317b4243cb3e5a8c3306e867a613bfc4dea9c72fb14ea803930c2e178cfbcdcf9466aa8de09f8932e20b4d3259b17f073cdb7b626db1bb10abf46347f963d171dd0c4f2ee582247af262b9af7548e0b8d0e621f5ceb9100441bf8c46b161077c6f105a12f615ffe68fef4800597ae9c45a58a42f127b7138b3328ed942b6c6353b5e17978bead181fd6c782b828c0cbdaea68dbff9d84403363a91af075e519fef85b6a3043051ad898c7e7d4b189b9b9478610f9bf69e31553db11ee7512d12044beed4d6f81d8b20c60a983b8ad95b24e1664d4d935c3a71b8d2cafc8848b4d25095d460c79af70965d2ef5a0a560700b7b2c026b5bb044a83ffcd884698f7105fb6dd2abf4c45aaaa95daf5422ecba85b79150b557da72435c6e1fa9aed89e45a537175cb9490aa413da09e86ad641d9a927f9b47377760a8b72b2a10ddbfe8d5648f55f3529875016f527c7d21c7ad4a64731e5637bb002dfb6f05b564f93779aedeb7cbea81e8212b3a5cab48218830bf26bbfbffb977fc8ef17bba44c9baaafb8b28a5d78720327ad1373eecd09dc5e2402aad4899bbefafa75a910b34b4a257d1f0e109ef3cd37c46448da10e5a7647a0a8914b6bf2ca571f6ffb23f49173d6d7a52fb35a5335023a4d0e6225474fd71aa10e0af80a6eff24ed831e60e9082f726d6f9aa4fc50eb424c440c22863395f7039d47e46600793ab8b4556bfa308f53ca1c614674a4e2adb11ad6ada624af36b3d4de4b0178fe110dfd7e2ad6d78aebd976bf33e0dec7987613c8597da35525030a5a73f6a50d31f7e0b6980aedbc404e01515f63812343eeb2716b78a52bfc4987f245ebdfedfa659c8dd82e7a91e24ac4fbd8dd28cdc40c85ebe5744f843734bcd25cf6b8ec614558d83e004fd4dec67cf0a42a1005f72ff36ab266b2d325b63db15893fed7b5a99a2ccdba4fe824b3caa2abab55653ee7ef7cfb0efedb83ce9b1d943076301f628477d39504210cea8d317140c3a5b5ef6008327e17f6a58e7282f53abba0d2a9bac2c37268c0aa06dc514fd4aa2cdf33a2af4ee6ae90bff4da2cf5f6d533353d403cd792327673a386e3ebfd8f3b57bca5b59f1ac680d4379dc4c47b517eff71b2aa001b81a7e0ecc4dfad69575e9633d099d3dfd36a6ba4824fb6273715285a7479d9be40b390710582548622cde2007f03068789b443c62cdccea88c5e74f32742e43bee2d65e8d8f38e453dd5e9be9b97ae8e8588605cdbd7d17f2ac2c01c3fd1c669430f2451d32b95da1921463e7cc2c3e77fd1a5e60570ce352b406e8b43065ff0d60fd5b5a38be4a8d2d9d96a4ccff61175c0a18ea5d3831c2f22c624c9e8fb8182066dbbc2e79f97afb1ad8d4600bcc8afe86ad51124907b566e09d82e9ea614d21c833bfc22fc237106962c625ae0c81598d01dd8165c893780bdd999fb9c75c0f9d0fd484c790e7440b985288046f09433436f139dc10ba609cf85d09569851064e97f92966af75516e15bc8def91a22c60c8d5a51540b69cb8811d8f124905211b87e5fa14f2f51c091732b16b805d5c9164468e1efcfe5ed349b2b189b40a8c93d5f0eccf9e09e4d341b91115499c00ef079abc34d27222d3639c0d12b30ba647745169e5ea400e3b842d1837d32df562b2be7620b8860cd72708d77a781a5c95973c6c692c8cd7d7ee163745f6e3b557772c0202a62fde86f34e885b133c2919aaa7dd825046eef31173922ff5cd0b913130baf30fe66339c0ee3767ce3af49c19dfc1dbb6d767a616f7f7b3d685c1873a5b895316eea750318a5abcaa90a582443c0c54253c387f30b4bae52008a77a9b2f512b5a6923e69bb0c6c919c6343e78e5fe5fa7546798ab0b8e94385f66a125577d5338166f2f6f22094f77d77945d3753368c7f91fec5a5595f2bfdb6e76027f144121baf8720a9f9f3aa3b1562d1b5e6d1b01f78ddb7983fea9eafdea2c10df45adb7ae538dd9bdf39790262cecc8710be69463db0ee739f35e57da12ebaf9ed4043d938e6f242bbcc135c234d1aed496c3df20de9f8ce3a9f78b04b1a0e2a17a732be1aa7798a221cda181�x������������� ������X�kl�������������������$-��������������������f425c2388f18e5168c44a4b24b24dc082a0f880e6110d22d2757a51c89f571c3fa3088e3f009751d9b6fffb9b326c3c76f3dfd49d62d91af7a55637aa5d93e0b3c823b5fef09159dd68ec5a52574dc03cb64e1d7453c045ae9b8bd438819798ffab3891e8c61a2f9b64d01e643d997c83d04b561b9c417d6152d8ba3ed0b38d4669de347d9a4350f75f9dc2f40a4617a49cc604a18b4254f814a3d99710601a94b32b535a60a902b0a8cfd71832cd88bc473853c63bb65ff12d735400e08aa8f2391fd4163b38e57457ec0e64c55a42b4062493209d21a79a05ca917abc271b22eece4a2b47c363e4fb94cf9d7bc30df973e7efaf031ebf5d2574493de40168735132cf6fba3e377750fec8a776791909aca5348b798c56b39cbcf8c8aa41f7b54b5c4d92fb802e74de9b7e3c4e7301188edd307b1f0640376e254219ab149730e83497278c69ab5f0222bf92aa16e5159306ec2c0a574f68d009296e74009ec0099b7c8c91cac598bdfdd7456bc61d5fade5d78f6a29e0ec1a25ea5a54cd19a67188467212512e8f4148013730e61a2ebda763789ab1d900e3f3ab155dc5e360202dfd4c32fbfe4e3dd0602c124fd0ddedb09688fa1f6fd480e7f77d86f44b291309998c8496edc86280be55e2c7069891acfbbc549b776c73c27875544f4b66228944ebb12503731c5a4061e65d3fc3de6cd44da7ad42d5bf390265b596d521bc99eb96f3fd7e8ea01161d0e29ee3a9fe5a3a5f74ab8091fdb2d81f5f1a522282eed8d83477cae8ed11640404f788036104052c66f5f0bcfa2b6b35276a5db8605def82775be8957f43a7a997b32b873ea5281875543ea23c897acb50709feb425135fc294a93dff277b3b4939b7cd6e717b62ac3c06ff3dfdc9860ccebdcaa883427cc8d1d1cb48e5cc75d093f0fc4d52a774c1c3943b549eee64fdcee6de7e58d253d4a0234cadc94e2f2c6f7e240e509744030ed9eaceebf8def9baefbbeb6d4f165a64693815d0b723b38bb59ccd5905829a58dc6b62ea58f6868fcf8541bb42dfeb9f11b25ddd6397d4ba4cd2cacb5ba8ae7276eef2b0bf9d5c996e60d476c4616aca7004470342da23f75e807b3e12fb15c73199e060d130a0d9a006ae3ac9545e2c51b2f8f21382453cd151fc5fb6786fe11003c540e557f9234e6ee32a886ca764cd0e5d39cbb4efa487cfce3bce1b3a9e0698bcceb727d7e358fe8bfe9b8373540870bedaf1b45a7de902d8b5c6a8a19b7b5cc35edc3666a5dbdb80d14aa7be5531e6f59378e318a8c11e91187259ad842a4c8416c91864b0d1cc9f3e6a5f635762703ade95294ec88d78f93c93819bf0f4af1aa46192356707bb75d3e94526c5d2471dd9537d7c4b56353b7caef6d32e45a6b41d7caebdb5f23d3b4f219adf64a214e946b082304b845d7b449a8aba5eef0d9ff9d3d54798483f56b67fcff2d88d65a4f393c4c53140c2703f3a48495bfab7bd72d7f43b3327c1b8ab73d86c41e8f38cdbb28eda9ab7122923e618e203a594f1609132723f9374dcd394961748894aa3758ebef1287de175153550564cc37d66d60723538ca4d934c338bbc9abfcfeb8e34c17474b818f1a04053e7c6b88184fdeb35c62b2fc0eed18684e5333a21244423b124fdb0024d0abe44c7b927c4c4cd45a58dd925fe3900eb20169503eafb458d83f0a891c7110e2fb210fa5ed00333dc6f9c7fb1f2ad7bff30c1eb98936a5952061322c630cb7b08d4d6b36245065053a3a7a03e3903f0d540ce804c32d896a90cedd2ce46e3d40891eb1147a2265a46aeb5eab4f579bfaf23643a2aef17558dbe1fca8acb6d979bf3faf2173e64f700ca0ab5af5e4447cb0d4b1d649d477434a5b8920754046e78a68de78a44595c3eddc56ae3cdf897a66fc6510df0fc34fa2c7cbafc176cf6c53ea3949dc3c1f899924fb52c55167dabe0042301cffe1d5f5fb71b7c4f332efda8e0a0bf959b215b569d64db3b1d30da2961f1af8fa13b7401bd6ad1a259b7a3598f9317fa1923eb1ea19a542406009516db4caef1afd0cabfc9b0e87818c6765d178de2fa2ad2239ef20b36fa459b946ecc9b4fd891972d81fdb5c98adba416e8c2c416a04d5bc12b9123071febf47562493b460b49d94d97c796e4f8ffec6687d91c73a02c29c8a11b44c0787203c0ad11ae51cb8c5de72c33aebc485709a82129089fb1dafc86dc9f9163315d107897286d010d9443cfba31fe282292c9ccc4c7d5rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootro�x��������������~�����X6m(J������������)��$9����������������)�(�*��t from lve if the nproc limit is reached- EA-6574: Make permissions on FPM socket dir more secure- ALTPHP-351: make lsphp error messaqges more informative
- ALTPHP-354: SIGCHILD handler fix after CRIU restoring- update PHP to 5.6.31
- update LiteSpeed SAPI to 6.11- add require for ea-libnghttp2- EA-6484: Clarify Summary and Description for DSO- EA-6232: Build -curl with HTTP/2 support- update always_populate_raw_post_data patch- LSPHP: fix php_value wrong priorities
- LSPHP: fix using options from .user.ini- EA-6292: Switch libxml2 to OS provided libraries- EA-6282: Swapped ea-php## symlinks to match EasyApache 3 compatibility- Switch libxml2 to cPanel distributed packages- EA-6063: Add ea-php56 binary symlinks to /usr/bin and /usr/local/bin- Disable dtrace functionality since CentOS does not provide dtrace via repos.- EA-6203: Correct OpCache blacklist directory- EA-6031: Enable mssql option and use our ea-freetds instead of freetds- ZC-2475: PHPs need build reqs when building for libcurl- EA-2422: Have PHPs use our ea-libcurl- ALTPHP-323: LSPHP: update CRIU patch- use ea-libcurl instead of system curl package- ALTPHP-313: Add to lsphp support for custom php.ini defined via .htaccess- EA-5946: force requirement of ea-libtidy instead of .so from BuildRequires ea-libtidy-devel- EA-5839: Add opcache.validate_permission to opcache ini- EA-5807: enable php-tidy on rhel 6 and above- ALTPHP-306: LSPHP: Return response code and response status line in cgi/fcgi manner
- Update CRIU patch to version 7
- Supress warnings about deprecated $HTTP_RAW_POST_DATA- update to 5.6.30- ALTPHP-283: lsphp CRIU support added- update to 5.6.29- EA-3685: do not create apache user/group since we use nobody- Remove fpm ondemand patch (EA-5714)- Fix erronous getpwnam message in php-fpm jailshell code- Ensure the same extensions are compiled statically across all
  SAPI types (EA-5587)- Make php-cli require php-litespeed- Updated to version 5.6.28 via update_pkg.pl (EA-5641)- ALTPHP-238: litespeed-php updated to 6.10
- AL-1865: Back to ea-php "Ensure that php.d is not scanned when PHPRC is set" patch with mod_lsapi mode support- Add patch for on demand forking bug- Updated to version 5.6.27 (EA-5409)- Set register_argc_argv default on to match EasyApache 3- added missing libXpm-devel and freetype-devel build requirements- update CloudLinux PHP-FPM patch- Updated to version 5.6.26 via update_pkg.pl (EA-5252)- Force users on jailshell and noshell to be chrooted when using php-fpm- Changed php-fpm.d directory to 0710 (EA-5097)- Updated to version 5.6.25 via update_pkg.pl (EA-5081)- Removed php-5.6.x-ea4-ini.patch which breaks mod_lsapi in some cases- Update PHP 5.6 to release 5.6.24 (EA-4815)- Disallow php-fpm from loading .user.ini files outside the user's homedirectory- Updated to version 5.6.23 via update_pkg.pl (EA-4734)- EA-4383: Update Release value to OBS-proof versioning- Removed unused global wsdl and session cache directories (EA-4690)- Added EasyApache 3 backwards compatibility php.ini patch (EA-4665)- Added litespeed 6.9.1 support- Enabled PHP-Litespeed package- Updated to version 5.6.22 via update_pkg.pl (EA-4637)- in requires change libc-client to ea-php54-libc-client- Updated to version 5.6.21 via update_pkg.pl (EA-4479)- Now uses bundled gd (ZC-1564)
- Updated descriptions to use scl_prefix macros (like php7)- Updated to version 5.6.20 via update_pkg.pl (EA-4416)- Updated to version 5.6.19 via update_pkg.pl (EA-4234)- mod_php adjusted to conflict with other mod_php versions, and
  not itself.  this lets the user reinstall the package without
  conflict. (ZC-1459)- Added imap extension for all CentOS versions.  It now depends on
  our internal SCL libc-client package.- Updated to version 5.6.18 via update_pkg.pl (EA-4151)- Improve DSO conflicts (EA-3751)- build with imap extension for all distributions- bump epoch to 1
- add litespeed 6.9
- add cloudlinux-php-fpm.5.dl.patch- Updated to version 5.6.17 via update_pkg.pl (EA-4051)- mod_php requires a�x�������������Pn�����X�l�`�������������#L�$3����������������#L"L$L�when PHPRC is set" patch with mod_lsapi mode support- Fix configure options in phpinfo()- Updated to version 7.0.12 via update_pkg.pl (EA-5413)- Set register_argc_argv default on to match EasyApache 3- update CloudLinux PHP-FPM patch- Updated to version 7.0.11 via update_pkg.pl (EA-5248)- Force users on jailshell and noshell to be chrooted when using php-fpm- Changed php-fpm.d directory to 0710 (EA-5097)- Updated to version 7.0.10 via update_pkg.pl (EA-5085)- Removed php-7.0.x-ea4-ini.patch which breaks mod_lsapi in some cases- Removed reference to unused patches.
- Used prior choon.net mail-header patch as a basis for updating
  it with PHP 7 compatibility (EA-4199).- Updated to version 7.0.9 (EA-4819)- Added application of previous patch to spec file- Disallow php-fpm from loading .user.ini files outside of homedir- Updated to version 7.0.8 via update_pkg.pl (EA-4738)
- Remove opcache check since it was removed in d41920c (EA-4755)- EA-4383: Update Release value to OBS-proof versioning- Removed unused global wsdl, session, and opcache cache
  directories (EA-4689)- Added EasyApache 3 backwards compatibility php.ini patch (EA-4666)- Added litespeed support- Updated to version 7.0.7 via update_pkg.pl (EA-4628)- in requires change libc-client to ea-php54-libc-client- Updated to version 7.0.6 via update_pkg.pl (EA-4487)- Updated to version 7.0.5 via update_pkg.pl (EA-4401)- Added imap extension across all centos versions by using our
  own SCL version of libc-client.- bump epoch to 1- Updated to version 7.0.4 via update_pkg.pl (EA-4222)- Updated to version 7.0.3 via update_pkg.pl (EA-4203)- Updated SPEC from xz to bz2 to match other PHP SCL packages- mod_php adjusted to conflict with other mod_php versions, and
  not itself.  this lets the user reinstall the package without
  conflict. (ZC-1459)- Updated php.ini to more closely match cPanel's PHP 5.6 php.ini
  (ZC-1468)- Update spec to reflect how cpanel deploys its other php packages.
- Disable file-based opcaching for cpanel because it introduces
  security concerns and incompatibilities on multi-user systems.- Now uses our SCL version of libgd
- Removed unused gh_ macro usage
- Added bundled gd support- build with --disable-huge-code-pages on EL-6- Update to 7.0.0
  http://www.php.net/releases/7_0_0.php- set opcache.huge_code_pages=0 on EL-6
  see  https://bugs.php.net/70973 and https://bugs.php.net/70977- Update to 7.0.0RC8
- set opcache.huge_code_pages=1 on x86_64- Update to 7.0.0RC7 (retagged)- Update to 7.0.0RC7- Update to 7.0.0RC6- php-config: reports all built sapis- rebuild as retagged- Update to 7.0.0RC5
- update php-fpm.d/www.conf comments
- API and Zend API are now set to 20151012- Update to 7.0.0RC4
- php-fpm: set http authorization headers- F23 rebuild with rh_layout- Update to 7.0.0RC3
- disable zip extension (provided in php-pecl-zip)- Update to 7.0.0RC2
- enable oci8 and pdo_oci extensions
- sync php.ini with upstream php.ini-production- Update to 7.0.0RC1- Update to 7.0.0beta3- Update to 7.0.0beta2
- switch from libvpx to libwebp (only for bundled libgd, not used)- Update to 7.0.0beta1
- use upstream tarball instead of git snapshot- Update to 7.0.0alpha2
- use new layout (/etc/opt, /var/opt)- new snapshot- new snapshot
- the phar link is now correctly created- Update to 7.0.0alpha1- new snapshot- new snapshot
- t1lib support have been removed- new snapshot- new snapshot- new snapshot- add experimental file based opcode cache (disabled by default)- new snapshot- new snapshot
- adapt system tzdata patch for upstream change for new zic- new snapshot- new snapshot- new snapshot- rename 10-php70-php.conf to 15-php70-php.conf to
  ensure load order (after 10-rh-php56-php.conf)- rebuild- fix mod_php configuration
- disable static json
- sync php.ini with upstream php.ini-production- update for php 7.0.0
- ereg, mssql, mysql and sybase_ct extensions are removed
- add pdo-dblib subpackage (instead of php-mssql)
- disable oci8 extension, not yet adapted for 7.0
- add php-�x��������������]�����X�l�Z������p���b��$r����������������b�c�a��name() function, which follow a destination symbolic link(#181977)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- upgrade- rebuilt- fix incorrect audit record in userdel (#174392)- fix useradd segfaults (#173241)- Update audit communication to standard format messages- upgrade- add useradd -l option back, it was removed by mistake- provide login.defs man page
- adjust audit patch- audit support- upgrade- Change to use new selinux api for selinux_check_passwd_access- change the password last changed field in the shadow file
  when "usermod -p" is used (#164943)- provide getspnam.3 man page(#162476)
- fix useradd man page(#97131)- do not copy files from skel directory if home directory
  already exist (#89591,#80242)- upgrade- remove vigr binary- fix nscd socket path- don't assume selinux is enabled if is_selinux_enabled() returns -1- fix chage -l option (#109499, #137498)- fix memory leak, and CPU spinning when grp_update() and
  duplicate group entries in /etc/group (#151484)- use newgrp binary
- newgrp don't ask for password if user's default GID = group ID,
  ask for password if there is some in /etc/gshadow
  and in /etc/group is 'x' (#149997)- gcc4 fix (#150994) 2:4.0.7-3- man pages cs,es,ko,ru,zh_CN,zh_TW to UTF-8- upgrade 2:4.0.7-1- static limit on group count to dynamic (#125510, #148994, #147742)- add "-l" option #146214- rebuilt- Change useradd to use matchpathcon- Add matchpathcon to create the files correctly when they do not exist.- Change symlink ownership when copying from /etc/skel (#66819, patch by
  Michael Weiser)- make the limit for the group name the same as the username (determined
  by the header files, rather than a constant) (#56850)- allow for mixed case and dots in usernames (#135401)
- all man pages to UTF-8, not just Japanese (#133883)
- add Polish blurb for useradd -n man page option (#82177)- check for non-standard legacy place for ncsd HUP (/var/run/nscd.pid) and
  then the std FHS place (/var/run/nscd.pid) (#125421)- Add checkPasswdAccess for chage in SELinux- always unlock all files on any exit (#126709)- #126596 fix Req and BuildReqs- Fix build deps etc, move to current auto* (Steve Grubb)- Fix nscd path. This fixes various stale data caching bugs (#125421)- Add get_enforce checks
- Clean up patch for potential upstream submission
- Add removemalloc patch to get it to build on 3.4- rebuilt- rebuild- make /etc/default world-readable, needed for #118338- rebuilt- Fix selinux relabel of /etc/passwd file- fix use of uninitialized memory in useradd (#89145)- back to UTF-8 again
- remove getspnam(3) man page, now conflicts with man-pages 1.64- don't convert man pages to UTF-8 for RHEL 3, conditionalized using macro
- fixup dangling man page references- lastlog: don't pass a possibly-smaller field to localtime (#109648)
- configure: call AC_SYS_LARGEFILE to get large file support- turn on SELinux support- convert ja man pages to UTF-8 (#106051)
- override MKINSTALLDIRS at install-time (#107476)- turn off SELinux support- build with SELinux support- Add SELinux support- rebuilt- rebuild- run autoconf to generate updated configure at compile-time- adjust mailspool patch to complain if no group named "mail" exists, even
  though that should never happen- fix perms on mailspools created by useradd to be owned by the "mail"
  group (#59810)- rebuilt- install the shadow.3 man page- disable use of cracklib at build-time
- fixup reserved-account changes for useradd- update to 4.0.3, bumping epoch- remove man pages which conflict with the man-pages package(s)- prevent libshadow from being built more than once, to keep automake happy
- change how md5 and md5crypt are enabled, to keep autoconf happy
- remove unpackaged files after %install- force .mo files to be regenerated with current gettext to flush out possible
  problems
- fixup non-portable encodings in translations
- make sv translation header non-fuzzy so that it will be included (#71281)- don't apply aging�x������sM�����X��l((��������������;L�$+����������������;L<L�H�?�d����0�	4�	`�<�@�X�\�g�r�v�	���������	�
��~
������|�dh|(�8��94�:k��G0H8I@XDYP\�]�^�bdjeofrltt�u�v��8�<�B�����__
j�����g�h�Cea-php70-php-imap7.0.3329.el8.cloudlinux.9A module for PHP applications that use IMAPThe ea-php70-php-imap module will add IMAP (Internet Message Access Protocol)
support to PHP. IMAP is a protocol for retrieving and uploading e-mail
messages on mail servers. PHP is an HTML-embedded scripting language.i�l�build.cloudlinux.com�YCloudLinuxCloudLinuxPHPCloudLinux Packaging Team <packager@cloudlinux.com>Development/Languageshttp://www.php.net/linuxx86_641�(����i�l�i�l�30ad26302882f692a8d2811cfaacd321a18edad586ea470c496fd8af85190e7c53932ee3c1ce23172fbd577279f429103afa7ea6ac8d5c235f6afabdb7152257rootrootrootrootea-php70-php-7.0.33-29.el8.cloudlinux.9.src.rpm��������config(ea-php70-php-imap)ea-php70-php-imapea-php70-php-imap(x86-64)@@@@@@@@@@@@@@@



@config(ea-php70-php-imap)ea-php70-libc-client(x86-64)ea-php70-php-cli(x86-64)ea-php70-php-common(x86-64)libc-client.so.2007()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcom_err.so.2()(64bit)libcrypt.so.1()(64bit)libcrypto.so.1.1()(64bit)libgssapi_krb5.so.2()(64bit)libk5crypto.so.3()(64bit)libkrb5.so.3()(64bit)libpam.so.0()(64bit)libssl.so.1.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)1:7.0.33-29.el8.cloudlinux.91:7.0.33-29.el8.cloudlinux.91:7.0.33-29.el8.cloudlinux.93.0.4-14.6.0-14.0-15.2-1ea-php70-php-recode1:7.0.33-29.el8.cloudlinux.94.14.3i�q@i���i��i�5�i�A@i��@ix��iM'@iJ�@i)��h�;@h�C�h�C�ht�@h$��h#4@h#4@g�g���g��@g
d�f�X@f��f:�e�5@e\��ej�d�]@dJ�c�G�c[�@cMC�b��b\@a�@a��a;H�`�i@`ٹ�`��`[)�`B@`7�@`�@`2@_��@_�u@_��_���_�]@_���_�P�_Wr@_R,@_3�_*�@_�@^��^��^���^��@^|�@^{G�^`�^`�^^F�^Y�^��]��]��]�)�]�@]�@]z3@]rJ@]o�@]S��]5�@]#0@];�]�]�@\�P�\�s@\��@\���\��\�r@\��\u*@\f��\^��\Z�@\J�@\J�@\	@\&@[ٙ@[��[�Q@[^��[U�@[P}@[D��[3|@[�[{@Z�@Z�@Z؄�Z�3@ZԐ@Z�J@Z�@Z�&�Z���Z���Z��@Za�Z`�@ZX�@ZWQ�ZT��ZP�@ZN@Z��ZN�Y��Y�B@Y�@Y�Y�d�Y��Y�5�Y�o@Y�@@Y��@Y�J�Y��@Y�@Yw2�YoI�Yd��Ycl@YS�@YK�@YJ_�Y:��Y;@Y�Y��YR@Y�@Yi@X�:@X��@X�Q@X�X�h@X�P@X��X�~@X�C�X��@X� @X��@X�@X�e@X�p�X�*�X�*�X��@XQ4@XJ��XJ��XEV�X.�@X.�@X-��X$a@X$a@X�@X�W�W�v@W��@W��@W�@W��W��W��W��@W��Wu	�Wq@Wg�W_�W^�@W^�@WF�@W3�W!�@V�b�V��@V�@V�'@V͛@V͛@V��V��V�&@V��V`.�V]��V\:@VU��VD@VC-�V0��V$�@VC�V�@V�U���U�Y�U�U�d@U���U���U��U���U�a@Uyx@Uv�@Um��UhT�Uc�UY�@UW1@U?v@U?v@U>$�U2G@U/�@U��U�@U�@U�@U�@U
�@T�9�T��@T���T�C@T��T�p@T�5�Tw@Tu��Th��Td�@TV�T?�@T.��Tk@S��S��Sr	@S,)�S?�S��R�@R��@R��@R�R�R�R�R_�@R:�@R��Q��@Q�Y@Q�Y@Q��Q��Q��@Q��@Q��Qy�Qf��Q@j@P��@PѬ@P��P�@P�@P�*�P��@P��@P�)�P�)�P���P���P���P��x��������������<�����Xl������������������$�����������������������c2a5ccb7fc37341382531eb8a74c647cbb5a21c81fd19567681323e67309385fe38792f6959a96ee2d10cdd8d083c1211e5b4ccc979ce9f30f4d70a3e38c731a2dece7a8166519ad15a95ce19c4e5226006678bff47664557fb118424edd281a5fa4461653f2d057b66d390917954a0714984d63c1c5637d0e603d31fa5d4df2ab27102386e311c54786b26a843bcd65489cf6de90cee962f6beef6ab5965bd4aaf735ee2033733156805cb87bfb32bfdfc51f01ba4719c80b6fe911b091a7c05124b64eeece964e09c058ef8f9805daca546b01ba4719c80b6fe911b091a7c05124b64eeece964e09c058ef8f9805daca546b01ba4719c80b6fe911b091a7c05124b64eeece964e09c058ef8f9805daca546b35cecc2cbf386c874377d47d345aaa7c8ba71e58ed1d4e0acc0de3e928d37eec01ba4719c80b6fe911b091a7c05124b64eeece964e09c058ef8f9805daca546beca058789f1e354218e494d71ebb22501e3d087d1191e0ce2bd3baf08d286e1f01ba4719c80b6fe911b091a7c05124b64eeece964e09c058ef8f9805daca546b01ba4719c80b6fe911b091a7c05124b64eeece964e09c058ef8f9805daca546b01ba4719c80b6fe911b091a7c05124b64eeece964e09c058ef8f9805daca546b01ba4719c80b6fe911b091a7c05124b64eeece964e09c058ef8f9805daca546b6d443fa3af5a72421586de6abec65c769a67beed4c550866c778ef8b998705f88e5f6bc8e3d93ca8736bec949a72157fcb6b475ca00b4f78ca3194b24aa1d2d833ad02a002fc84ab303ef24417f32e9a8cb25acdd2c109b7055615ee80df077408088913ab5ea4b33ca9c8f677b9b2e594771223567e24feb78b85b43bd455ff32fee146cbf350ddcfbd25d193d3fd97f8a96e31373d450dfa5fdc0d0d6f77e7505adb7631b6d9e139f4194338197d6693184216af0555288d7ede1e79ad6bdf14322f820bb238adaba014720eeb548e93c6e6c0f058983dc9fd62ba0aa79bc03edf4ba856fb912404f8030112b8a7ce95c8f49d9599e97fa76b7eb5906ce4e07fa9633568f1715489d19cc07af793a305b9df0cc3468382990f12898071b16cdb037285e10a0d8b701397f68d6f81ec9406a46c1743e89d11edace631083b788c7003f1b5de3e51e7f579ab0fdd508b07b76625be63cd90476b5e80347893c2fe09a3938ffbdca3a68578c803894d0e6311c8a84dee845614f8ade79202a0e5d6b4f585156b243f81aa4edaf0f38bff70c037b8b0a13b24268a84b45b87acf271fa02dcff05f55ee7f2e53889a738467e865935d3eb8fa47905d66fb4a692234c3fbd7d67caed707f34f7569369d7d356a3d84ef7dc6b8e1c1ec74a030b9d3c96920ab59c4eec604d23a2aa3b13364610557a6e2d3234016309c70a85bc7a4da75ca368f39a5ceac24a224922e0c952ad998b257cb15159b78d943e49a05fdda891931c0fe90e89e6cfff8d6dc2777f31f272a7db69aa459195049559d30fd540ae63a82a8443492f0fa567a7b4cc3be901d92cc6083188a98cfd0c20cf6e73bb95ca0e8c23d07e918515d372ff026eae4db41111ab0e34b5a10c074285e5d4954556e9b6173c5f70b8a0b36ac9d3d154ae22cf0203a0748a6679b80568ceedf19f2c5b98f78295775aea7ea1d5fd720a9612b015322e69b5df93b93b4c3ccdf70bd6b15efde84714395d2f24493a7c4e1f2f657b7e27772dd3afd725c969474c400768b004acad7ea3a63f934bead6135a52d75fc0a183c59c42a9201288a86d72df4c5fe9f800cb604197abe9e9fc526ebde554994361b2ef1c85a772eb7b785863302a2f3299118116116218c1a1fd85d8145d04a140b2289cce3333ec098ec0127ae77f15d45802904c47fa8c3221047dbe5bebc45e1108170edbdce358a9aae9e608d12817c382f930267dab03c8b9c37305b2a1dc60fa2532201b396e119a243bc6250d747cf21fa1390e90ca097622fbc6a2b36fcb565116debfceee33b1f273285e670113f0ac8f137255984cd561e30d7697826c4da69044c5892b999ab4211ba829b55ae3f8b75f832c69519f526b1c1e6f7426ad39a4f4b005c3110e1197c886a870994e5ad806d68516a35106aee812937baf80c7594e59b916ae3ff6ecba5f2b050c0554186f59470e6a37b1f64651451a137404c79791d98443a2ed0b7ad94633cc46a8db0d48de0655abb7ae764741952dad0dbb1d57ed65d5194e6ee4d7561f64c2562c4c084f86836b395ee1fae31557494bc24454cb37642b88a40e2261e5ee572e5c718695d053a1ac922b39b04e348514f2f2bacf6479d21739fd2e6c7c99c86719c3254a43e5c0992898e9a77271835a2571b8538646f0f37848e4cccc2a35f2820e47376f2da46542bb655c8dd1ae8e602e94394b725a9f9cdf54b4b7433c16d3765c7ad986c1f3e382447e6be0c924e2fb0fca90318b1aeca458a560e204106a7df4e7ebb57cdd19da56bc359d216c9e045302e9d45812afc74133aa72d8623a4ff426cfd2fb87ec8ad78e7fd36cfd0ca723bf0b49d64667f84e0ee5e51cd099a35c8e3cacaacfd5fefb4d27aacfbe188aceee2e149a52e7348a5b5fdfd3a6a37e56a73f35d8bf73416afe2bb5e13abc516f5326ec2b5f5f876c5ec06ba2a3d88bb6f9ec7ed63aab0d53971f255530a24f1228c7e7769c849705938d2194c9d9b8dc3ff10d1b6a721cf41d29c6b6b68e9083810de55b3e074a06db2038a9352440ee976b607838f1e53c64731308fc0e2bc28069aba53f7c71f3c19e16268651dd6cbf777a9a5c9d238ccf9767371e�x�������������0,�����X�l�RHH����r��$b����������������r�q�s��ector returns empty selector instead of None (Jan Silhan)
- packaging: add automatic's systemd unit files. (RhBug:1109915) (Ales Kozumplik)
- automatic: handle 'security' update_cmd. (Ales Kozumplik)- lint: fix convention violations in the new source files (Radek Holy)
- Add "updateinfo [<output>] [<availability>] security" command. (RhBug:850912) (Radek Holy)
- Add "updateinfo [<output>] [<availability>] bugfix" command. (Radek Holy)
- Add "updateinfo [<output>] [<availability>] enhancement" command. (Radek Holy)
- Add "updateinfo [<output>] [<availability>] [<package-name>...]" command. (Radek Holy)
- Add "updateinfo [<output>] [<availability>] [<advisory>...]" command. (Radek Holy)
- Add "updateinfo [<output>] all" command. (Radek Holy)
- Add "updateinfo [<output>] updates" command. (Radek Holy)
- Add "updateinfo [<output>] installed" command. (Radek Holy)
- Add "-v updateinfo info" command. (Radek Holy)
- Add "updateinfo info" command. (Radek Holy)
- Add "updateinfo list" command. (Radek Holy)
- Add "updateinfo available" command. (Radek Holy)
- Add "updateinfo summary" command. (Radek Holy)
- Add basic updateinfo command. (Radek Holy)
- test: add updateinfo to the testing repository (Radek Holy)
- test: support adding directory repos to Base stubs (Radek Holy)
- test: really don't break other tests with the DRPM fixture (Radek Holy)
- Load UpdateInfo.xml during the sack preparation. (Radek Holy)
- Add Repo.updateinfo_fn. (Radek Holy)
- lint: add Selector calls to false positives, it's a hawkey type. (Ales Kozumplik)
- removed recursive calling of ucd in DownloadError (Jan Silhan)
- does not throw error when selector is empty (RhBug:1127206) (Jan Silhan)
- remove etc/version-groups.conf, not used. (Ales Kozumplik)
- lint: dnf.conf.parser (Ales Kozumplik)
- rename: dnf.conf.parser.varReplace()->substitute() (Ales Kozumplik)
- pycomp: add urlparse/urllib.parser. (Ales Kozumplik)
- move: dnf.yum.parser -> dnf.conf.parser. (Ales Kozumplik)
- packaging: add dnf-automatic subpackage. (Ales Kozumplik)
- doc: properly list the authors. (Ales Kozumplik)
- automatic: add documentation, including dnf.automatic(8) man page. (Ales Kozumplik)
- dnf-automatic: tool supplying the yum-cron functionality. (Ales Kozumplik)
- doc: cosmetic: fixed indent in proxy directive (Jan Silhan)
- include directive support added (RhBug:1055910) (Jan Silhan)
- refactor: move MultiCallList to util. (Ales Kozumplik)
- cli: do not output that extra starting newline in list_transaction(). (Ales Kozumplik)
- refactor: extract CLI cachedir magic to cli.cachedir_fit. (Ales Kozumplik)
- transifex update (Jan Silhan)
- move: test_output to tests/cli. (Ales Kozumplik)
- refactor: move Term into its own module. (Ales Kozumplik)
- refactoring: cleanup and linting in dnf.exceptions. (Ales Kozumplik)
- lint: test_cli.py (Ales Kozumplik)
- lint: rudimentary cleanups in tests.support. (Ales Kozumplik)
- refactor: loggers are module-level variables. (Ales Kozumplik)
- groups: promote unknown-reason installed packages to 'group' on group install. (RhBug:1116666) (Ales Kozumplik)
- c82267f refactoring droppped plugins.run_transaction(). (Ales Kozumplik)
- cli: sort packages in the transaction summary. (Ales Kozumplik)
- refactor: cli: massively simplify how errors are propagated from do_transaction(). (Ales Kozumplik)
- groups: rearrange things in CLI so user has to confirm the group changes. (Ales Kozumplik)
- groups: committing the persistor data should only happen at one place. (Ales Kozumplik)
- groups: visualizing the groups transactions. (Ales Kozumplik)
- Add dnf.util.get_in() to navigate nested dicts with sequences of keys. (Ales Kozumplik)
- group persistor: generate diffs between old and new DBs. (Ales Kozumplik)
- Better quoting in dnf_pylint. (Ales Kozumplik)
- lint: logging.py. (Ales Kozumplik)
- Do not print tracebacks to the tty on '-d 10' (RhBug:1118272) (Ales Kozumplik)
- search: do not double-report no matches. (Ales Kozumplik)
- refactor: move UpgradeToCommand to its own module. (Ales Kozumplik)- packaging: also add pyli�x�������������������XPmp��������=����m�$}����������������m��
���������������xsgbVQE@4/#
���������������ythcWRFA50$�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
z
u
i
d
X
S
G
B
6
1
%
 



���������������{vjeYTHC72&!���������������|wkfZUID83'"�
�
�
�
�
�
�
�
�
�
�
�
�
�
}
x
l
g
[
V
J
E
9
4
(
#




�	�	�	�	�	�	�	�	�	�	�	�	�	�	~	y	m	h	\	W	K	F	:	5	)	$					��������������zni]XLG;6*%���������������{oj^YMH<7+&	���������������|pk_ZNI=8,'
���������������}ql`[OJ>9-(���������������~rma\PK?:.)���������������snb]QL@;/locale/ilo/LC_MES>[;�	�>���땑̕�>[;�6,��>[;%p<��>[;�LA�>[;�)�_�>[;�	�b�E�1P|���땑̕����Ŧ��O�wIO�:�E�1�.\�	�*²��
�A�v-@ �O�wE \�
>[;�otx�>[;#)T+�E�1�-����������뛥�O�w���Y�E�1�.|�	�*�~��
�v����>[;�	-�O�w��[�
��_��M�>[;�(h �E�1�-�����Q�������̤��O�wG�\2�E�1y.��	�*Ÿ0t�
�v���>�O�wE\G�
���J��%�>[;Umpr�>[;d\)�>[;b(`'�E�1*}�����s�� ���룣|!�O�w�d'�E�1�.��	�ѱ0��
>[;�h#�O�wdE��
���n�8 �>[;l��>[;/��>[;�'<0�E�1�D�����ҍ,@����i��x�O�w7�X��E�1�.t�	��2��O�w6F$�
���H��>[;4k���>[;�'@'�E�1�D
���끌�����a��1�>[;�2�'�O�w�t�E�1�$4�	E�1�#h�
���%�E�1P|��q��`E��q��`E��q��`E��q��`E��q��`E��q��`E��q��`E��q��`E��q��`E��q��`E��q��`E��q��`E��q��`E��q��`E��q��`E��A�v-@ ��+}��+}���>[;�otx��@i� ;�>[;#)T+��+}����Y.���6��������q�����>[;�	-���_��M���uP��+����̤���q���T:��+}3���+}��>[;Umpr�>[;b(`'��+}��
��$���#����s�� �O�w�d'��q��o�^�>[;�h#�O�wdE��
���n�8 ���u����>[;/�����i��x��q�4��=���2���+}^���+}t�>[;4k���>[;�'@'��+} �,��$���di���끌��>[;�2�'�O�w�t��q�̄���>[;+,1�>[;-p��q�i�lH���G���+}���O�w{���oV�k�#��+}O�
�[�<����>[;��("�>[;�1�0��q���4I�>[;z�(�G��8��>[;g�!��q����^x��YP1w�+}�T
v>[;'P�1r�oV?7��q>[;%(Xp�+}�X1o>[;���+mJ�=��i>[;��.fG��F0��c>[;0�a�]t~�`E�1M34Y	�q��A,rX�+}��V�ÂE�S>[;ZD5R�oV,7�@Q>[;�#$\P�+}��O>[;�~L3MVg����MG>[;�xF�f,��=B>[;K*A���+��0<E�1�%�.9	�q��@�8�+}�6�+}�
�
1>[;� |0�+}I�/�f#���'>[;~�&�%6�S#.~���">[;�
�!��륓|��q�'?���먨�0�+}L�
�q����K�+}�
,
>[;���+}q�>[;�q�X
>[;+�,O�w6�PI
�@��|P�x������������� �����X�l���������q������L�$����������������LLL�@redhat.com> 5.4.16-2Remi Collet <rcollet@redhat.com> 5.4.16-1Remi Collet <rcollet@redhat.com> 5.4.14-3Remi Collet <rcollet@redhat.com> 5.4.14-2Remi Collet <rcollet@redhat.com> 5.4.14-1Remi Collet <rcollet@redhat.com> 5.4.13-1Remi Collet <rcollet@redhat.com> 5.4.11-1Remi Collet <rcollet@redhat.com> 5.4.10-1Remi Collet <rcollet@redhat.com> 5.4.9-1Remi Collet <rcollet@redhat.com> 5.4.8-7Remi Collet <rcollet@redhat.com> 5.4.8-6Remi Collet <rcollet@redhat.com> 5.4.8-5Remi Collet <rcollet@redhat.com> 5.4.8-6Remi Collet <rcollet@redhat.com> 5.4.8-4Remi Collet <rcollet@redhat.com> 5.4.8-4Remi Collet <rcollet@redhat.com> 5.4.8-3Joe Orton <jorton@redhat.com> - 5.4.8-2Remi Collet <rcollet@redhat.com> 5.4.8-3Remi Collet <rcollet@redhat.com> 5.4.8-2.1Remi Collet <rcollet@redhat.com> 5.4.8-2Remi Collet <rcollet@redhat.com> 5.4.8-1.2Remi Collet <rcollet@redhat.com> 5.4.8-1Remi Collet <rcollet@redhat.com> 5.4.7-4Remi Collet <rcollet@redhat.com> 5.4.7-3Remi Collet <rcollet@redhat.com> 5.4.7-2Remi Collet <rcollet@redhat.com> 5.4.7-1Remi Collet <remi@fedoraproject.org> 5.4.7-10Remi Collet <remi@fedoraproject.org> 5.4.7-9Remi Collet <rcollet@redhat.com> 5.4.7-8Remi Collet <rcollet@redhat.com> 5.4.7-7Remi Collet <rcollet@redhat.com> 5.4.7-6Remi Collet <rcollet@redhat.com> 5.4.7-5Remi Collet <rcollet@redhat.com> 5.4.7-4Remi Collet <rcollet@redhat.com> 5.4.7-3Remi Collet <remi@fedoraproject.org> 5.4.7-2Remi Collet <remi@fedoraproject.org> 5.4.7-1Remi Collet <remi@fedoraproject.org> 5.4.6-2Remi Collet <remi@fedoraproject.org> 5.4.6-1Remi Collet <remi@fedoraproject.org> 5.4.5-1Remi Collet <remi@fedoraproject.org> 5.4.4-4Remi Collet <remi@fedoraproject.org> 5.4.4-3Remi Collet <remi@fedoraproject.org> 5.4.4-2Remi Collet <remi@fedoraproject.org> 5.4.4-1Remi Collet <remi@fedoraproject.org> 5.4.3-1Remi Collet <remi@fedoraproject.org> 5.4.2-1Remi Collet <remi@fedoraproject.org> 5.4.1-1Joe Orton <jorton@redhat.com> - 5.4.0-6Remi Collet <remi@fedoraproject.org> 5.4.0-5Joe Orton <jorton@redhat.com> - 5.4.0-4Joe Orton <jorton@redhat.com> - 5.4.0-3Joe Orton <jorton@redhat.com> - 5.4.0-2Remi Collet <remi@fedoraproject.org> 5.4.0-1Remi Collet <remi@fedoraproject.org> 5.4.0-0.4.RC8Remi Collet <remi@fedoraproject.org> 5.4.0-0.3.RC7Remi Collet <remi@fedoraproject.org> 5.4.0-0.2.RC6Remi Collet <remi@fedoraproject.org> 5.4.0-0.1.RC6Remi Collet <remi@fedoraproject.org> 5.3.8-4.4Remi Collet <remi@fedoraproject.org> 5.3.8-4.3Adam Jackson <ajax@redhat.com> - 5.3.8-4.2Marcela Mašláňová <mmaslano@redhat.com> - 5.3.8-3.2Peter Schiffer <pschiffe@redhat.com> - 5.3.8-3.1Remi Collet <remi@fedoraproject.org> 5.3.8-3Remi Collet <remi@fedoraproject.org> 5.3.8-2Remi Collet <remi@fedoraproject.org> 5.3.8-1Remi Collet <remi@fedoraproject.org> 5.3.7-1Joe Orton <jorton@redhat.com> - 5.3.6-4Remi Collet <Fedora@famillecollet.com> 5.3.6-3Remi Collet <Fedora@famillecollet.com> 5.3.6-2Remi Collet <Fedora@famillecollet.com> 5.3.6-1Joe Orton <jorton@redhat.com> - 5.3.5-6Caolán McNamara <caolanm@redhat.com> 5.3.5-5Remi Collet <Fedora@famillecollet.com> 5.3.5-4Remi Collet <Fedora@famillecollet.com> 5.3.5-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.3.5-2Remi Collet <Fedora@famillecollet.com> 5.3.5-1Remi Collet <rpms@famillecollet.com> 5.3.4-2Remi Collet <rpms@famillecollet.com> 5.3.4-1.1Remi Collet <Fedora@famillecollet.com> 5.3.4-1Remi Collet <Fedora@famillecollet.com> 5.3.3-5Joe Orton <jorton@redhat.com> - 5.3.3-4Joe Orton <jorton@redhat.com> - 5.3.3-3Remi Collet <Fedora@famillecollet.com> 5.3.3-2Remi Collet <Fedora@famillecollet.com> 5.3.3-1Remi Collet <Fedora@famillecollet.com> 5.3.2-3Caolán McNamara <caolanm@redhat.com> 5.3.2-2Remi Collet <Fedora@famillecollet.com> 5.3.2-1Joe Orton <jorton@redhat.com> - 5.3.1-3Joe Orton <jorton@redhat.com> - 5.3.1-2Remi Collet <Fedora@famillecollet.com> 5.3.1-1Tom "spot" Callaway <tcallawa@redhat.com> - 5.3.0-7Tomas Mraz <tmraz@redhat.com> - 5.3.0-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> -�x��������������������X%m�A�������������$�������������������� by limiting number of parsed
  multipart body parts and printing upload limit exceed error message only once- CL9 compatibility- EA-11075: Correct default value description for log_errors in php.ini- Fix for Harden PHP
- CVE-2022-31631: Fix integer overflow that could cause PDO::quote() to return an improperly quoted string- EA-11039: Ensure php.ini is marked as a config file on debian based systems- EA-11038: Update ea-php74 from v7.4.32 to v7.4.33- EA-10957: Update ea-php74 from v7.4.30 to v7.4.32- EA-10757: Update ea-php74 from v7.4.29 to v7.4.30- EA-10632: Update ea-php74 from v7.4.28 to v7.4.29- EA-10532: Update litespeed to 8.0.1- EA-10504: Update ea-php74 from v7.4.27 to v7.4.28- EA-10461: Patch PHP-FPM/OpCache for kill_all_lockers bug (74709)- ZC-9611: Dependency issue with php-enchant.- ZC-9598: Fix Ubuntu 21 global regs problem- ZC-7454: Add php-sodium- EA-10364: Update ea-php74 from v7.4.26 to v7.4.27- EA-10279: Update ea-php74 from v7.4.25 to v7.4.26- ZC-9470: Remove gmp extension from common’s built-in Provides list- EA-10228: Update ea-php74 from v7.4.24 to v7.4.25- ZC-9368: Correct build issues from changes to ea-tools- EA-10137: disable upstream regression tests in favor of our own- EA-10136: Update ea-php74 from v7.4.23 to v7.4.24- EA-10081: Update ea-php74 from v7.4.22 to v7.4.23- EA-10009: Update ea-php74 from v7.4.21 to v7.4.22- EA-9925: Update ea-php74 from v7.4.20 to v7.4.21- EA-9013: Optimize %check section- EA-9831: Update ea-php74 from v7.4.19 to v7.4.20- Update icu version requirements- EA-9752: Update ea-php74 from v7.4.18 to v7.4.19- EA-9737: Update ea-php74 from v7.4.16 to v7.4.18- EA4D-266: Update hph-fpm lve patch 
- ALTPHP-1102: Update Litespeed patches for litespeed-7.9- EA-9625: Update litespeed to 7.9- EA-9622: Update ea-php74 from v7.4.15 to v7.4.16- ALTPHP-1053: Update move_override_ini patch
- ALTPHP-1038: Update litespeed log patch- Fix openssl11 requirements issue- EA-9565: Update ea-php74 from v7.4.14 to v7.4.15- EA-9517: Update ea-php74 from v7.4.13 to v7.4.14- ZC-8005: Replace ea-openssl11 with system openssl on C8- AAP-178: Added disable killing of PHP-FPM parent process in LVE when not enough of memory- EA-9448: Update ea-php74 from v7.4.12 to v7.4.13- EA-9424: Fix the build on CentOS 8- EA-9401: Update ea-php74 from v7.4.11 to v7.4.12- ALTPHP-997: Fix Local-Master values after updating LiteSpeed- ZC-7893: Update DSO config to factor in PHP 8- EA-9390: Fix build with latest ea-brotli (v1.0.9)- ZC-7497: Reinstate `runselftest`- Fix for build for CentOS 8- EA-9339: Update ea-php74 from v7.4.10 to v7.4.11- MODLS-815: override_ini processing patch added
- MODLS-818: Litespeed SAPI updated to 7.8- EA-9281: Update litespeed from upstream to 7.8- EA-9282: Update ea-php74 from v7.4.9 to v7.4.10- Fix requirements for mbstring- EA-9224: Update ea-php74 from v7.4.8 to v7.4.9- MODLS-741: Make LSCRIU log messages with timestamps
- MODLS-804: Improve mod_lsapi & lsphp error reporting in case of php memory limit reached- EA-9189: Update litespeed from upstream to 7.7- EA-9150: Update ea-php74 from v7.4.7 to v7.4.8- ZC-6967: Build on C8- EA4D-197: Fix ea-php specs for using our litespeed patches- EA-9109: Update ea-php74 from v7.4.6 to v7.4.7- EA-9087: Fix PHP version in DSO description- EA-9072: Revert new .user.ini search behavior- EA-9070: Update ea-php74 from v7.4.5 to v7.4.6- EA4D-210: Modify for CloudLinux- ZC-6649: Re-enable multibyte regex for 7.4- EA-9014: Build ea-php74 with jpeg support- EA-9007: Update ea-php74 from v7.4.2 to v7.4.5- ZC-6287: Add php_intl with ea-libicu for C6- ZC-6287: Add libzip to zip Requires for C6- EA-8867: Update ea-php74 from v7.4.1 to v7.4.2- ZC-4640: Initial packaging1:7.4.33-18.el8.cloudlinux.51:7.4.33-18.el8.cloudlinux.51:7.4.33-18.el8.cloudlinux.520-bz2.inibz2.so.build-id804a6032c683453028943992cf5a23ac1e5fdd70/opt/cpanel/ea-php74/root/etc/php.d//opt/cpanel/ea-ph�x�������������������X�l�������������o��$����������������o�n�p��oad error (RhBug:1190458) (Jan Silhan)
- log: print metadata age along with timestamp (Petr Spacek)
- cli: fix double expansion of cachedir (RhBug:1194685) (Michal Luscon)
- removed unused dnf-makecache.cron (Jan Silhan)
- renamed erase command to remove (RhBug:1160806) (Jan Silhan)
- spec: made python3-dnf package installed by default in f23 (Jan Silhan)
- AUTHORS: changed email address (Jan Silhan)
- doc: improve the documentation of the "install" command (Radek Holy)
- "dnf install non-existent" should fail (Radek Holy)
- tests: add some tests of Base.install (Radek Holy)
- tests: add some tests of Base.package_install (Radek Holy)
- Revert "doesn't upgrade packages by installing local packages" (RhBug:1160950) (Radek Holy)
- lint: fix all Pylint errors in test_install (Radek Holy)
- tests: add some tests to test_install (Radek Holy)
- tests: improve some tests in test_install (Radek Holy)
- cosmetic: reorder tests in test_install (Radek Holy)
- cosmetic: rename some tests in test_install and add some docstrings (Radek Holy)
- AUTHORS: updated (Jan Silhan)
- Add support for armv6hl (Peter Hjalmarsson)
- doc: subject.__init__(): what is pkg_spec (Jan Silhan)
- doc: mentioning raising IOError from Base.fill_sack() (Jan Silhan)
- option_parser: fixed splitting multiple values (RhBug:1186710) (Jan Silhan)
- AUTHORS: updated (Jan Silhan)
- Standardize words describing boolean data type (Christopher Meng)- Adapt to librepo-1.7.13, metalink and mirrorlist are not loaded anymore when the repo is local. (Radek Holy)
- not raises value error when no metadata exist (Jan Silhan)
- Remove lock files during boot (RhBug:1154476) (Michal Luscon)
- doc: groups are ordered not categories (Jan Silhan)
- doc: added Package attributes to API (Jan Silhan)
- README: link to bug reporting guide (Jan Silhan)
- README: the official documentation is on readthedoc (Jan Silhan)
- i18n: unicode encoding does not throw error (RhBug:1155877) (Jan Silhan)
- conf: added minrate repo option (Related:RhBug:1175466) (Jan Silhan)
- conf: added timeout repo option (RhBug:1175466) (Jan Silhan)
- doc: api_queries: add 'file' filter description (RhBug:1186461) (Igor Gnatenko)
- doc: documenting enablegroups (Jan Silhan)
- log: printing metadata timestamp (RhBug:1170156) (Jan Silhan)
- base: setup default cachedir value (RhBug:1184943) (Michal Luscon)
- orders groups/environments by display_order tag (RhBug:1177002) (Jan Silhan)
- no need to call create_cmdline_repo (Jan Silhan)
- base: package-spec matches all packages which the name glob pattern fits (RhBug:1169165) (Michal Luscon)
- doc: move dnf.conf to appropriate man page section (RhBug:1167982) (Michal Luscon)
- tests: add test for blocking process lock (Michal Luscon)
- lock: fix several race conditions in process lock mechanism (Michal Luscon)
- base: use blocking process lock during download phase (RhBug:1157233) (Michal Luscon)
- Update the Source0 generation commands in dnf.spec.in file (Parag Nemade)
- Enhancement to dnf.spec.in file which follows current fedora packaging guidelines (Parag Nemade)
- doc: add some examples and documentation of the core use case (RhBug:1138096) (Radek Holy)
- bash-completion: enable downgrading packages for local files (RhBug:1181189) (Igor Gnatenko)
- group: prints plain package name when package not in any repo (RhBug:1181397) (Jan Silhan)
- spec: own __pycache__ for python 3 (Igor Gnatenko)
- changed hawkey.log dir to /var/log (RhBug:1175434) (Jan Silhan)
- bash-completion: handle sqlite errors (Igor Gnatenko)
- use LANG=C when invoking 'dnf help' and 'sed' with regular expressions (Jakub Dorňák)
- spec: own __pycache__ directory for py3 (Igor Gnatenko)
- doc: mentioning Install command accepts path to local rpm package (Jan Silhan)
- groups: in erase and install cmd non-existent group does not abort transaction (Jan Silhan)
- doc: running tests in README (Jan Silhan)
- api: transaction: added install_set and remove_set (RhBug:1162887) (Jan Silhan)
- cosmetic: fixed some typos in documentation (Jan Silhan)
- groups: environments descr�x���������H������X�tl��������p���������$b��������������������a8ac842bece15ee3d84ed3f276b8cf41f199cdbf7ee9acb77467d5f2745f1a199b7f947e842478706ced98cc2051d132f81e0e929dbe154a7738f232e8e95c178665456035dda187a5c80ece69079ac5af8f0efe7699ea9bef574295ed68a14bebacec5264cea17584231e307aafe924713aad9c15190c69ad5642ed5e25a022820b1bdfe5c247e8bc464583cff1aa1e33ac72419d74791024406aa4add089581cb8157e15afeea10c7f5c70a15f0ebf1c4a63636f9d29beb3263ca07f1e18c0180753a17a87408f8e891b77d181b3412d3e695da9c53e996afdbc2de768f1d9d900ae4751ad7d706039cd50dfa547ee89d4365204d5f63a8eb5cf702a196ab8ea4d7dbb0a3e99a9c82f24d5e33de49de4f22ee056207f375542d159bd417e2fcd6dd585bb430813ae543b7043ccc35abc932512e2cab8366d7b4834776d3c0bc930e27045d9730ac4f41b89a3326bffc566d3022dbc13aa6400346d55ac9c51efb90644f5cc4237c5339ef1ad1407e7305199ccf79d73603ae2354a133501c38311041ddf3a6547b25415692f2fbbc8bc21c31aae70484ae0c79b9485b77d29a288bcde3d9955e5fbbb349c9bb5f7175ac09ae81414e9f3a459f3c3df5e7aeb60a425395395c43fb5bb66dac07727f7e66c0dbc5668d24dccca2b26b4b93eda09f5cc067256c4d7a1856b8e964408b6ef9a68d939fd03ce423a199af9ed70f48a94fc217c6947844a55d8a43d38df29b3b2d721e0f1df8d61ba77e7f75814d1d9e246b6224abceb347189c3117911c2b244a851d1827e5d2228fd86d34836c9e3b930d2dc5d12a8418e4db3b9275ff39d2f4a35140e5fa20e81ea3f0a8adfe4f23f342dc28841444beee93d3f6253adaa2db778ddae31c49ff9b21287c4f955ddac851c3a33c1ff0../../../../usr/lib64/libbytesize.so.1.0.0libbytesize.so.1.0.0�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlibbytesize-1.4-3.el8.src.rpm��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������libbytesizelibbytesize(x86-64)libbytesize.so.1()(64bit)@@@@@@@@@



@libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.8)(64bit)libgmp.so.10()(64bit)libmpfr.so.4()(64bit)libpcre.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.2]�{@\�+@[b�@Z؄�Z�_@Zz�@ZOh�Y�5�Y��@Yé�Y�o@Y�(@Y�@Yx�@YA%@X�Q@X��@Xv@XZn�XS�@XN�@W�$�W�@W;�W,�@W(��WX@W�@V�@V�@V�@V�m@V�>@V�=@VA�x��������������������X�k�����������B��$R����������������B�A�C��techtrefny/master-pvsize (vpodzime)
- Do not try to create a PV with 4KiB metadata space (vpodzime)
- Add pv_info to BDLVMPVdata (vtrefny)
- btrfs now requires at least 128MiB device(s) (vpodzime)
- Merge pull request #52 from vpodzime/master (vpodzime)
- Round size in thpoolcreate() to KiB (vpodzime)
- Sync the %changelog in spec with downstream (vpodzime)- Create the cache pool before the to-be-cached LV (vpodzime)- Rebuilt for Python3.5 rebuild- Fix the annotation of bd_try_init in blockdev.c (vpodzime)- Add missing python GI requires (vpodzime)
- Merge pull request #49 from dashea/libblockdev-python (vpodzime)
- Merge pull request #50 from vpodzime/master-fix_striped_lv (vpodzime)
- Merge pull request #46 from vpodzime/master-bcache_destroy (vpodzime)
- Merge pull request #39 from vpodzime/master-lvm_physical_space (vpodzime)
- Add a missing ldconfig that rpmlint found. (dshea)
- Move python files to separate packages (#1256758) (dshea)
- Fix lvcreate calls for striped LVs (vpodzime)
- Merge pull request #48 from vojtechtrefny/master_pvfree (vpodzime)
- Add pv_free to BDLVMPVdata (vtrefny)
- Merge pull request #47 from atodorov/add_coverage_report (vpodzime)
- Produce coverage report in CI (atodorov)
- Check bcache device's state before trying to detach the cache in destroy() (vpodzime)
- Fix URLs in the spec (vpodzime)
- Fix the int-float less-than comparison (vpodzime)
- Fix the calculation of physical space taken by an LV (vpodzime)- Merge pull request #40 from vpodzime/master-config_support (vpodzime)
- Add tests for configuration support (vpodzime)
- Add a function for getting the loaded soname for a plugin (vpodzime)
- Add the default configuration (vpodzime)
- Load and respect configuration files when loading plugins (vpodzime)
- Add functions for finding and processing configuration files (vpodzime)
- Merge pull request #38 from vpodzime/master-md_superblock_size (vpodzime)
- Better document how MD RAID superblock size should be calculated (vpodzime)
- Merge pull request #36 from phatina/master (vpodzime)
- BTRFS: allow an arbitrary label to be set for a btrfs volume (phatina)
- Merge pull request #32 from phatina/master (vpodzime)
- BTRFS: fix parsing empty partition label (phatina)
- Merge pull request #35 from vpodzime/master (vpodzime)
- Define env variables for sudo via the env utility (vpodzime)
- Merge pull request #34 from dashea/python3-tests (vpodzime)
- Use unittest.addCleanup to simplify crypto_test. (dshea)
- Run tests with both python2 and python3 in the ci target. (dshea)
- Fix python3 issues in the unittests. (dshea)
- Do not run all tests in the 'ci' target (vpodzime)
- Merge pull request #33 from clumens/master (vpodzime)
- Add a new makefile target that does everything needed for jenkins. (clumens)
- Synchronize the .spec file with downstream (vpodzime)- Explicitly specify the type of the cert_data parameter (#1246096) (vpodzime)- Clean generated boilerplate code on 'make clean' (vpodzime)
- Merge pull request #31 from atodorov/use_lang_c (vpodzime)
- tests: use LANG=C in test_backup_passphrase() (atodorov)
- Merge pull request #30 from atodorov/makefile_updates (vpodzime)
- Makefile.am:   - add separate check target   - add coverage targets   - make it possible to test with Python3 (atodorov)
- Merge pull request #29 from atodorov/fix_issue_28 (vpodzime)
- Merge pull request #27 from atodorov/fix_docs_url (vpodzime)
- Merge pull request #26 from atodorov/test_docs (vpodzime)
- Change the modified sources back in tearDown() method as well. Closes #28. (atodorov)
- update URL to on-line documentation (atodorov)
- add test documentation (atodorov)
- Merge pull request #22 from dashea/escrow-tests (vpodzime)
- Merge pull request #25 from dashea/python-dep (vpodzime)
- Filter the python files from automatic rpm requires (dshea)
- Added tests for escrow packets and backup passphrases (dshea)
- Free leaked contexts from crypto_init (dshea)
- Cooperate with volume_key's memory management (dshea)
- Fix inheritance in the LVM tests to prevent multiple runs of some te�x�������������8������X�cm�������`�����������$x��������������������HcMiAg6QcKA7halL
kCdIS2nWR8g7nZeZjq5XhckeNGrGX/3w/m/lwczYjMUer+qs2ww5expZJ7qhtSta
lE3EtL/l7zE4RlknqwDZ0IXtxCNPu2UovCzZmdZm8UWfMSKk/3VgL8HgzYRr8fo0
yj0XkckJ7snXvuhoviW2tjm46PyHPWRKgW4iEzUrB+hiXpy3ikt4rLRg/iMqKjyf
mvcE/VdmFVtsfbfRVvlaWiIWCndRTVBkAaTu8DwrGyugQsbjEcK+4E25/SaKIJIw
qfxpyBVhru21ypgEMAw1Y8KC7KntB7jzpFotE4wpv1jZKUZuy71ofr7g3/2O+7nW
LrR1mncbuT6yXo316r56dfKzOxQJBnYFwTjXfa65yBArjQBUCPNYOKr0wkYEEhEI
AAYFAlb8JFYACgkQy8sIKhu5Q9snYACgh3id41CYTHELOQ/ymj4tiuFt1lcAn3JU
9wH3pihM9ISvoeuGnwwHhcKnwsFcBBIBCAAGBQJW/CSEAAoJEJFxGJmV5Fqe11cP
/A3QhvqleuRaXoS5apIY3lrDL79Wo0bkydM3u2Ft9EqVVG5zZvlmWaXbw5wkPhza
7YUjrD7ylaE754lHI48jJp3KY7RosClY/Kuk56GJI/SoMKx4v518pAboZ4hjY9MY
gmiAuZEYx5Ibv1pj0+hkzRI78+f6+d5QTQ6y/35ZjSSJcBgCMAr/JRsmOkHu6cY6
qOpq4g8mvRAX5ivRm4UxE2gnxZyd2LjY2/S2kCZvHWVaZuiTD0EU1jYPoOo6fhc8
zjs5FWS56C1vp7aFOGBvsH3lwYAYi1K2S+/B4nqpitYJz/T0zFzzyYe7ZG77DXKD
/XajD22IzRGKjoeVPFBx+2V0YCCpWZkqkfZ2Dt3QVW//QIpVsOJnmaqolDg1sxoa
BEYBtCtovU0wh1pXWwfn7IgjIkPNl0AU8mW8Ll91WF+Lss/oMrUJMKVDenTJ6/ZO
06c+JFlP7dS3YGMsifwgy5abA4Xy4GWpAsyEM68mqsJUc7ZANZcQAKr6+DryzSfI
Olsn3kJzOtb/c3JhVmblEO6XzdfZJK/axPOp3mF1oEBoJ56fGwO2usgVwQDyLt3J
iluJrCvMSBL9KtBZWrTZH5t3rTMN0NUALy4Etd6Y8V94i8c5NixMDyjRU7aKJAAw
tUvxLd12dqtaXsuvGyzLbR4EDT/Q5DfLC1DZWpgtUtCVwsFcBBIBCAAGBQJW/CS2
AAoJEEHdwLQNpW8iMUoP/AjFKyZ+inQTI2jJJBBtrLjxaxZSG5ggCovowWn8NWv6
bQBm2VurYVKhvY1xUyxoLY8KN+MvoeTdpB3u7z+M6x+CdfoTGqWQ2yapOC0eEJBF
O+GFho2WE0msiO0IaVJrzdFTPE0EYR2BHziLu0DDSZADe1WYEqkkrZsCNgi6EMng
mX2h+DK2GlC3W2tY9sc63DsgzjcMBO9uYmpHj6nizsIrETqouVNUCLT0t8iETa25
Mehq/I92I70Qfebv7R4eMrs+tWXKyPU0OjV+8b8saZsv1xn98UkeXwYx4JI04OTw
nBeJG8yPrGDBO5iucmtaCvwGQ3c76qBivrA8eFz3azRxQYWWiFrkElTg+C/E83JQ
WgqPvPZkI5UHvBwBqcoIXG15AJoXA/ZWIB8nPKWKaV5KDnY3DBuA4rh5Mhy3xwcC
/22E/CmZMXjUUvDnlPgXCYAYU0FBbGk7JpSYawtNfdAN2XBRPq5sDKLLxftx7D8u
ESJXXAlPxoRh7x1ArdGM+EowlJJ0xpINBaT0Z/Hk0jxNIFEak796/WeGqewdOIki
dAs4tppUfzosla5K+qXfWwmhcKmpwA4oynE8wIaoXptoi8+rxaw4N6wAXlSrVxeC
VTnb7+UY/BT2Wx6IQ10C9jrsj6XIffMvngIinCD9Czvadmr7BEIxKt1LP+gGA8Zg
wsFcBBIBCgAGBQJYE6oDAAoJEL7YRJ/O6NqIJ24P+QFNa2O+Q1rLKrQiuPw4Q73o
7/blUpFNudZfeCDpDbUgJ01u1RHnWOyLcyknartAosFDJIpgcXY5I8jsBIO5IZPR
C/UKxZB3RYOhj49bySD9RNapHyq+Y56j9JUoz6tkKFBd+6g85Ej8d924xM1UnRCS
9cfI9W0fSunbCi2CXLbXFF7V+m3Ou1SVYGIAxpMn4RXyYfuqeB5wROR2GA5Ef6T3
S5byh1dRSEgnrBToENtp5n7Jwsc9pDofjtaUkO854l45IqFarGjCHZwtNRKd2lcK
FMnd1jS0nfGkUbn3qNJam1qaGWx4gXaT845VsYYVTbxtkKi+qPUIoOyYx4NEm6fC
ZywH72oP+fmUT/fbfSHa5j137dRqokkR6RFjnEMBl6WHwgqqUqeIT6t9uV6WWzX9
lNroZFAFL/de7H31iIRuZcm38DUZOfjVf9glweu4yFvuJ7cQtyQydFQJV4LGDT/C
8e9TWrV1/gWMyMGQlZsRWa+h+FfFUccQtfSdXpvSxtXfop+fVQmJgUUl92jh4K9j
c9a6rIp5v1Q1yEgs2iS50/V/NMSmEcE1XMOxFt9fX9T+XmKAWZ8L25lpILsHT3mB
VWrpHdbawUaiBp9elxhn6tFiTFR7qA7dlUyWrI+MMlINwSZ2AAXvmA2IajH/UIlh
xotxmSNiZYIQ6UbD3fk4wsFzBBABCgAdFiEEmy/52H2krRdju+d2+GQcuhDvLUgF
Ally44wACgkQ+GQcuhDvLUgkjQ//c3mBxfJm6yLAJD4s4OgsPv4pcp/EKmPcdztm
W0/glwopUZmq9oNo3VMMCGtusrQgpACzfUlesu9NWlPCB3olZkeGugygo0zuQBKs
55eG7bPzMLyfSqLKyogYocaGc4lpf4lbvlvxy37YGVrGpwT9i8t2REtM6iPKDcMM
sgVtNlqFdq3Fs2Haqt0m1EksX6/GSIrjK4LZEcPklrGPvUS3S+qkwuaGE/jXxncE
4jFQR9SYH6AHr6Vkt1CG9Dgpr+Ph0I9n0JRknBYoUZ1q51WdF946NplXkCskdzWG
RHgMUCz3ZehF1FzpKgfO9Zd0YZsmivV/g6frUw/TayP9gxKPt7z2Lsxzyh8X7cg6
TAvdG9JbG0PyPJT1TZ8qpjP/PtqPclHsHQQIbGSDFWzRM5znhS+5sgyw8FWInjw8
JjxoOWMa50464EfGeb2jZfwtRimJAJLWEf/JnvO779nXf5YbvUZgfXaX7k/cvCVk
U8M7oC7x8o6F0P2Lh6FgonklKEeIRtZBUNZ0Lk9OShVqlU9/v16MHq/Eyu/Mbs0D
en3vYgiYxOBR8czD1Wh4vsKiGfOzQ6oWti/DCURV+iTYhJc7mSWM6STzUFr0nCnF
x6W0j/zH6ZgiFAGOyIXW2DwfjFvYRcBL1RWAEKsiFwYrNV+MDonjKXjpVB1Ra90o
lLrZXAXCwHMEEgEKAB0WIQRMRw//78TT3Fl3hlXOGj3V48lPSQUCXAAgOgAKCRDO
Gj3V48lPSQxAB/43qoWteVZEiN3JW4FnHg+S60TnHSP69FKV+363XYKDa23pNpv4
tiJumo9Kvb4UoDft766/URHm5RKyPtrxy+wqotamrkGJUTtP2a68h7C31VX+pf6i
iQKmxRQz4zmW0pA5X01+AgpvcDH++Fv5NLBpnjqPdTh5b0gvr89E0zMNldNYOZu1
0H/mukrnGlFDu/osBuy+XJtP2MeasazVMLvjKs+hr//E+iLI9DZOwFBK6AX5gkkI
UEHkSeb4//AHwvanUMin9un9+F9iR+qDuDEKxuevYzM0owuoVcK5pAsRnRQJlnHW
/0BQ6FtNGpmljhvUk8a/l3xFf3z/uJG5vVKVzsFNBFb8EKsBEADDfCMsu2U1CdJh
r4xp6z4J89/tMnpCQASC8DQhtZ6bWG/ksyKt2DnDQ050XBEng+7epzHWA2UgT0li
Y05zZmFs1X7QeZr16B7JANq6fnHOdZB0ThS7JEYbProkMxcqAFLAZJCpZT534Gpz
W7qHwzjV+d13IziCHdi6+DD�x������V�����������X�AmP��������������*�$�����������������*�*�*�uza@redhat.com> 3.7.8-10Daniel Novotny <dnovotny@redhat.com> 3.7.8-9Daniel Novotny <dnovotny@redhat.com> 3.7.8-8Daniel Novotny <dnovotny@redhat.com> 3.7.8-7Henrique Martins <bugzilla-redhat-2009@martins.cc> 3.7.8-6Daniel Novotny <dnovotny@redhat.com> 3.7.8-5Daniel Novotny <dnovotny@redhat.com> 3.7.8-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 3.7.8-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 3.7.8-2Daniel Novotny <dnovotny@redhat.com> 3.7.8-1Daniel Novotny <dnovotny@redhat.com> 3.7.7-4Daniel Novotny <dnovotny@redhat.com> 3.7.7-3Daniel Novotny <dnovotny@redhat.com> 3.7.7-2Tomas Smetana <tsmetana@redhat.com> 3.7.7-1Tomas Smetana <tsmetana@redhat.com> 3.7.6-4Tomas Smetana <tsmetana@redhat.com> 3.7.6-3Tomas Smetana <tsmetana@redhat.com> 3.7.6-2.2Tomas Smetana <tsmetana@redhat.com> 3.7.6-2.1Tomas Smetana <tsmetana@redhat.com> 3.7.6-2Tomas Smetana <tsmetana@redhat.com> 3.7.6-1.3Tomas Smetana <tsmetana@redhat.com> 3.7.6-1.2Tomas Smetana <tsmetana@redhat.com> 3.7.6-1.1Tomas Smetana <tsmetana@redhat.com> 3.7.6-1Tomas Smetana <tsmetana@redhat.com> 3.7.5-5Tomas Smetana <tsmetana@redhat.com> 3.7.5-4Peter Vrabec <pvrabec@redhat.com> 3.7.5-3Peter Vrabec <pvrabec@redhat.com> 3.7.5-2Peter Vrabec <pvrabec@redhat.com> 3.7.5-1Peter Vrabec <pvrabec@redhat.com> 3.7.4-13Peter Vrabec <pvrabec@redhat.com> 3.7.4-12Peter Vrabec <pvrabec@redhat.com> 3.7.4-11Peter Vrabec <pvrabec@redhat.com> 3.7.4-10Peter Vrabec <pvrabec@redhat.com> 3.7.4-9Peter Vrabec <pvrabec@redhat.com> 3.7.4-8Jesse Keating <jkeating@redhat.com> - 3.7.4-7Peter Vrabec <pvrabec@redhat.com> 3.7.4-6Dan Walsh <dwalsh@redhat.com> 3.7.4-5Peter Vrabec <pvrabec@redhat.com> 3.7.4-4Jesse Keating <jkeating@redhat.com> - 3.7.4-3.1Peter Vrabec <pvrabec@redhat.com> 3.7.4-3Peter Vrabec <pvrabec@redhat.com> 3.7.4-2Peter Vrabec <pvrabec@redhat.com> 3.7.4-1Peter Vrabec <pvrabec@redhat.com> 3.7.3-3Jesse Keating <jkeating@redhat.com> - 3.7.3-2.2.1Jesse Keating <jkeating@redhat.com> - 3.7.3-2.2Jesse Keating <jkeating@redhat.com>Peter Vrabec <pvrabec@redhat.com> 3.7.3-2Peter Vrabec <pvrabec@redhat.com> 3.7.3-1Peter Vrabec <pvrabec@redhat.com> 3.7.2-12Peter Vrabec <pvrabec@redhat.com> 3.7.2-11Peter Vrabec <pvrabec@redhat.com> 3.7.2-10Peter Vrabec <pvrabec@redhat.com> 3.7.2-9Peter Vrabec <pvrabec@redhat.com> 3.7.2-8Peter Vrabec <pvrabec@redhat.com> 3.7.2-7Peter Vrabec <pvrabec@redhat.com> 3.7.2-6Peter Vrabec <pvrabec@redhat.com> 3.7.2-5Peter Vrabec <pvrabec@redhat.com> 3.7.2-4Peter Vrabec <pvrabec@redhat.com> 3.7.2-3Peter Vrabec <pvrabec@redhat.com> 3.7.2-2Peter Vrabec <pvrabec@redhat.com> 3.7.2-1Peter Vrabec <pvrabec@redhat.com> 3.7.1-14Peter Vrabec <pvrabec@redhat.com> 3.7.1-13Peter Vrabec <pvrabec@redhat.com> 3.7.1-12Dan Walsh <dwalsh@redhat.com> 3.7.1-10Dan Walsh <dwalsh@redhat.com> 3.7.1-9Peter Vrabec <pvrabec@redhat.com> 3.7.1-8Peter Vrabec <pvrabec@redhat.com>Peter Vrabec <pvrabec@redhat.com>Peter Vrabec <pvrabec@redhat.com> - 3.7.1-5Peter Vrabec <pvrabec@redhat.com> - 3.7.1-4Peter Vrabec <pvrabec@redhat.com> - 3.7.1-3Miloslav Trmac <mitr@redhat.com> - 3.7.1-2Elliot Lee <sopwith@redhat.com> 3.7.1-1Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Dan Walsh <dwalsh@redhat.com> 3.6.10-4Dan Walsh <dwalsh@redhat.com> 3.6.10-3Dan Walsh <dwalsh@redhat.com> 3.6.10-2.selErik Troan <ewt@redhat.com>Elliot Lee <sopwith@redhat.com> 3.6.10-1Dan Walsh <dwalsh@redhat.com> 3.6.9-2Elliot Lee <sopwith@redhat.com> 3.6.9-1Elliot Lee <sopwith@redhat.com> 3.6.8-1Elliot Lee <sopwith@redhat.com> 3.6.7-1Elliot Lee <sopwith@redhat.com> 3.6.6-1Elliot Lee <sopwith@redhat.com> 3.6.5-1Elliot Lee <sopwith@redhat.com> 3.6.4-1Elliot Lee <sopwith@redhat.com> 3.6.3-1Elliot Lee <sopwith@redhat.com> 3.6.2-1Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com> 3.6-1Preston Brown <pbrown@redhat.com> 3.5.10-1Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown �x�������������X������Xl��������h�������b��$r����������������b�c��H[�?Z\d����0�	4�	`�<�@�X�\�g�r�v�	���������	�
��~
������x�8<P(m8t�9��:)e�GWHWIWXWYW$\W|]W�^W�bW�dY>eYCfYFlYHtY`uYhvYp�Z�Z�Z�ZXZlZpZ�_Z�_
[>[g�[�[�[�g[�h[�Cea-php72-php-imap7.2.3412.el8.cloudlinux.9A module for PHP applications that use IMAPThe ea-php72-php-imap module will add IMAP (Internet Message Access Protocol)
support to PHP. IMAP is a protocol for retrieving and uploading e-mail
messages on mail servers. PHP is an HTML-embedded scripting language.i�r�build.cloudlinux.com�aCloudLinuxCloudLinuxPHPCloudLinux Packaging Team <packager@cloudlinux.com>Development/Languageshttp://www.php.net/linuxx86_641�0����i�rRi�rU30ad26302882f692a8d2811cfaacd321a18edad586ea470c496fd8af85190e7c3fc90aa6570b4cd366c7bb6c91b653b0ffc3cb3876f02b467e6c35ff1a377112rootrootrootrootea-php72-php-7.2.34-12.el8.cloudlinux.9.src.rpm��������config(ea-php72-php-imap)ea-php72-php-imapea-php72-php-imap(x86-64)@@@@@@@@@@@@@@



@config(ea-php72-php-imap)ea-php72-libc-clientea-php72-php-cli(x86-64)ea-php72-php-common(x86-64)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcom_err.so.2()(64bit)libcrypt.so.1()(64bit)libcrypto.so.1.1()(64bit)libgssapi_krb5.so.2()(64bit)libk5crypto.so.3()(64bit)libkrb5.so.3()(64bit)libpam.so.0()(64bit)libssl.so.1.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)1:7.2.34-12.el8.cloudlinux.91:7.2.34-12.el8.cloudlinux.91:7.2.34-12.el8.cloudlinux.93.0.4-14.6.0-14.0-15.2-1ea-php72-php-recode1:7.2.34-12.el8.cloudlinux.94.14.3i�q@i���i��i�5�i�A@i��@ix��iM'@iJ�@i)��h�R@h�C�h�C�ht�@h$��h#4@h#4@g�g��@g��@g
d�f�X@f��f:�e\��ej�d�]@d,@dJ�c�G�cl�c[�@cMC�b��b\@a��a;H�`�i@`ٹ�`��`[)�`B@`7�@_���_��_��@_���_�]@_��@_���_u�_Wr@_R,@_+�_*�@_�@_�^��^��^��@^�2�^��@^|�@^s^�^[��^Y�^Nt�^=Q@^)��^��]�f@]��]��]�|@]��@]���]�@]z3@]rJ@]nU�]B�@]5�@]#0@];�];�]^@]�\�@\�P�\�s@\��\��@\���\��\�r@\��\��@\�M�\��\n��\\�\Z�@\P@@\J�@\J�@\?�\73�\	@\&@[�%@[ٙ@[��[�;@[�Q@[y[�[^��[U�@[P}@[D��[3|@[0�@[�[{@[��Z�@Z�@Z؄�Z�3@ZԐ@Z�@Z�&�Z���Z���Z��@ZtR�Za�Z`�@ZX�@ZWQ�ZT��ZP�@ZOh�Z'�Z%8�Z�@ZN�Y��Y�B@Y�@Y�Y�d�Y�*@Y�5�Y�o@Y��@Y��@Y���Y��Sergey Fokin <sfokin@cloudlinux.com> - 7.2.34-12.cloudlinux.9Razmik Manvelyan <rmanvelyan@cloudlinux.com> - 1:7.2.34-12.cloudlinux.8Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 1:7.2.34-12.cloudlinux.7Levon Matshkalyan <lmatshkalyan@cloudlinux.com> - 7.2.34-12.cloudlinux.6Sergey Fokin <sfokin@cloudlinux.com> - 7.2.34-12.cloudlinux.5Razmik Manvelyan <rmanvelyan@cloudlinux.com> - 1:7.2.34-12.cloudlinux.4Arseniy Zolotarev <azolotarev@cloudlinux.com> - 1:7.2.34-12.cloudlinux.3Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 1:7.2.34-12.cloudlinux.2Sergey Fokin <sfokin@cloudlinux.com> - 1:7.2.34-12.cloudlinux.1Levo�x�������������І�����X2m�X������ �����%��$5����������������%�$�&�� Orton <jorton@redhat.com> 5.1.2-2Joe Orton <jorton@redhat.com> 5.1.1-8Joe Orton <jorton@redhat.com> 5.1.1-7Joe Orton <jorton@redhat.com> 5.1.1-6Jesse Keating <jkeating@redhat.com>Joe Orton <jorton@redhat.com> 5.1.1-5Joe Orton <jorton@redhat.com> 5.1.1-4Joe Orton <jorton@redhat.com> 5.1.1-3Joe Orton <jorton@redhat.com> 5.1.1-2Tomas Mraz <tmraz@redhat.com> 5.0.5-6Joe Orton <jorton@redhat.com> 5.0.5-5Joe Orton <jorton@redhat.com> 5.0.5-4Joe Orton <jorton@redhat.com> 5.0.5-3Joe Orton <jorton@redhat.com> 5.0.4-11Joe Orton <jorton@redhat.com> 5.0.4-10Joe Orton <jorton@redhat.com> 5.0.4-9Joe Orton <jorton@redhat.com> 5.0.4-8Joe Orton <jorton@redhat.com> 5.0.4-7Joe Orton <jorton@redhat.com> 5.0.4-6Joe Orton <jorton@redhat.com> 5.0.4-5Joe Orton <jorton@redhat.com> 5.0.4-4Joe Orton <jorton@redhat.com> 5.0.4-3Joe Orton <jorton@redhat.com> 5.0.4-2Joe Orton <jorton@redhat.com> 5.0.4-1Joe Orton <jorton@redhat.com> 5.0.3-5Joe Orton <jorton@redhat.com> 5.0.3-4Joe Orton <jorton@redhat.com> 5.0.3-3Joe Orton <jorton@redhat.com> 5.0.3-2Joe Orton <jorton@redhat.com> 5.0.3-1Joe Orton <jorton@redhat.com> 5.0.2-8Joe Orton <jorton@redhat.com> 5.0.2-7Joe Orton <jorton@redhat.com> 5.0.2-6Joe Orton <jorton@redhat.com> 5.0.2-5Joe Orton <jorton@redhat.com> 5.0.2-4Joe Orton <jorton@redhat.com> 5.0.1-4Joe Orton <jorton@redhat.com> 5.0.1-3Joe Orton <jorton@redhat.com> 5.0.1-2Joe Orton <jorton@redhat.com> 5.0.1-1Tom Callaway <tcallawa@redhat.com>Tom Callaway <tcallawa@redhat.com>- EA4D-797: revert to use system libxml2 lib for all platforms
- EA4D-811: remove libphp5.so from _root_httpd_moddir to fix file conflicts- Update php-fpm patch to v4 for per-domain resource isolation support- Add Conflicts against old php-zendguard to allow opcache and zendguard coexistence- EA4D-793: Update php-fpm LVE patch- EA4D-789: Add CVE-2019-11035, CVE-2019-19246, CVE-2021-21704 security patches- remove ea-mod_php provide and require- EA4D-773: Rebuild ea-php56 on rhel>=9 with system libxml2 as cPanel- EA4D-746: Update php-fpm lve patch to extract doc_root from php_admin_values
  for CageFS per-domain isolation- EA4D-731: Fix for ea-libxml2 2.15+- build for rhel10
- build with alt-libicu65 ans alt-pcre for rhel10- EA4D-714: Fix gd.so linking against ea-brotli- EA4-136: Fix libxml2 v2.15.0 compatibility- ZC-12167: Correct libxml2 problem- Security fixes
- CVE-2025-1220: fix null byte termination in hostnames
- CVE-2025-6491: fix NULL pointer dereference in PHP SOAP extension via large
  XML namespace prefix- EA4D-677: rebuild with new libtidy 5.8.0- EA4D-642: Fix for ea-libxml2 2.13+- Security fixes
- CVE-2019-9022: fix DNS response parsing
- CVE-2019-11034: fix possible infoleak or crush caused by read past allocated
  buffer in exif_process_IFD_TAG()
- CVE-2019-11036: fix infoleak of crash via read past allocated buffer in
  exif_process_IFD_TAG()
- CVE-2019-9025: fix possible memcpy() execution with negative argument in
  mb_split()- Security fixes
- CVE-2025-1217: http stream wrapper: fix handling folded headers
- CVE-2025-1734: http stream wrapper: fix handling headers with invalid name and no colon
- CVE-2025-1861: fix http redirect location truncation- Security fixes
- CVE-2020-7071: avoid parse_url() returning a wrong host to user
- CVE-2020-7068: fix using of freed hash key in the phar_parse_zipfile function- Security fixes
- CVE-2024-8929: fix various heap buffer over-reads for mysqlnd- Security fixes
- CVE-2024-11234: fix HTTP fulluri CRLF injection
- CVE-2024-11233: fix single byte overread with convert.quoted-printable-decode
  filter
- CVE-2024-11236: prevent integer overflow in quoters causing OOB writes- Security fixes
- CVE-2024-8925: Fix data integrity violation while parsing multipart/form-data
  boundaries larger than the read buffer
- CVE-2024-8927: Fix bypass of cgi.force_redirect configuration- ALTPHP-1839: Change lsapi naming- EA4D-541: Build with system openssl and libcurl on CL8- Fix for hardened PHP
- CVE-2024-2756: fix __Host-/__Secure-cookie bypass due t�x�������������Hv�����X�k8�����0�������F��$V����������������F�E�G��t report error when non-existing swap's status is queried (vpodzime)
- Make libblockdev-plugins-all pull the same version of plugins (vpodzime)
- Don't report error when asked for a backing file of an uknown loop (vpodzime)
- Fix accidental change in the spec's changelog (vpodzime)- Add tests for what we can easily test from the mpath plugin (vpodzime)
- Add link to sources to the documentation (vpodzime)
- Add missing symbols into the libblockdev-sections.txt file (vpodzime)
- Do not build docs for testing (vpodzime)
- Add the bd_try_init function (vpodzime)
- Log stdout and stderr output when running processes (vpodzime)
- Allow a subset of plugins to be load instead of all (vpodzime)
- Make sure devmapper doesn't spam stdout with tons of messages (vpodzime)
- Let debug messages go to stderr when running ipython (vpodzime)
- Give plugins a way to initialize themselves (vpodzime)
- Give plugins a way how to check if they could run properly (vpodzime)
- Allow a subset of plugins to be load instead of all [TEST NEEDED] (vpodzime)
- Make sure we use the whole /dev/mapper path for cryptsetup (vpodzime)
- Fix vg_pv_count parsing when getting info about PV (vpodzime)
- Set default values to data structures if real values are not available (vpodzime)
- Fix the parameter name specifying pool metadata size (vpodzime)
- Activate LUKS as ReadWrite in luks_open (vpodzime)
- Make sure we pass key_size to cryptsetup in bytes (vpodzime)
- Add the min_entropy parameter to luks_format Python overrides (vpodzime)
- Pass size in KiB instead of B to lvcreate (vpodzime)
- Add underscore into dataalignment and metadatasize parameter names (vpodzime)
- Don't report error if non-mpath device is tested for being mpath member (vpodzime)
- Fix name of the invoked utility in mpath_set_friendly_names (vpodzime)- Improve the test for lvm_set_global_config (vpodzime)
- Fix some minor issues in the spec file (vpodzime)
- Fix issues with the LVM global config str (vpodzime)
- Add couple more Python overrides (vpodzime)
- Fix the name of the lvm_thlvpoolname() function in the header file (vpodzime)
- Use assertEqual instead of assertTrue(a == b) (vpodzime)
- Add the min_entropy parameter to luks_format (vpodzime)
- Move internal dmraid-related macros into the source file (vpodzime)
- Add an override for the md_add function (vpodzime)
- Fix parameters in luks_open python overrides (vpodzime)
- Prevent init() from being done multiple times and provide a test function (vpodzime)
- Add the roadmap.rst document (vpodzime)
- Remove an extra parenthesis in one of the docstrings (vpodzime)
- Move the mddetail function next to the mdexamine function (vpodzime)
- Add some more constants required by blivet (vpodzime)- Require volume_key-devel in a version that fixes build issues (vpodzime)
- Fix Python 2 devel package name in BuildRequires (vpodzime)
- Generate docs for the library and all plugins (vpodzime)
- Make doc comments better for documentation generation (vpodzime)
- Fix parameter names in function prototypes (vpodzime)
- Add the metadatasize parameter to pvcreate (vpodzime)
- Add the dataalignment parameter to lvm_pvcreate (vpodzime)
- Export non-internal constants via introspection (vpodzime)
- Expand size constants in the GI-scanned files (vpodzime)
- Fix usage printing in the boilerplate_generator (vpodzime)
- Add the build directory to .gitignore (vpodzime)
- Add the md_run function (vpodzime)
- Fix some issues in Python overrides (vpodzime)
- Add the escrow_device function to the crypto plugin (vpodzime)
- Fix version of GI files in the Makefile (vpodzime)
- Make the order of release target's dependencies more explicit (vpodzime)- Fix dependencies of the release target (vpodzime)
- Python overrides for the GI-generated bindings (vpodzime)
- Pass version info to the code and use it to load plugins (vpodzime)- Initial release�2.28-7.el8_102.28-7.el8_10.build-idc67beaa6f2e706544936c44b8a3191d8f59c4ae7libbd_lvm.so.2libbd_lvm.so.2.0.0�x��������������e�����X��l��������H������`������$p����������������`�_�a��move duplicates from "dnf list" and "dnf info" outputs
- Fix the installation of completion_helper.py
- Fix formatting of message about free space required
- Fix installation failiure when duplicit RPMs are specified (RhBug:1687286)
- Fix issues with terminal hangs when attempting bash completion (RhBug:1702854)
- Allow plugins to terminate dnf (RhBug:1701807)
- [provides] Enhanced detecting of file provides (RhBug:1702621)
- [provides] Sort the output packages alphabetically- Backport patch to unify --help with man for module-spec (RhBug:1678689)- Backport patch to not allow direct module switch- Backport patch to add support for modular updateinfoxml data- Backport patch: Fix minor problem with suggestion printed to terminal- Backport patches for: RHEL should use --best option by default for dnf / libdnf (RhBug:1670776)
- Add --nobest dnf option to revert the new default behavior from commandline- Print information about skipped packages after the transaction
- Sort reported skipped packages, force ignore_weak
- Allow to enable modules that break default modules (RhBug:1648839)- Updated difference YUM vs. DNF for yum-updateonboot
- Added new command ``dnf alias [options] [list|add|delete] [<name>...]`` to allow the user to
  define and manage a list of aliases
- Enhanced documentation
- Unifying return codes for remove operations
- [transaction] Make transaction content available for commands
- Add hotfix packages to install pool (RhBug:1654738)
- Report group operation in transaction table
- [sack] Change algorithm to calculate rpmdb_version
- Add basic integration with digest (RhBug:1614351)- Added dnf.repo.Repo.get_http_headers
- Added dnf.repo.Repo.set_http_headers
- Added dnf.repo.Repo.add_metadata_type_to_download
- Added dnf.repo.Repo.get_metadata_path
- Added dnf.repo.Repo.get_metadata_content
- Added --changelogs option for check-update command
- [module] Add information about active modules
- Hide messages created only for logging
- Enhanced --setopt option
- [module] Fix dnf remove @<module>
- [transaction] Make transaction content available for plugins- Backport patches for setting cachedir with --setopt- Update to 4.0.4
- Add dnssec extension
- Set termforce to AUTO to automatically detect if stdout is terminal
- Repoquery command accepts --changelogs option (RhBug:1483458)
- Calculate sack version from all installed packages (RhBug:1624291)
- [module] Allow to enable module dependencies (RhBug:1622566)- [module] Improved module commands list, info
- [module] Reports error from module solver
- Fix: Error detected when calling 'RepoCB.fastestMirror' (RhBug:1628056)
- Preserve packages from other installed mod profiles (RhBug:1629841)
- [spec] Postpone conflict with yum to Fedora 30+ (RhBug:1600444)
- [cli] Install command recommends alternative packages (RhBug:1625586)
- [cli] Fix case insensitive hint (1628514)
- Fix installed profiles for module info (RhBug:1629689)
- Fix module provides not having consistent output (RhBug:1623866)
- Enhance label for transaction table (RhBug:1609919)
- Implement C_, the gettext function with a context (RhBug:1305340)
- Actually disambiguate some messages using C_ (RhBug:1305340)
- Restore 'strict' choice for group installs (#1461539)
- [repoquery] More strict queryformat parsing (RhBug:1631458)
- Redirect repo progress to std error (RhBug:1626011)
- Unify behavior of remove and module remove (RhBug:1629848)
- Change behavior of disabled module for module install (RhBug:1629711)
- Allow enablement on disabled plugin (RhBug:1614539)
- Resolves: rhbz#1622585 - [modularity] dnf should not be proposing distro-sync
- Resolves: rhbz#1614531 - dnf 3.2 does not depsolve correctly
- Bug 1564369 - don't show duplicate errors in dnf output
- Resolves: rhbz#1597257 - dnf should accept localinstall command, at least as an alias
- Resolves: rhbz#1613860 - dnf search behaviour is slightly confusing
- Resolves: rhbz#1625586 - Advise user about alternatives to the non-existing "python" package
- Resolves: rhbz#1614346 - dnf rollback doesn't work after �x�������������(U�����X!Il��������pi��������$��������������������st device access from guest [rhel-av-8.4.0])
- Resolves: bz#1920941
  ([ppc64le] [AV]--disk cdimage.iso,bus=usb fails to boot)
- Resolves: bz#1917830
  (Add romsize property to qemu-kvm)
- Resolves: bz#1917826
  (Add extra device support to qemu-kvm, but not to rhel machine types)
- Resolves: bz#1880299
  (vhost-user mq connection fails to restart after kill host testpmd which acts as vhost-user client)- kvm-virtio-Add-corresponding-memory_listener_unregister-.patch [bz#1903521]
- kvm-block-Honor-blk_set_aio_context-context-requirements.patch [bz#1918966 bz#1918968]
- kvm-nbd-server-Quiesce-coroutines-on-context-switch.patch [bz#1918966 bz#1918968]
- kvm-block-Avoid-processing-BDS-twice-in-bdrv_set_aio_con.patch [bz#1918966 bz#1918968]
- kvm-storage-daemon-Call-bdrv_close_all-on-exit.patch [bz#1918966 bz#1918968]
- kvm-block-move-blk_exp_close_all-to-qemu_cleanup.patch [bz#1918966 bz#1918968]
- Resolves: bz#1903521
  (hot unplug vhost-user cause qemu crash: qemu-kvm: ../softmmu/memory.c:2818: do_address_space_destroy: Assertion `QTAILQ_EMPTY(&as->listeners)' failed.)
- Resolves: bz#1918966
  ([incremental_backup] qemu aborts if guest reboot during backup when using virtio-blk: "aio_co_schedule: Co-routine was already scheduled in 'aio_co_schedule'")
- Resolves: bz#1918968
  ([incremental_backup] qemu deadlock after poweroff in guest during backup in nbd_export_close_all())- kvm-scsi-fix-device-removal-race-vs-IO-restart-callback-.patch [bz#1854811]
- kvm-tracetool-also-strip-l-and-ll-from-systemtap-format-.patch [bz#1907264]
- kvm-redhat-moving-all-documentation-files-to-qemu-kvm-do.patch [bz#1881170 bz#1924766]
- kvm-hw-arm-smmuv3-Fix-addr_mask-for-range-based-invalida.patch [bz#1834152]
- kvm-redhat-makes-qemu-respect-system-s-crypto-profile.patch [bz#1902219]
- kvm-vhost-Unbreak-SMMU-and-virtio-iommu-on-dev-iotlb-sup.patch [bz#1925028]
- kvm-docs-set-CONFDIR-when-running-sphinx.patch [bz#1902537]
- Resolves: bz#1854811
  (scsi-bus.c: use-after-free due to race between device unplug and I/O operation causes guest crash)
- Resolves: bz#1907264
  (systemtap: invalid or missing conversion specifier at the trace event vhost_vdpa_set_log_base)
- Resolves: bz#1881170
  (split documentation from the qemu-kvm-core package to its own subpackage)
- Resolves: bz#1924766
  (split documentation from the qemu-kvm-core package to its own subpackage [av-8.4.0])
- Resolves: bz#1834152
  ([aarch64] QEMU SMMUv3 device: Support range invalidation)
- Resolves: bz#1902219
  (QEMU doesn't honour system crypto policies)
- Resolves: bz#1925028
  (vsmmuv3/vhost and virtio-iommu/vhost regression)
- Resolves: bz#1902537
  (The default fsfreeze-hook path from man page and qemu-ga --help command are different)- kvm-spapr-Allow-memory-unplug-to-always-succeed.patch [bz#1914069]
- kvm-spapr-Improve-handling-of-memory-unplug-with-old-gue.patch [bz#1914069]
- kvm-x86-cpu-Add-AVX512_FP16-cpu-feature.patch [bz#1838738]
- kvm-q35-Increase-max_cpus-to-710-on-pc-q35-rhel8-machine.patch [bz#1904268]
- kvm-config-enable-VFIO_CCW.patch [bz#1922170]
- Resolves: bz#1914069
  ([ppc64le] have this fix for rhel8.4 av (spapr: Allow memory unplug to always succeed))
- Resolves: bz#1838738
  ([Intel 8.4 FEAT] qemu-kvm Sapphire Rapids (SPR) New Instructions (NIs) - Fast Train)
- Resolves: bz#1904268
  ([RFE] [HPEMC] qemu-kvm: support up to 710 VCPUs)
- Resolves: bz#1922170
  (Enable vfio-ccw in AV)- kvm-Drop-bogus-IPv6-messages.patch [bz#1918061]
- Resolves: bz#1918061
  (CVE-2020-10756 virt:rhel/qemu-kvm: QEMU: slirp: networking out-of-bounds read information disclosure vulnerability [rhel-av-8])- kvm-block-nvme-Implement-fake-truncate-coroutine.patch [bz#1848834]
- kvm-spec-find-system-python-via-meson.patch [bz#1899619]
- kvm-build-system-use-b_staticpic-false.patch [bz#1899619]
- kvm-spapr-Fix-buffer-overflow-in-spapr_numa_associativit.patch [bz#1908693]
- kvm-usb-hcd-xhci-pci-Fixup-capabilities-ordering-again.patch [bz#1912846]
- kvm-qga-commands-posix-Send-CCW-address-on-s390x-with-th.patch [bz#1755075]
- kvm-AArch64-machine-types-c�x��������������D�����X"Nk��������H������Ĺ�$T����������������ĹŹù� #1734553 - blkid_get_dev() leak file descriptor to underlying block device
- fix #1719069 - findmnt warning "recommended root FS passno is 1" for XFS- fix #1732769 - lscpu not showing Physical socket, chips information- fix #1681062 - improve loopdev use in gating tests- fix #1699310 - rpm -V setup fail on /var/log/lastlog
- fix #1702712 - pam_env bypassed for root user when using su- fix #1681062 - implement gating tests- fix #1658206 - improve dependence between subpackages- fix #1656437 - Failing tests from testsuite
- fix #1653781 - unable to umount by loop backing file
- fix #1655650 - RHEL8.0 - fdisk -l shows the conflicting partitions name for the mpath
- fix #1653413 - blkid: add --no-part-details to not return metadata from empty partitions- fix #1624877 - libuuid: name-based UUIDs are not compatible with RFC4122- fix #1614967 - Lslogins doesn't fail with nonexisting username
- cleanup patches list- fix #1614364 - losetup: /dev/loop1: failed to set up loop device
- fix #1614852 - mount man page says sync option has no effect for ext4
- fix #1614843 - Man page of logger is missing -S option- refresh lastlog patch 
- fix #1595882 - wipefs should erase also secondary LUKSv2 header* rebuild to verify build flags- upgrade to v2.32.1
  http://www.kernel.org/pub/linux/utils/util-linux/v2.32/v2.32.1-ReleaseNotes- Build only the python3 bindings- sync spec file with Fedora
- move /etc/adjtime config from initscripts to util-linux
- fix #1560642 - uuidd.service does not start
- remove unused build option --enable-libmount-force-mountinfo (it's default now)
- disable assert code- fix #1560283 - column does not properly handle spaces at beginning of tab-separated table columns- upgrade to v2.32- add BuildRequires gcc- upgrade to v2.32-rc1
  http://www.kernel.org/pub/linux/utils/util-linux/v2.32/v2.32-ReleaseNotes- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for switch to libxcrypt- Fix directory ownership in python subpackage- fix dmesg for multi-line records- upgrade to final v2.31
- move rfkill to sbin (for backward compatibility)- fix build error- upgrade to v2.31-rc2
- enable rfkill- temporary disable rfkill (fix #1494855)- upgrade to v2.31-rc1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.31/v2.31-ReleaseNotes- upgrade to v2.30.2
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.30/v2.30.2-ReleaseNotes- make ln-s usage more robust- fix post install script- fix #1390191 - systemd read-only container produces errors- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- upgrade to v2.30.1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.30/v2.30.1-ReleaseNotes- upgrade to v2.30- upgrade to v2.30-rc1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.30/v2.30-ReleaseNotes- upgrade to v2.29.2
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.29/v2.29.2-ReleaseNotes- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- upgrade to v2.29.1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.29/v2.29.1-ReleaseNotes- Rebuild for Python 3.6- upgrade to v2.29- upgrade to v2.29-rc2- upgrade to v2.29-rc1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.29/v2.29-ReleaseNotes- upgrade to stable 2.28.2
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.28/v2.28.2-ReleaseNotes- upgrade to stable 2.28.1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.28/v2.28.1-ReleaseNotes- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- fix #1234317 - CD / DVD are rarely automounted- refresh login-lastlog-create.patch- upgrade to stable v2.28- fix libblkid- upgrade to v2.28-rc2- upgrade to v2.28-rc1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.28/v2.28-ReleaseNotes
- add patch to fix broken swapon
- add subpackage util-linux-user (utils with dependence on libuser)- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- fix #1299255 - boot.iso (from 20160117 Rawhide compose) incorrectly detected as minix FS- fix #1259745 �x��������������3�����X?�k��������8������;������$+����������������;�<�:��gey Fokin <sfokin@cloudlinux.com> - 8.0.30-8.cloudlinux.2Lizi Ekseulidze <lekseulidze@cloudlinux.com> - 8.0.30-8.cloudlinux.1Dan Muey <daniel.muey@webpros.com> - 8.0.30-8Julian Brown <julian.brown@cpanel.net> - 8.0.30-7Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 8.0.30-6.cloudlinux.1Dan Muey <dan@cpanel.net> - 8.0.30-6Julian Brown <julian.brown@cpanel.net> - 8.0.30-5Dmitriy Popov <dpopov@cloudlinux.com> - 8.0.30-4.cloudlinux.1Travis Holloway <t.holloway@cpanel.net> - 8.0.30-4Sergey Fokin <sfokin@cloiudlinux.com> - 1:8.0.30-3.cloudlinux.1Tim Mullin <tim@cpanel.net> - 8.0.30-3Julian Brown <julian.brown@cpanel.net> - 8.0.30-2Cory McIntire <cory@cpanel.net> - 8.0.30-1Cory McIntire <cory@cpanel.net> - 8.0.29-1Travis Holloway <t.holloway@cpanel.net> - 8.0.28-6Julian Brown <julian.brown@cpanel.net> - 8.0.28-5Julian Brown <julian.brown@cpanel.net> - 8.0.28-4Brian Mendoza <brian.mendoza@cpanel.net> - 8.0.28-3Julian Brown <julian.brown@cpanel.net> - 8.0.28-2Cory McIntire <cory@cpanel.net> - 8.0.28-1Tim Mullin <tim@cpanel.net> - 8.0.27-2Cory McIntire <cory@cpanel.net> - 8.0.27-1Cory McIntire <cory@cpanel.net> - 8.0.26-1Travis Holloway <t.holloway@cpanel.net> - 8.0.25-2Cory McIntire <cory@cpanel.net> - 8.0.25-1Cory McIntire <cory@cpanel.net> - 8.0.24-1Julian Brown <julian.brown@cpanel.net> - 8.0.23-3Dan Muey <dan@cpanel.net> - 8.0.23-2Cory McIntire <cory@cpanel.net> - 8.0.23-1Cory McIntire <cory@cpanel.net> - 8.0.22-1Cory McIntire <cory@cpanel.net> - 8.0.21-1Cory McIntire <cory@cpanel.net> - 8.0.20-1Cory McIntire <cory@cpanel.net> - 8.0.19-1Cory McIntire <cory@cpanel.net> - 8.0.18-1Cory McIntire <cory@cpanel.net> - 8.0.17-1Travis Holloway <t.holloway@cpanel.net> - 8.0.16-2Cory McIntire <cory@cpanel.net> - 8.0.16-1Cory McIntire <cory@cpanel.net> - 8.0.15-1Julian Brown <julian.brown@cpanel.net> - 8.0.14-5Dan Muey <dan@cpanel.net> - 8.0.14-4Julian Brown <julian.brown@cpanel.net> - 8.0.14-3Julian Brown <julian.brown@cpanel.net> - 8.0.14-2Cory McIntire <cory@cpanel.net> - 8.0.14-1Cory McIntire <cory@cpanel.net> - 8.0.13-1Dan Muey <dan@cpanel.net> - 8.0.12-2Cory McIntire <cory@cpanel.net> - 8.0.12-1Tim Mullin <tim@cpanel.net> - 8.0.11-4Julian Brown <julian.brown@cpanel.net> - 8.0.11-3Cory McIntire <cory@cpanel.net> - 8.0.11-2Cory McIntire <cory@cpanel.net> - 8.0.11-1Travis Holloway <t.holloway@cpanel.net> - 8.0.10-1Cory McIntire <cory@cpanel.net> - 8.0.9-1Julian Brown <julian.brown@webpros.com> - 8.0.8-2Travis Holloway <t.holloway@cpanel.net> - 8.0.8-1Travis Holloway <t.holloway@cpanel.net> - 8.0.7-2Ivan Danilov <cory@cpanel.net> - 8.0.6-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 8.0.7-1Cory McIntire <cory@cpanel.net> - 8.0.6-1Cory McIntire <cory@cpanel.net> - 8.0.5-1Anatholy Scryabin <ascryabin@cloudlinux.com> - 8.0.3-2.cloudlinux.2Eduard Abdullin <eabdullin@cloudlinux.com> - 8.0.3-2.cloudlinux.1Cory McIntire <cory@cpanel.net> - 8.0.3-2Cory McIntire <cory@cpanel.net> - 8.0.3-1Eduard Abdullin <eabdullin@cloudlinux.com> - 8.0.2-1.cloudlinux.1Cory McIntire <cory@cpanel.net> - 8.0.2-1Tim Mullin <tim@cpanel.net> - 8.0.1-1Eduard Abdullin <eabdullin@cloudlinux.con> - 8.0.0-2.cloudlinux.1Daniel Muey <dan@cpanel.net> - 8.0.0-2Daniel Muey <dan@cpanel.net> - 8.0.0-1Julian Brown <julian.brown@cpanel.net> - 8.0.0rc4-5Daniel Muey <dan@cpanel.net> - 8.0.0rc4-4Daniel Muey <dan@cpanel.net> - 8.0.0rc4-3Daniel Muey <dan@cpanel.net> - 8.0.0rc4-2Daniel Muey <dan@cpanel.net> - 8.0.0rc4-1Daniel Muey <dan@cpanel.net> - 8.0.0rc3-5Tim Mullin <tim@cpanel.net> - 8.0.0rc3-3Daniel Muey <dan@cpanel.net> - 8.0.0rc3-2Daniel Muey <dan@cpanel.net> - 8.0.0rc3-1Daniel Muey <dan@cpanel.net> - 8.0.0beta4-2Daniel Muey <dan@cpanel.net> - 8.0.0beta4-1Julian Brown <julian.brown@cpanel.net> - 8.0.0alpha3-2Julian Brown <julian.brown@cpanel.net> - 8.0.0alpha3-1- EA4D-797: revert to use system libxml2 lib for all platforms- Update php-fpm patch to v4 for per-domain resource isolation support- EA4D-789: Security fixes
- CVE-2024-5458: filter_var URL validation fix
- CV�x������������p#�����XL�l�������������(�$2�����������������(�(�J�?�d����	 �	]���4�8�C�N�i�	��������$	@
\�b
��2x��0p����(890:
G�HI@XPY`\�]�^
qb�d�e�f�ltuTv�w�x�y�T�X�^�����Wg�
/�pt�g�h�Cperl-MIME-Base643.15396.el8Encoding and decoding of Base64 and quoted-printable stringsThis package contains a Base64 encoder/decoder and a quoted-printable
encoder/decoder. These encoding methods are specified in RFC 2045 - MIME
(Multipurpose Internet Mail Extensions).]��build.cloudlinux.com��CloudLinuxCloudLinux(GPL+ or Artistic) and MITCloudLinux Packaging Team <packager@cloudlinux.com>Development/Librarieshttp://search.cpan.org/dist/MIME-Base64/linuxx86_64BJ�>�&!�	�A�A�A큤��A�A��A큤������]��]��]��]��T�-1Q�0;]��]��]��]��T�-�Q�0;]��]��91498dfbc6bd12dc65c54cd637793cd3c5183598f16e2340656310a30c28d0abc28ca1088145029ee83e44257306565889a87a4275eee54260fb19bdccc5b5c746f9ac8b20fedfe223a615df719220248990bb7901666812b42a416e2e885291c47a4e74dca232e24eacb096716d18807501205cc9af2170bccfad6e69639c7408e6898e3d62619e83880832ec42ae8a2984257e4c244843db9d3b9b7fcff236f7c6f7015b96e24fc594c680646a0301ba9a3aeb3372f3db02035fdf63244347399141d28e3a7c8081c61dcdcb57ac0b2895535bcee06b1dcce19b4b50c1e930../../../../usr/lib64/perl5/vendor_perl/auto/MIME/Base64/Base64.sorootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-MIME-Base64-3.15-396.el8.src.rpm����������������������������������������������������perl(MIME::Base64)perl(MIME::QuotedPrint)perl-MIME-Base64perl-MIME-Base64(x86-64)@@@@@@@@@@



@libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)libperl.so.5.26()(64bit)libpthread.so.0()(64bit)perl(:MODULE_COMPAT_5.26.3)perl(Exporter)perl(MIME::Base64)perl(XSLoader)perl(strict)perl(vars)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-1perl4:5.22.0-3474.14.2Z|;�Y�@Yy�Y2��X���W7@V�=@U��@Fedora Release Engineering <releng@fedoraproject.org> - 3.15-396Fedora Release Engineering <releng@fedoraproject.org> - 3.15-395Fedora Release Engineering <releng@fedoraproject.org> - 3.15-394Jitka Plesnikova <jplesnik@redhat.com> - 3.15-393Fedora Release Engineering <releng@fedoraproject.org> - 3.15-366Jitka Plesnikova <jplesnik@redhat.com> - 3.15-365Fedora Release Engineering <releng@fedoraproject.org> - 3.15-349Petr Pisar <ppisar@redhat.com> 3.15-348- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Perl 5.26 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Increase relea�x������Z������������Xk�������� �������Y��$I����������������Y�Z�X��h��(i�N1i�N1i�N1i�N1c85946807e6f2b4cb2e010ced95462cd6bd3144e12d648251136cc2cfec0d6c79ba6429597aeed2d8617a7705b56e96d044f64b07971659382e426675105654bb1ff4ee800da59859c8521f66f4b416d52b9a60fee5e18cd523e9288373abd8ba6e3c01dabf4fe5cb32b20e1f84e55a2aa4309159e102867a1ca8fa7e8acd9919f4593f58d27f969710e506c0d662e6a01d7478d6ad20ba29b8634286e24bc31a41f4a2fab52dea930c509864a0fef1668d00a3252501909e63b4f3a98214c4c5a1fa2a68a1b41362c16564af97b9cff28354e04115cbf28699b99bc68077790943a3b6c2149f0ffa1e4752386dfb7759f06214505a6fc42cea32153e497591959aa0db74ad995083f3b1674fecb9de2a4eb108eb45b64e06e42bcff7a73a86c42ed2b296ec71edc273ad1d5f0f946421941c3b35d6a6c206f93d084dc2cadb3b2c26199e8de21c709f92d6b3b2623e74349489b1f9d7484cd517a4d0f64ea1c4d0d70b1b965a1a7d6ec89c29a6feb20be1a0eda6bd0d71987dea1f95289ff25678b5523f1189758336135bad1e9ae6685bf24a2b0affd981dab02010d573dba32594f21ddcde828b62d4a6df58a7df1b38f158ad73c8284ccdd77db5bc9946e899340365b2b78c1d4917a93356d26a0cabaf70ab1baaa47100cbfda491c61d4021d7ab723860287371db725f07a85ea9a35a4df4d49ab64fbf6389f278e4d1ba4ecdb4721bbd634a117dec56e496e4ab8dbb2fc4d4061aa39b7972bc5a4ddd280f808aa807387728a93c8d1c0c49ac07f356055275f198000ec394bf7a03d8b6b9ebf2ef4231a6abed341f7661453f4c29b2444be909ec6c574a1623aa1d1d6dfa6f78261ffa100c7c1f233a9caf86758a08ddfb8f0f406087bbbe45a6fc45d4e6e6524232672bbb1c6c20c61390bec87329108c86855edafd2ff374d1ee24715501295d0526970cca8898ee86b64a48512ada69c934aeb6ce06f6f8c0ea5ee1fa383556d228ec71541f14ee05c8270155f1fc0ad5c821dff764c2015cad4139a35b974a427a85a948c8f6a988435ed2da6e16664162f4a81797d8ac65fbbb0f4021876ea529f986c4b7b87ebb408860b69326b5c492e9d4cb76baf69da14aab06170e924bd63c10535a4b994b58863c3a16c72e8d143259490a97c56105ffc98fc447d81fb23b81b5da7375e23197928e703f44ae109af6d6bc48753cf503b28cc37a42bea4711f056b929a11dc301cf2e1102383cf52ca67373fd535a945e5735d69a7faf737de5f4b0b3f76e62aaebb432b6f2cec8d9e1b7e67958fb59689d85e75eb6d87658bde3f6518d0300ac99a6d0c551a98420be03d1000b0b45187eef0f5ac569173c365814680e9ba6bc8177b3d596a47fe032a73b283d3a873a17e64a1465d259ea07e62da0d37947118608904c1fa0443c26f594894220f1b956d7c0376be98ba735c08490bc72fbe74644dbf6075f9937b496fbca103660c1f4d6a7eb20caa6000d7bbe13a324ed1285a29e3bc923375431f6f6bfedb62d32d8c5ec652398cf7482c713fb150b1bbcf4ecf758c84d49708e6918f9ddc95bc9029d6207076b93b38cb89814cecadc35336b983070695da8e02e96492286dbedb751f10ee4e658175c521e0c90889f6ddc5533c915613f71d1224a4295f15e93d98f7958cb954c662b98803af54db67e8d39aae60f789891365eafb657b2cb07ffaeda191ee6ad5f48e4886835fbe790ba508754660f8de06c4bb31426d7bbd389f5c34da66ec79006c45326f35d0da4b4ddf1b76517082e329dcb916b8e39232698dd81e7e4b151b8cd8725d0d7e5da607c9ba604802d40eb3acc3e3f4aaa2f9d9563280a1c0036b9acc8ded474f6cae9a77360765083ee8d7b74cdd35fbbd1551a39e689f657830b60a870f5fbc2498e46416840ad8683e082f66f58b2066c5f5bd1814a674a586a2da7ae7d81efac1f9ffd770e56c28527aa27aba80ece1e3f98d64ae7e035372e9c6695349999775e80839c23b7c65d32a779cc266e43c8b8057b1dbd583be851f5d8ef59278df87ca36691831727cc34d247997775a772ce0345efc043ae7ea685e3b10811c0fc710bcbdade589dfb30d35a008362d1623616d56b9d167760c828970b3cdbbcc05a539eb63f57282a628c879334365c48d1e2a26d557be10b1ee41d6702cba0f16fdca7ea0dacf1b4ab19f3aa5f8456b60157ab70af7ec53e1a9a2419853c4b3330722dc43b41759d56d1d1fec70d5ca97d0c8afb1dd4fb82bf5f39f00b65666a20cc1548ec84b55b0f3e8b492b08706a10d7268e8327a3004e7381786ff803391316b60c3b7ea48328783dc90402b040e45081f28502b44c4ac0cb4aba5857495f903df65543566cb6f0d575327c44a9be6f59b79c6e5518e194de164c657b35007652169d7e536ef3dadae4dff897ad4b0d2663457ee1d1f7fc5a378b3f3d9dd407bd097a9ac34cda92c5d23b86a00d5d240a9955ca53b641e9c7c39ff63e71b75c6e60ab0578414f6b723f9744d509b8df7950f55c59e3020a3852e700f9646d16e55a3e1535e5577cc5e2fea3daccb3f88e81c855cc73a1c67d8cfd1e7d4f698dc2cfd50f98740c925b5dc03847c97426315a7449ffde22202db396b483fb2fbe9d29dce34a231da807d5e2a4244dccfe238132140e258733f34b9d1d357aa61fc999cf96912e3de239138ffa2010fde120dd2320fc1cdaaf8deff7636ece56ac48e933d2cf523491a05de5f444e01da226da9293979fba33a323e97c4feb4ea247e86840c050bd190c7d8e0�x�����`>���`�����X�smPa��������������$�������������������@`
���������������xsgbVQE@4/#
���������������ythcWRFA50$�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
z
u
i
d
X
S
G
B
6
1
%
 



���������������{vjeYTHC72&!���������������|wkfZUID83'"�
�
�
�
�
�
�
�
�
�
�
�
�
�
}
x
l
g
[
V
J
E
9
4
(
#




�	�	�	�	�	�	�	�	�	�	�	�	�	�	~	y	m	h	\	W	K	F	:	5	)	$					��������������zni]XLG;6*%���������������{oj^YMH<7+&	���������������|pk_ZNI=8,'
���������������}ql`[OJ>9-(���������������~rma\PK?:.)���������������snb]QL@;/>[;X��>[;X��>[;X��>[;X��>[;X��>[;X��>[;X�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ�����Ӧ��O�w%h�
�A��l���u����>[;p,���q�����>[;�	�6����ڐ���q�.�B�>[;)����u�T���q��K�*�>[;5�9�>[;�	�,���띏\���q�o��6�>[;��<����ڤ���$�T�Pߨ�>[;�(H-���ukOh�>[;�m���q��LD�>[;:	|2�T���`Q
���뤎����q���L;�O�w܁,'�>[;^l/����A�����$�n�#�>[;P(8�>[;ml��q��o�o�>[;�3t�>[;�X+������>��q�
��:�O�w҂���>[;)@5������-�����+�t��$����#�>[;�'dA���.!�>[;�k>��q��D`�>[;*3�b�>[;c�L��q�t��?�O�w�pk�>[;f�"��$�Z�<d�>[;r'�c�����8j�t���>[;�j����q�Ä`c��q�:��A�>[;)P��>{���[�<Ҏ8��O�w�G��
��a' ����C�$��q��(D~�O�w�E�T���IJ�>[;ċ�.��q���,H��oV�qL��M��T�G��|P|��>[;U&@5�����>[;#h�I��q����T�>[;v1�1�>[;tT'�>[;���D��q���P_��oV�$@>[;a�$���ʜ��~G���~�$}��Lxy>[;�P�j�x�q�k��<w>[;#h/t>[;���<s�q�D*<`r�oV�7�)o�����wnG��P��m�]t� -j>[;�$�#j��K�iJ�=��gE�1j3�g	>[;�<c�q�� Dsb�oV�.�_>[;�V_���+��^>!շ�HO]G��:PB]=�v8Z>[;U$�4Z��k�%Y>[;�D|]XE�1Q3hW	�q����rR�oV�/�O>[;�PFO���I��hN�Â����MG��>6��MVg�`�`,LE�1�%<G	>[;G.0E>[;�\`D�q�JA�~BO�w���B@>[;E�#?���C��0>�Â�8g=Vg���@A<>[;O!l6:��뻪D�9>[;F9�
8E�1.x7	>[;�-L)5�q��@2>[;�
S/���p�X.�q���\->[;� �K*�f#ÿ@%)>[;z�$�q��?<">[;�
�"���œ��q�@��M�@���d>[;c�\�2���4���Ш80P�h�>[;�7H5O�w�DN�q��>����̒ ?�q����D
���u���	>[;�6�����\�>[;H(>[;�p�:�q�ʺxO�w���x��������������������X'�k �������������$�������������������?4?�d��'�-�	9�	|�������	
��.�4<\	l
|��
���\|�	�		�	(	�8	�9	�:
�G�HI0X8Y�\
4]
T^
�bmd�e�f�l�t�uv �<�@�F����
��� (g,h0Ccpanel-perl-542-algorithm-dependency1.1121.cp130~el8CPAN module - Base class for implementing various dependency treesCpanel build perl module 'Algorithm::Dependency'Base class for implementing various dependency treesh�pbh-centos-8.dev.cpanel.net�perlcpanel/perlhttps://metacpan.orglinuxnoarchXC��#��,M�$�$�$�$�$�$�$�$^���^���^���^���^���^���^���^���7948a7b6185c63e4ee002716302f0b17036a4774a785bc4a0b8966afe4ab8efeef3e23b6aea9ca11f3614680fda1cd0e559d91df46f1826614ad2acf72b85729079f230ea68313e6c6fcffaf14a55a16f9fdb16ee1e5be3fc7dd5ed9ae09fc2cf0a504b95d28d5ffeb9bf646860905de22c8157b54814ec143dbfe2703b9b76ae4ee77e3ed1492f0cdbcc7e3dd93bbde423dbffa0feaf5daa4eb5288b802aaa927eb2e13f401f45707ef20e3b4a8c8c62027e8697e3ebd00a34eb34b4921c01265b1a224688cce6eb3d9b68d60adf89727da53b7d330feaa569943f9d76b3ff209cf22f6042f11b894388da843e514a2bab946194fc7569795d68974640a955arootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcpanel-perl-542-algorithm-dependency-1.112-1.cp130~el8.src.rpm��������������������������������cpanel-perl(Algorithm::Dependency)cpanel-perl(Algorithm::Dependency::Item)cpanel-perl(Algorithm::Dependency::Ordered)cpanel-perl(Algorithm::Dependency::Source)cpanel-perl(Algorithm::Dependency::Source::File)cpanel-perl(Algorithm::Dependency::Source::HoA)cpanel-perl(Algorithm::Dependency::Source::Invert)cpanel-perl(Algorithm::Dependency::Weight)cpanel-perl-542-algorithm-dependencycpanel-perl-542-algorithm-dependency-itemcpanel-perl-542-algorithm-dependency-orderedcpanel-perl-542-algorithm-dependency-sourcecpanel-perl-542-algorithm-dependency-source-filecpanel-perl-542-algorithm-dependency-source-hoacpanel-perl-542-algorithm-dependency-source-invertcpanel-perl-542-algorithm-dependency-weightcpanel-perl-algorithm-dependencycpanel-perl-algorithm-dependency-itemcpanel-perl-algorithm-dependency-orderedcpanel-perl-algorithm-dependency-sourcecpanel-perl-algorithm-dependency-source-filecpanel-perl-algorithm-dependency-source-hoacpanel-perl-algorithm-dependency-source-invertcpanel-perl-algorithm-dependency-weight




cpanel-perl-542cpanel-perl-542-list-utilcpanel-perl-542-params-utilcpanel-perl-542-strictrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)1.110.313.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h?�b�@`-@_�9�]��@V��@Busy Camels <bc@cpanel.net> - 1.112-1.cp130Busy Camels <bc@cpanel.net> - 1.112-1.cp108Busy Camels <bc@cpanel.net> - 1.112-1.cp1198Todd Rinaldo <toddr@cpan.org> - 1.112-1.cp1194Todd Rinaldo <toddr@cpanel.net> - 1.111-1.cp1186Todd Rinaldo <toddr@cpanel.net> - 1.110-1.cp1156- Bump to 1.cp130 for re-build- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Algorithm-Dependency 1.112- Update from upstream: Algorithm-Dependency 1.111- Update from upstream: Algorithm-Dependency 1.11��������x�������������X��������������������P���������������������������������������������~ #